Query         034219
Match_columns 101
No_of_seqs    95 out of 97
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 11:05:40 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034219.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034219hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01102 Glycophorin_A:  Glycop  92.1    0.14 3.1E-06   37.0   2.7   33   18-51     60-92  (122)
  2 PF02439 Adeno_E3_CR2:  Adenovi  90.2    0.65 1.4E-05   27.8   3.8   28   26-53      8-35  (38)
  3 PF07204 Orthoreo_P10:  Orthore  86.6    0.58 1.3E-05   33.1   2.3   37   17-53     36-72  (98)
  4 TIGR00822 EII-Sor PTS system,   74.1     6.5 0.00014   31.6   4.6   27   22-48    205-235 (265)
  5 PF05283 MGC-24:  Multi-glycosy  73.2     3.7 7.9E-05   31.7   2.8   22   24-45    161-182 (186)
  6 PF13214 DUF4022:  Protein of u  73.2     3.7   8E-05   28.0   2.5   24   29-52      8-47  (83)
  7 TIGR00847 ccoS cytochrome oxid  70.8       8 0.00017   24.2   3.5   23   23-45      3-25  (51)
  8 PF15347 PAG:  Phosphoprotein a  69.4       4 8.7E-05   35.2   2.5   23   26-48     17-39  (428)
  9 PF05151 PsbM:  Photosystem II   68.4     4.3 9.3E-05   23.4   1.7   14   34-47      6-19  (31)
 10 PF03597 CcoS:  Cytochrome oxid  66.8      11 0.00024   22.9   3.4   23   23-45      2-24  (45)
 11 PF11174 DUF2970:  Protein of u  65.4      11 0.00024   23.8   3.4   19   20-38     28-46  (56)
 12 PRK09757 PTS system N-acetylga  64.5       9 0.00019   30.7   3.5   28   22-49    206-238 (267)
 13 PF04277 OAD_gamma:  Oxaloaceta  63.9     5.6 0.00012   25.3   1.8   11   75-85     61-71  (79)
 14 PRK13592 ubiA prenyltransferas  63.6     9.1  0.0002   31.5   3.4   29   20-48    232-261 (299)
 15 PF15048 OSTbeta:  Organic solu  62.4     9.7 0.00021   28.0   3.0   26   21-46     33-58  (125)
 16 PF11980 DUF3481:  Domain of un  61.9     9.4  0.0002   26.6   2.8   20   25-44     18-37  (87)
 17 PRK11486 flagellar biosynthesi  60.1      20 0.00043   26.1   4.3   16   73-88     61-76  (124)
 18 PF14575 EphA2_TM:  Ephrin type  58.7      12 0.00025   24.6   2.7   23   30-52      7-29  (75)
 19 PF02480 Herpes_gE:  Alphaherpe  58.3     3.3 7.1E-05   35.3   0.0   16   15-30    343-358 (439)
 20 TIGR02976 phageshock_pspB phag  56.5      13 0.00029   24.7   2.7   28   25-52      3-30  (75)
 21 PRK12785 fliL flagellar basal   56.1      11 0.00024   27.8   2.5   19   75-94     70-90  (166)
 22 PF06697 DUF1191:  Protein of u  55.4     5.2 0.00011   32.7   0.7   61   14-91    208-270 (278)
 23 PF02480 Herpes_gE:  Alphaherpe  55.2       4 8.6E-05   34.8   0.0   44   10-53    342-385 (439)
 24 PF14914 LRRC37AB_C:  LRRC37A/B  55.0      16 0.00035   27.7   3.2   27   26-52    121-150 (154)
 25 PF12911 OppC_N:  N-terminal TM  54.8      15 0.00033   21.7   2.5   12   33-44     19-30  (56)
 26 PF01299 Lamp:  Lysosome-associ  54.2      12 0.00025   29.7   2.5   26   27-53    276-301 (306)
 27 PF10215 Ost4:  Oligosaccaryltr  53.4      24 0.00052   20.6   3.1   18   27-44      7-24  (35)
 28 CHL00080 psbM photosystem II p  53.3      14 0.00031   21.6   2.2   13   33-45      5-17  (34)
 29 PF06667 PspB:  Phage shock pro  53.2      17 0.00036   24.4   2.7   28   25-52      3-30  (75)
 30 PF05399 EVI2A:  Ectropic viral  52.9      14  0.0003   29.7   2.7   19   30-48    128-146 (227)
 31 PF09928 DUF2160:  Predicted sm  52.7      15 0.00033   25.5   2.6   22   18-39      3-24  (88)
 32 PF12273 RCR:  Chitin synthesis  52.5     5.3 0.00012   28.0   0.3   20   32-51      4-23  (130)
 33 COG5416 Uncharacterized integr  52.4      20 0.00044   25.4   3.2   29   16-44     54-82  (98)
 34 TIGR03038 PS_II_psbM photosyst  51.4      16 0.00035   21.3   2.2   13   33-45      5-17  (33)
 35 PF01102 Glycophorin_A:  Glycop  51.4      24 0.00053   25.4   3.6   32   25-56     69-100 (122)
 36 PF07172 GRP:  Glycine rich pro  51.3      14 0.00031   25.4   2.3    7   45-51     22-28  (95)
 37 PRK14094 psbM photosystem II r  51.1      15 0.00033   23.2   2.1   13   33-45      5-17  (50)
 38 PHA03283 envelope glycoprotein  49.9      32 0.00069   30.8   4.7   30   17-48    393-424 (542)
 39 PF13295 DUF4077:  Domain of un  49.8     6.4 0.00014   29.7   0.4   27   25-51    114-140 (175)
 40 PHA02909 hypothetical protein;  48.8      20 0.00044   23.7   2.6    9   41-49     49-57  (72)
 41 PRK04989 psbM photosystem II r  48.2      19 0.00041   21.2   2.1   13   33-45      5-17  (35)
 42 PF15339 Afaf:  Acrosome format  47.7      26 0.00056   27.6   3.4   24   25-48    131-154 (200)
 43 PF01998 DUF131:  Protein of un  47.5      12 0.00026   24.3   1.4   26   20-45     31-59  (64)
