BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034200
         (101 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N91|A Chain A, Solution Nmr Structure Of Protein Yggu From Escherichia
          Coli. Northeast Structural Genomics Consortium Target
          Er14.
 pdb|1YH5|A Chain A, Solution Nmr Structure Of Protein Yggu From Escherichia
          Coli. Northeast Structural Genomics Consortium Target
          Er14
          Length = 108

 Score = 29.3 bits (64), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 42 ITIHAKPGSKSCSITDVSDEAVGVQIDAPAKDGEANAALLEYM 84
          + ++ +P +   SI  +  + V V I AP  DG+AN+ L++++
Sbjct: 17 LRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFL 59


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.125    0.346 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,965,629
Number of Sequences: 62578
Number of extensions: 57875
Number of successful extensions: 120
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 119
Number of HSP's gapped (non-prelim): 1
length of query: 101
length of database: 14,973,337
effective HSP length: 67
effective length of query: 34
effective length of database: 10,780,611
effective search space: 366540774
effective search space used: 366540774
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)