 44 PRK05419 putative sulfite oxid  46.3      26 0.00057   26.8   3.3   30   22-51    113-142 (205)
 45 PF03229 Alpha_GJ:  Alphavirus   45.5      70  0.0015   23.6   5.2   17   17-33     75-96  (126)
 46 COG4594 FecB ABC-type Fe3+-cit  44.9      45 0.00097   27.9   4.6   21   30-50      6-26  (310)
 47 COG4961 TadG Flp pilus assembl  43.9      24 0.00052   26.0   2.7   20   28-47     21-40  (185)
 48 PF06305 DUF1049:  Protein of u  43.7      43 0.00093   20.3   3.4   30   15-44     10-40  (68)
 49 PF06596 PsbX:  Photosystem II   42.1      44 0.00095   20.1   3.1   20   26-45     12-31  (39)
 50 PRK13726 conjugal transfer pil  41.0      51  0.0011   25.1   4.1   27   26-52     16-42  (188)
 51 PF15345 TMEM51:  Transmembrane  40.7      27 0.00059   28.1   2.6   32   14-45     51-82  (233)
 52 PF14241 DUF4341:  Domain of un  40.4      46   0.001   21.0   3.2   22   21-44      1-22  (62)
 53 PTZ00370 STEVOR; Provisional    40.1      31 0.00066   28.7   2.9   23   29-51    258-282 (296)
 54 PF09049 SNN_transmemb:  Stanni  39.8      76  0.0017   18.4   4.2   27   20-49      6-33  (33)
 55 TIGR01478 STEVOR variant surfa  39.5      31 0.00068   28.6   2.9   23   29-51    262-286 (295)
 56 PF04906 Tweety:  Tweety;  Inte  39.0      53  0.0011   27.5   4.2   19   37-55    372-393 (406)
 57 COG3715 ManY Phosphotransferas  38.7      86  0.0019   25.6   5.3   13   21-33    204-216 (265)
 58 PF06103 DUF948:  Bacterial pro  38.5      30 0.00064   22.5   2.2   13   36-48      5-17  (90)
 59 PRK09458 pspB phage shock prot  37.8      41 0.00088   22.7   2.8   28   25-52      3-30  (75)
 60 PF05568 ASFV_J13L:  African sw  37.7      47   0.001   25.7   3.5   19   33-51     39-57  (189)
 61 PRK05696 fliL flagellar basal   37.4 1.4E+02  0.0031   21.7   5.9   20   75-94     71-90  (170)
 62 PF05255 UPF0220:  Uncharacteri  36.6      46   0.001   25.0   3.2   26   25-50    102-127 (166)
 63 COG4736 CcoQ Cbb3-type cytochr  36.6      63  0.0014   20.8   3.4   27   26-52      5-31  (60)
 64 PF15330 SIT:  SHP2-interacting  36.6      52  0.0011   23.1   3.3   26   27-52      3-28  (107)
 65 PRK15065 PTS system mannose-sp  35.3      90   0.002   25.1   4.9   27   22-48    206-236 (262)
 66 PF11143 DUF2919:  Protein of u  35.1      50  0.0011   24.3   3.2   23   29-52     57-79  (149)
 67 PF10717 ODV-E18:  Occlusion-de  34.7      65  0.0014   22.4   3.4   24   33-56     28-51  (85)
 68 PHA00736 hypothetical protein   34.4      37  0.0008   23.0   2.1   14   26-39     57-70  (79)
 69 PF13903 Claudin_2:  PMP-22/EMP  34.3      67  0.0014   21.8   3.5   25   26-50     73-97  (172)
 70 PRK13415 flagella biosynthesis  33.2 1.5E+02  0.0032   23.6   5.7   24   14-39     61-84  (219)
 71 PF10883 DUF2681:  Protein of u  32.3      49  0.0011   22.7   2.5   20   33-52      7-26  (87)
 72 PF01794 Ferric_reduct:  Ferric  32.3      93   0.002   20.1   3.8   27   22-48     76-102 (125)
 73 PTZ00260 dolichyl-phosphate be  32.2 1.8E+02  0.0039   23.2   6.1   25   23-52     12-36  (333)
 74 PF12048 DUF3530:  Protein of u  32.1      60  0.0013   26.0   3.4   12   78-89     62-73  (310)
 75 PF13807 GNVR:  G-rich domain o  31.8      95  0.0021   19.8   3.7   19   20-38     54-72  (82)
 76 PF15240 Pro-rich:  Proline-ric  30.3      36 0.00077   26.3   1.8   13   33-45      2-14  (179)
 77 KOG3626 Organic anion transpor  30.3 1.2E+02  0.0027   27.9   5.4   27   24-50    673-699 (735)
 78 PRK10081 entericidin B membran  30.1      66  0.0014   20.1   2.6   21   30-50      6-26  (48)
 79 PF10826 DUF2551:  Protein of u  29.8      42  0.0009   23.1   1.8   19   27-45     43-61  (83)
 80 PF04133 Vps55:  Vacuolar prote  29.7      58  0.0013   23.3   2.7   19   33-51      6-24  (120)
 81 cd02435 CCC1 CCC1. CCC1: This   29.3      86  0.0019   24.6   3.8   29   23-51    173-206 (241)
 82 PF15471 TMEM171:  Transmembran  29.1      96  0.0021   26.0   4.1   25   31-55    166-190 (319)
 83 PLN00090 photosystem II reacti  28.9      82  0.0018   22.7   3.3   13   33-45     75-87  (113)
 84 PRK12430 putative bifunctional  28.8 1.1E+02  0.0024   26.3   4.5   17   72-88     65-81  (379)
 85 PLN00085 photosystem II reacti  28.7      49  0.0011   24.8   2.2   15   33-47     82-96  (149)
 86 PRK07021 fliL flagellar basal   28.4 2.1E+02  0.0045   20.7   5.5   19   75-94     63-82  (162)
 87 PRK11486 flagellar biosynthesi  28.4      78  0.0017   23.0   3.2   15   25-39     20-34  (124)
 88 PRK10884 SH3 domain-containing  28.0      53  0.0012   25.3   2.4   17   25-42    174-190 (206)
 89 PF10577 UPF0560:  Uncharacteri  28.0      77  0.0017   29.7   3.7   23   24-46    273-295 (807)
 90 PF14991 MLANA:  Protein melan-  27.9      20 0.00043   26.2   0.0   18   34-51     32-49  (118)
 91 PF01594 UPF0118:  Domain of un  27.9      90   0.002   23.9   3.6   26   25-50    302-327 (327)
 92 PRK11246 hypothetical protein;  27.7      99  0.0021   24.6   3.9   30   23-52    164-194 (218)
 93 PF06800 Sugar_transport:  Suga  27.5      77  0.0017   25.6   3.3   32   16-51     94-125 (269)
 94 PF06387 Calcyon:  D1 dopamine   27.4      46   0.001   26.0   1.9   14   34-47     85-98  (186)
 95 PF06814 Lung_7-TM_R:  Lung sev  27.3   1E+02  0.0022   24.0   3.9   38   14-51     38-75  (295)
 96 PF05454 DAG1:  Dystroglycan (D  26.7      21 0.00047   29.2   0.0   13   39-51    161-173 (290)
 97 TIGR03007 pepcterm_ChnLen poly  26.4 1.1E+02  0.0025   25.3   4.2   30   22-51    411-440 (498)
 98 TIGR03054 photo_alph_chp1 puta  26.2 1.9E+02   0.004   21.3   4.8   24   29-52      3-26  (135)
 99 PF07589 VPEP:  PEP-CTERM motif  26.1      85  0.0018   16.6   2.3   11   36-46     10-20  (25)
100 TIGR03363 VI_chp_8 type VI sec  26.0      33 0.00071   28.0   0.9    8   20-27    313-320 (353)
101 PF12259 DUF3609:  Protein of u  26.0      59  0.0013   27.2   2.4   23   29-52    302-324 (361)
102 PF03381 CDC50:  LEM3 (ligand-e  25.9 1.4E+02   0.003   23.8   4.5   32   19-50    241-272 (278)
103 cd01059 CCC1_like CCC1-related  25.6 1.3E+02  0.0028   21.3   3.9   29   23-51     79-113 (143)
104 COG4885 Uncharacterized protei  25.5      59  0.0013   27.1   2.3   23   29-51    289-311 (312)
105 CHL00066 psbH photosystem II p  25.4   1E+02  0.0022   20.8   3.1   21   30-50     43-63  (73)
106 PRK13792 lysozyme inhibitor; P  25.4      39 0.00084   24.6   1.1   21   31-51      4-24  (127)
107 PF04478 Mid2:  Mid2 like cell   25.4      20 0.00044   27.1  -0.3   23   29-51     57-79  (154)
108 PTZ00201 amastin surface glyco  25.4 1.4E+02  0.0031   23.0   4.3   25   26-50    154-178 (192)
109 TIGR03501 gamma_C_targ gammapr  24.7      80  0.0017   17.2   2.1   17   34-50      5-21  (26)
110 PF13623 SurA_N_2:  SurA N-term  24.4      71  0.0015   23.2   2.4   17   32-48     10-26  (145)
111 KOG0499 Cyclic nucleotide-gate  24.3      82  0.0018   29.3   3.2   25   20-44    425-449 (815)
112 PF11153 DUF2931:  Protein of u  24.2      63  0.0014   24.2   2.1   18   35-52      5-22  (216)
113 PF13908 Shisa:  Wnt and FGF in  24.1      37 0.00079   24.8   0.8    7   19-25     69-75  (179)
114 cd04821 PA_M28_1_2 PA_M28_1_2:  23.7      60  0.0013   24.0   1.9   15   73-87     45-59  (157)
115 PF04976 DmsC:  DMSO reductase   23.6 1.2E+02  0.0025   23.9   3.6   27   15-41    141-168 (276)
116 PF11353 DUF3153:  Protein of u  23.5      96  0.0021   23.3   3.0    7   14-20    177-183 (209)
117 cd07387 MPP_PolD2_C PolD2 (DNA  23.5      50  0.0011   26.2   1.5   16   81-96     97-112 (257)
118 TIGR02830 spore_III_AG stage I  23.2      76  0.0016   24.4   2.4   18   30-47      5-22  (186)
119 PRK14061 unknown domain/lipoat  23.1 1.7E+02  0.0037   26.2   4.8   30   23-52    164-194 (562)
120 PF06365 CD34_antigen:  CD34/Po  22.6      48   0.001   25.9   1.3   28   23-51     99-129 (202)
121 PHA03231 glycoprotein BALF4; P  22.5      74  0.0016   29.8   2.6   29   17-49    698-726 (829)
122 PRK02624 psbH photosystem II r  22.3 1.3E+02  0.0028   19.9   3.0   21   30-50     31-51  (64)
123 PRK13823 conjugal transfer pro  22.3      75  0.0016   21.9   2.0   11   30-40     25-35  (94)
124 PF04964 Flp_Fap:  Flp/Fap pili  21.8      86  0.0019   18.6   2.0   13   31-43     14-26  (46)
125 PF15470 DUF4637:  Domain of un  21.6      24 0.00051   27.1  -0.6   17   14-31     90-106 (173)
126 PF04961 FTCD_C:  Formiminotran  21.4 1.2E+02  0.0027   22.6   3.2   21   28-48     20-40  (184)
127 COG1704 LemA Uncharacterized c  21.2      96  0.0021   24.1   2.6   23   30-52      4-26  (185)
128 PF09680 Tiny_TM_bacill:  Prote  21.2      69  0.0015   17.5   1.3   19   29-48      5-23  (24)
129 TIGR03750 conj_TIGR03750 conju  21.1 1.5E+02  0.0032   21.2   3.4   28   22-49     40-69  (111)
130 PF05915 DUF872:  Eukaryotic pr  21.0 1.8E+02  0.0038   20.6   3.8   27   23-49     39-65  (115)
131 PLN00055 photosystem II reacti  20.6 1.4E+02  0.0031   20.1   3.0   21   30-50     43-63  (73)
132 PF07937 DUF1686:  Protein of u  20.6      94   0.002   24.3   2.5   18   33-50    129-146 (185)
133 cd02437 CCC1_like_1 CCC1-relat  20.4 1.8E+02  0.0039   21.3   3.8   15   37-51    131-145 (175)
134 PRK12361 hypothetical protein;  20.2 1.4E+02   0.003   25.5   3.6   14   37-50     37-50  (547)

No 1  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=92.14  E-value=0.14  Score=36.98  Aligned_cols=33  Identities=18%  Similarity=0.280  Sum_probs=23.3

Q ss_pred             cccCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           18 QWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        18 ~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      .+..|+ -....|++|.|+|++.|||+-|-+|+.
T Consensus        60 ~fs~~~-i~~Ii~gv~aGvIg~Illi~y~irR~~   92 (122)
T PF01102_consen   60 RFSEPA-IIGIIFGVMAGVIGIILLISYCIRRLR   92 (122)
T ss_dssp             SSS-TC-HHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             Cccccc-eeehhHHHHHHHHHHHHHHHHHHHHHh
Confidence            444454 244568899999999999988887554


No 2  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=90.17  E-value=0.65  Score=27.83  Aligned_cols=28  Identities=18%  Similarity=0.577  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 034219           26 MFGGLLLVFGVIAVALMFLACCHDKSSI   53 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy~k~~s   53 (101)
                      ...|..+-|.+|.+..++-+|-|||...
T Consensus         8 IIv~V~vg~~iiii~~~~YaCcykk~~~   35 (38)
T PF02439_consen    8 IIVAVVVGMAIIIICMFYYACCYKKHRR   35 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHccccc
Confidence            5677778888888888999999999753


No 3  
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=86.62  E-value=0.58  Score=33.15  Aligned_cols=37  Identities=24%  Similarity=0.329  Sum_probs=29.2

Q ss_pred             ccccCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 034219           17 VQWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKSSI   53 (101)
Q Consensus        17 ~~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k~~s   53 (101)
                      +..-+=.|||-+|=+++|.||-++|+.-.|.+||.+.
T Consensus        36 S~~~ayWpyLA~GGG~iLilIii~Lv~CC~~K~K~~~   72 (98)
T PF07204_consen   36 SSFVAYWPYLAAGGGLILILIIIALVCCCRAKHKTSA   72 (98)
T ss_pred             ehHHhhhHHhhccchhhhHHHHHHHHHHhhhhhhhHh
Confidence            5566678999999888888888888777777788543


No 4  
>TIGR00822 EII-Sor PTS system, mannose/fructose/sorbose family, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters.
Probab=74.07  E-value=6.5  Score=31.62  Aligned_cols=27  Identities=19%  Similarity=0.242  Sum_probs=18.7

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 034219           22 PLPYMFGGLLLVFGV----IAVALMFLACCH   48 (101)
Q Consensus        22 PvPYLFgGLa~MlgL----IAvALliLaCSy   48 (101)
                      =.||+|.|+.++--+    +++|++-++|.+
T Consensus       205 ~~~ff~lGF~laayl~l~~l~iAiig~~~A~  235 (265)
T TIGR00822       205 LMPFFYLGFLFAAYTDFSLLAFGAVGGAGAL  235 (265)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            479999999876443    666666555554


No 5  
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=73.21  E-value=3.7  Score=31.69  Aligned_cols=22  Identities=27%  Similarity=0.720  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Q 034219           24 PYMFGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        24 PYLFgGLa~MlgLIAvALliLa   45 (101)
                      .-++||+.+.|||+||.++++-
T Consensus       161 ~SFiGGIVL~LGv~aI~ff~~K  182 (186)
T PF05283_consen  161 ASFIGGIVLTLGVLAIIFFLYK  182 (186)
T ss_pred             hhhhhHHHHHHHHHHHHHHHhh
Confidence            3489999999999999887753


No 6  
>PF13214 DUF4022:  Protein of unknown function (DUF4022)
Probab=73.17  E-value=3.7  Score=27.96  Aligned_cols=24  Identities=29%  Similarity=0.520  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHH---------------Hhhh-cccC
Q 034219           29 GLLLVFGVIAVALMFL---------------ACCH-DKSS   52 (101)
Q Consensus        29 GLa~MlgLIAvALliL---------------aCSy-~k~~   52 (101)
                      |+--+|.++.+||++|               .||| ||-+
T Consensus         8 gm~~imsistlallllaevlvaiiligisieicsygwkks   47 (83)
T PF13214_consen    8 GMNHIMSISTLALLLLAEVLVAIILIGISIEICSYGWKKS   47 (83)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHhhhceeeeeccccccC
Confidence            3444555566666555               4999 7754


No 7  
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=70.80  E-value=8  Score=24.22  Aligned_cols=23  Identities=9%  Similarity=0.249  Sum_probs=18.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHH
Q 034219           23 LPYMFGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        23 vPYLFgGLa~MlgLIAvALliLa   45 (101)
                      +-|+..++++++|+++++.++.+
T Consensus         3 il~~LIpiSl~l~~~~l~~f~Wa   25 (51)
T TIGR00847         3 ILTILIPISLLLGGVGLVAFLWS   25 (51)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Confidence            45888899999998888777766


No 8  
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=69.44  E-value=4  Score=35.22  Aligned_cols=23  Identities=17%  Similarity=0.566  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q 034219           26 MFGGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy   48 (101)
                      |.|+||++--++-|.+||+.||-
T Consensus        17 lwgsLaav~~f~lis~LifLCsS   39 (428)
T PF15347_consen   17 LWGSLAAVTTFLLISFLIFLCSS   39 (428)
T ss_pred             eehHHHHHHHHHHHHHHHHHhhc
Confidence            56899998888888899998886


No 9  
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=68.43  E-value=4.3  Score=23.37  Aligned_cols=14  Identities=36%  Similarity=0.420  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHhh
Q 034219           34 FGVIAVALMFLACC   47 (101)
Q Consensus        34 lgLIAvALliLaCS   47 (101)
                      +|+||.||.|+.++
T Consensus         6 l~fiAtaLfi~iPt   19 (31)
T PF05151_consen    6 LAFIATALFILIPT   19 (31)
T ss_dssp             THHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHH
Confidence            57788888887664


No 10 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=66.81  E-value=11  Score=22.87  Aligned_cols=23  Identities=30%  Similarity=0.560  Sum_probs=17.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHH
Q 034219           23 LPYMFGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        23 vPYLFgGLa~MlgLIAvALliLa   45 (101)
                      +-|+..+++.++|+++++.++.+
T Consensus         2 ~l~~lip~sl~l~~~~l~~f~Wa   24 (45)
T PF03597_consen    2 ILYILIPVSLILGLIALAAFLWA   24 (45)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHH
Confidence            34788888888888887777665


No 11 
>PF11174 DUF2970:  Protein of unknown function (DUF2970);  InterPro: IPR021344  This short family is conserved in Proteobacteria. The function is not known. 
Probab=65.44  E-value=11  Score=23.80  Aligned_cols=19  Identities=26%  Similarity=0.551  Sum_probs=14.4

Q ss_pred             cCChhHHHHHHHHHHHHHH
Q 034219           20 NSPLPYMFGGLLLVFGVIA   38 (101)
Q Consensus        20 ~SPvPYLFgGLa~MlgLIA   38 (101)
                      .+|.||++.|+.+.+.+|+
T Consensus        28 ~~p~~~Ii~gii~~~~fV~   46 (56)
T PF11174_consen   28 GSPVHFIIVGIILAALFVA   46 (56)
T ss_pred             CCCchHHHHHHHHHHHHHH
Confidence            4799999999876665554


No 12 
>PRK09757 PTS system N-acetylgalactosamine-specific transporter subunit IIC; Provisional
Probab=64.49  E-value=9  Score=30.75  Aligned_cols=28  Identities=25%  Similarity=0.497  Sum_probs=19.4

Q ss_pred             ChhHHHHHHHHH--HH---HHHHHHHHHHhhhc
Q 034219           22 PLPYMFGGLLLV--FG---VIAVALMFLACCHD   49 (101)
Q Consensus        22 PvPYLFgGLa~M--lg---LIAvALliLaCSy~   49 (101)
                      =.||+|.|+.+.  ++   +|++|++-++|.+.
T Consensus       206 ~~~ff~lGF~l~ayl~~~~~i~iaiig~~iA~~  238 (267)
T PRK09757        206 YIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVY  238 (267)
T ss_pred             hHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHH
Confidence            479999998764  32   57777776666653


No 13 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=63.86  E-value=5.6  Score=25.31  Aligned_cols=11  Identities=18%  Similarity=0.051  Sum_probs=6.5

Q ss_pred             CCCCceEEEec
Q 034219           75 ALEPKIVVIMA   85 (101)
Q Consensus        75 ~~e~kivVIMA   85 (101)
                      +.++.+.||+|
T Consensus        61 ~~~~~vAaI~A   71 (79)
T PF04277_consen   61 DDPELVAAIAA   71 (79)
T ss_pred             CChHHHHHHHH
Confidence            55566666654


No 14 
>PRK13592 ubiA prenyltransferase; Provisional
Probab=63.57  E-value=9.1  Score=31.49  Aligned_cols=29  Identities=14%  Similarity=0.006  Sum_probs=23.1

Q ss_pred             cCChhHH-HHHHHHHHHHHHHHHHHHHhhh
Q 034219           20 NSPLPYM-FGGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        20 ~SPvPYL-FgGLa~MlgLIAvALliLaCSy   48 (101)
                      -||.||+ ++.++..+.+++.++++++|..
T Consensus       232 ~s~lp~~~~g~~g~~~l~~~~~~~l~~~~~  261 (299)
T PRK13592        232 TNFALLWNISHVGVVVLVLNVIWMTVQFEQ  261 (299)
T ss_pred             HhhHHHHHhhhhHHHHHHHHHHHHHHHHHH
Confidence            4789999 8877777777888888888863


No 15 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=62.39  E-value=9.7  Score=28.00  Aligned_cols=26  Identities=27%  Similarity=0.254  Sum_probs=21.7

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHHHh
Q 034219           21 SPLPYMFGGLLLVFGVIAVALMFLAC   46 (101)
Q Consensus        21 SPvPYLFgGLa~MlgLIAvALliLaC   46 (101)
                      ||--|-..+|+++..+|.|.||...-
T Consensus        33 tpWNysiL~Ls~vvlvi~~~LLgrsi   58 (125)
T PF15048_consen   33 TPWNYSILALSFVVLVISFFLLGRSI   58 (125)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHh
Confidence            56669999999999999999987643


No 16 
>PF11980 DUF3481:  Domain of unknown function (DUF3481);  InterPro: IPR022579  This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptor family of proteins. It is found in association with PF00754 from PFAM, PF00431 from PFAM and PF00629 from PFAM. There are two completely conserved residues (Y and E) that may be functionally important.
Probab=61.91  E-value=9.4  Score=26.56  Aligned_cols=20  Identities=20%  Similarity=0.190  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034219           25 YMFGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliL   44 (101)
                      |++.|=++.+.|++++|.++
T Consensus        18 yiiA~gga~llL~~v~l~vv   37 (87)
T PF11980_consen   18 YIIAMGGALLLLVAVCLGVV   37 (87)
T ss_pred             HHHhhccHHHHHHHHHHHHH
Confidence            56777777777788875544


No 17 
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=60.10  E-value=20  Score=26.08  Aligned_cols=16  Identities=13%  Similarity=0.304  Sum_probs=11.3

Q ss_pred             CCCCCCceEEEecCCC
Q 034219           73 PAALEPKIVVIMAGDD   88 (101)
Q Consensus        73 ~~~~e~kivVIMAGd~   88 (101)
                      ++-.+|||+||=.||+
T Consensus        61 slG~RErvvvVeV~~~   76 (124)
T PRK11486         61 SLGARERVVIVDVEDA   76 (124)
T ss_pred             ccCCccEEEEEEECCE
Confidence            4556788888877764


No 18 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=58.74  E-value=12  Score=24.58  Aligned_cols=23  Identities=9%  Similarity=0.327  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccC
Q 034219           30 LLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k~~   52 (101)
                      ++.++.|+++.++++.|.+++..
T Consensus         7 ~~g~~~ll~~v~~~~~~~rr~~~   29 (75)
T PF14575_consen    7 IVGVLLLLVLVIIVIVCFRRCKY   29 (75)
T ss_dssp             HHHHHHHHHHHHHHHCCCTT---
T ss_pred             HHHHHHHHHhheeEEEEEeeEcC
Confidence            44455555566667777776653


No 19 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=58.32  E-value=3.3  Score=35.29  Aligned_cols=16  Identities=13%  Similarity=-0.024  Sum_probs=0.0

Q ss_pred             ccccccCChhHHHHHH
Q 034219           15 GLVQWNSPLPYMFGGL   30 (101)
Q Consensus        15 ~~~~W~SPvPYLFgGL   30 (101)
                      ....|.++.-.+.+++
T Consensus       343 ~p~~~~~~~~~~l~vV  358 (439)
T PF02480_consen  343 PPSPRTSRGAALLGVV  358 (439)
T ss_dssp             ----------------
T ss_pred             CCCCCCCcccchHHHH
Confidence            3355666655555554


No 20 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=56.49  E-value=13  Score=24.71  Aligned_cols=28  Identities=25%  Similarity=0.243  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      +.|..+-+++++|-||.+-|..-|++..
T Consensus         3 ~~fl~~Pliif~ifVap~wl~lHY~~k~   30 (75)
T TIGR02976         3 IFFLAIPLIIFVIFVAPLWLILHYRSKR   30 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            4577777788888888888888886443


No 21 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=56.08  E-value=11  Score=27.79  Aligned_cols=19  Identities=21%  Similarity=0.324  Sum_probs=13.1

Q ss_pred             CCCCceEEEecCCCC--Cceec
Q 034219           75 ALEPKIVVIMAGDDH--PTRIA   94 (101)
Q Consensus        75 ~~e~kivVIMAGd~~--PTfLA   94 (101)
                      +.++ |+|=+++++.  ..||-
T Consensus        70 ~l~~-fvVNL~~~~~~~~ryLk   90 (166)
T PRK12785         70 DVPD-MLVNLAGDPGERVQYLK   90 (166)
T ss_pred             EcCC-EEEECCCCCCCcceEEE
Confidence            4444 9999988753  57863


No 22 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=55.38  E-value=5.2  Score=32.69  Aligned_cols=61  Identities=15%  Similarity=0.128  Sum_probs=31.2

Q ss_pred             cccccccCChhHHHHH-HHHHHHHHHHHHHHHHhhhcccCCCCCCCCCCccccccccCCCCCCCCCceEEEecCCCC-Cc
Q 034219           14 AGLVQWNSPLPYMFGG-LLLVFGVIAVALMFLACCHDKSSITGPSSGDQKDEKSAEAIDPPAALEPKIVVIMAGDDH-PT   91 (101)
Q Consensus        14 ~~~~~W~SPvPYLFgG-La~MlgLIAvALliLaCSy~k~~s~~~s~~~~~~ek~~~~~~~~~~~e~kivVIMAGd~~-PT   91 (101)
                      ...|-|.     +.+| ..-.++|+-++++++.|.++|....-            .++|...+.+|..=+.|.|+.+ |+
T Consensus       208 ~~~~~W~-----iv~g~~~G~~~L~ll~~lv~~~vr~krk~k~------------~eMEr~A~~gE~L~~~~VG~sraPs  270 (278)
T PF06697_consen  208 KRSWWWK-----IVVGVVGGVVLLGLLSLLVAMLVRYKRKKKI------------EEMERRAEEGEALQMSWVGGSRAPS  270 (278)
T ss_pred             CcceeEE-----EEEEehHHHHHHHHHHHHHHhhhhhhHHHHH------------HHHHHhhccCceeeeEEEccccCcc
Confidence            5667787     3333 22222345555666677766642111            1122233445555588888875 43


No 23 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=55.19  E-value=4  Score=34.79  Aligned_cols=44  Identities=18%  Similarity=0.245  Sum_probs=0.0

Q ss_pred             CCCCcccccccCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 034219           10 APSGAGLVQWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKSSI   53 (101)
Q Consensus        10 ~~~~~~~~~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k~~s   53 (101)
                      ++...+...|..-+-.+.|+.++++.++.++++++.|.+||...
T Consensus       342 ~~p~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~~~  385 (439)
T PF02480_consen  342 APPSPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRRQR  385 (439)
T ss_dssp             --------------------------------------------
T ss_pred             CCCCCCCCcccchHHHHHHHHHHHHHHHHHhheeeeehhccccc
Confidence            33457778889989999888888888888888888888876543


No 24 
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=55.03  E-value=16  Score=27.75  Aligned_cols=27  Identities=19%  Similarity=0.380  Sum_probs=19.1

Q ss_pred             HHHHHH---HHHHHHHHHHHHHHhhhcccC
Q 034219           26 MFGGLL---LVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        26 LFgGLa---~MlgLIAvALliLaCSy~k~~   52 (101)
                      |.+++.   +++-||.+.-||-.||||+.+
T Consensus       121 lilaisvtvv~~iliii~CLiei~shr~a~  150 (154)
T PF14914_consen  121 LILAISVTVVVMILIIIFCLIEICSHRRAS  150 (154)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhccccc
Confidence            455544   445677888888899999864


No 25 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=54.81  E-value=15  Score=21.70  Aligned_cols=12  Identities=33%  Similarity=0.730  Sum_probs=4.9

Q ss_pred             HHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFL   44 (101)
Q Consensus        33 MlgLIAvALliL   44 (101)
                      |+|+|-+.++++
T Consensus        19 ~~gl~il~~~vl   30 (56)
T PF12911_consen   19 VIGLIILLILVL   30 (56)
T ss_pred             HHHHHHHHHHHH
Confidence            444444444433


No 26 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=54.22  E-value=12  Score=29.72  Aligned_cols=26  Identities=19%  Similarity=0.231  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcccCC
Q 034219           27 FGGLLLVFGVIAVALMFLACCHDKSSI   53 (101)
Q Consensus        27 FgGLa~MlgLIAvALliLaCSy~k~~s   53 (101)
                      ..|+++ .|||.+.|+.-.|.|||...
T Consensus       276 aVG~~L-a~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  276 AVGAAL-AGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             HHHHHH-HHHHHHHHHhheeEeccccc
Confidence            344443 56677777777788877654


No 27 
>PF10215 Ost4:  Oligosaccaryltransferase  ;  InterPro: IPR018943  Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, 2.4.1.119 from EC, that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum. ; PDB: 1RKL_A 2LAT_A.
Probab=53.43  E-value=24  Score=20.59  Aligned_cols=18  Identities=33%  Similarity=0.421  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034219           27 FGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        27 FgGLa~MlgLIAvALliL   44 (101)
                      ...||-.||+.++.|+++
T Consensus         7 L~~lan~lG~~~~~LIVl   24 (35)
T PF10215_consen    7 LYTLANFLGVAAMVLIVL   24 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            346788889888888876


No 28 
>CHL00080 psbM photosystem II protein M
Probab=53.25  E-value=14  Score=21.63  Aligned_cols=13  Identities=38%  Similarity=0.646  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .+|+||.+|.|+.
T Consensus         5 ~lgfiAt~LFi~i   17 (34)
T CHL00080          5 ILAFIATALFILV   17 (34)
T ss_pred             HHHHHHHHHHHHH
Confidence            3677777777764


No 29 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=53.18  E-value=17  Score=24.35  Aligned_cols=28  Identities=21%  Similarity=0.117  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      +.|...-+++++|-||.+-|..-|++..
T Consensus         3 ~~fl~~plivf~ifVap~WL~lHY~sk~   30 (75)
T PF06667_consen    3 FEFLFVPLIVFMIFVAPIWLILHYRSKW   30 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4566667777888888887777775543


No 30 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=52.90  E-value=14  Score=29.70  Aligned_cols=19  Identities=26%  Similarity=0.695  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHhhh
Q 034219           30 LLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy   48 (101)
                      .|....||-+|.|+|.|..
T Consensus       128 ~amLIClIIIAVLfLICT~  146 (227)
T PF05399_consen  128 MAMLICLIIIAVLFLICTL  146 (227)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            4566778999999999964


No 31 
>PF09928 DUF2160:  Predicted small integral membrane protein (DUF2160);  InterPro: IPR018678  The members of this family of hypothetical prokaryotic proteins have no known function. It is thought that they are transmembrane proteins, but their function has not been inferred yet. 
Probab=52.71  E-value=15  Score=25.54  Aligned_cols=22  Identities=23%  Similarity=0.487  Sum_probs=18.4

Q ss_pred             cccCChhHHHHHHHHHHHHHHH
Q 034219           18 QWNSPLPYMFGGLLLVFGVIAV   39 (101)
Q Consensus        18 ~W~SPvPYLFgGLa~MlgLIAv   39 (101)
                      .|..|+--.|+++++||+..++
T Consensus         3 aWT~ptA~FF~~I~~~L~~mtv   24 (88)
T PF09928_consen    3 AWTWPTAIFFICIALMLAGMTV   24 (88)
T ss_pred             CcchHHHHHHHHHHHHHHHHHH
Confidence            4889999999999998877654


No 32 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=52.49  E-value=5.3  Score=27.97  Aligned_cols=20  Identities=25%  Similarity=0.220  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHhhhccc
Q 034219           32 LVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        32 ~MlgLIAvALliLaCSy~k~   51 (101)
                      +.++||+++||+|+..++..
T Consensus         4 l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             eHHHHHHHHHHHHHHHHHHH
Confidence            34455666666666666654


No 33 
>COG5416 Uncharacterized integral membrane protein [Function unknown]
Probab=52.40  E-value=20  Score=25.39  Aligned_cols=29  Identities=28%  Similarity=0.334  Sum_probs=24.6

Q ss_pred             cccccCChhHHHHHHHHHHHHHHHHHHHH
Q 034219           16 LVQWNSPLPYMFGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        16 ~~~W~SPvPYLFgGLa~MlgLIAvALliL   44 (101)
                      +++|+=|.=-.+.|-++|-+||++.+.+-
T Consensus        54 fg~~~~PLilvil~s~v~G~Li~~~~~~~   82 (98)
T COG5416          54 FGQWELPLILVILGAAVVGALIAMFAGIA   82 (98)
T ss_pred             cchhhhhHHHHHHHHHHHHHHHHHHHhHH
Confidence            47788888889999999999999887765


No 34 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=51.42  E-value=16  Score=21.28  Aligned_cols=13  Identities=38%  Similarity=0.710  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .+|+||.+|.|+.
T Consensus         5 ~l~fiAt~Lfi~i   17 (33)
T TIGR03038         5 ILGFIATLLFILV   17 (33)
T ss_pred             HHHHHHHHHHHHH
Confidence            3577777777664


No 35 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=51.38  E-value=24  Score=25.44  Aligned_cols=32  Identities=25%  Similarity=0.272  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccCCCCC
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDKSSITGP   56 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k~~s~~~   56 (101)
                      -.||-+|.++|+|++.+..+-=-++|...+-.
T Consensus        69 Ii~gv~aGvIg~Illi~y~irR~~Kk~~~~~~  100 (122)
T PF01102_consen   69 IIFGVMAGVIGIILLISYCIRRLRKKSSSDVQ  100 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHS--------
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhccCCCCCC
Confidence            36788888888888888888888888876653


No 36 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=51.28  E-value=14  Score=25.36  Aligned_cols=7  Identities=0%  Similarity=-0.069  Sum_probs=3.0

Q ss_pred             Hhhhccc
Q 034219           45 ACCHDKS   51 (101)
Q Consensus        45 aCSy~k~   51 (101)
                      .++-+.+
T Consensus        22 evaa~~~   28 (95)
T PF07172_consen   22 EVAAREL   28 (95)
T ss_pred             hhhhHHh
Confidence            4444443


No 37 
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=51.06  E-value=15  Score=23.17  Aligned_cols=13  Identities=31%  Similarity=0.416  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .||+||.+|.|+.
T Consensus         5 ~lgfiAtaLFi~i   17 (50)
T PRK14094          5 NFGFVASLLFVGV   17 (50)
T ss_pred             HHHHHHHHHHHHH
Confidence            4677777777664


No 38 
>PHA03283 envelope glycoprotein E; Provisional
Probab=49.86  E-value=32  Score=30.75  Aligned_cols=30  Identities=20%  Similarity=0.453  Sum_probs=24.3

Q ss_pred             ccccCChhH--HHHHHHHHHHHHHHHHHHHHhhh
Q 034219           17 VQWNSPLPY--MFGGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        17 ~~W~SPvPY--LFgGLa~MlgLIAvALliLaCSy   48 (101)
                      ..|-  -+|  +++|+.+..||+.++|.+.+|-+
T Consensus       393 ~~~~--~~~l~~~~~~~~~~~~~~~~l~vw~c~~  424 (542)
T PHA03283        393 GAWT--RHYLAFLLAIICTCAALLVALVVWGCIL  424 (542)
T ss_pred             Cccc--cccchhHHHHHHHHHHHHHHHhhhheee
Confidence            3553  555  58888999999999999999987


No 39 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=49.84  E-value=6.4  Score=29.68  Aligned_cols=27  Identities=30%  Similarity=0.578  Sum_probs=22.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      ||---|.++||-+|+.|-...||||..
T Consensus       114 ylserlvvilggvavvltfilcsywpe  140 (175)
T PF13295_consen  114 YLSERLVVILGGVAVVLTFILCSYWPE  140 (175)
T ss_pred             HHHhHHHHhcccchheeehhhhhcChH
Confidence            555667888899999999999999974


No 40 
>PHA02909 hypothetical protein; Provisional
Probab=48.83  E-value=20  Score=23.71  Aligned_cols=9  Identities=33%  Similarity=0.567  Sum_probs=6.6

Q ss_pred             HHHHHhhhc
Q 034219           41 LMFLACCHD   49 (101)
Q Consensus        41 LliLaCSy~   49 (101)
                      ..||||||-
T Consensus        49 ftilacsyv   57 (72)
T PHA02909         49 FTILACSYV   57 (72)
T ss_pred             HHHHHHHHH
Confidence            347899984


No 41 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=48.23  E-value=19  Score=21.24  Aligned_cols=13  Identities=31%  Similarity=0.485  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .+|+||.+|.|+.
T Consensus         5 ~lgfiAt~Lfi~i   17 (35)
T PRK04989          5 DLGFVASLLFVLV   17 (35)
T ss_pred             HHHHHHHHHHHHH
Confidence            3566777776653


No 42 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=47.68  E-value=26  Score=27.57  Aligned_cols=24  Identities=17%  Similarity=0.206  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy   48 (101)
                      =|..|+.+|--+|-|.||++.|.-
T Consensus       131 kLmLGIsLmTl~lfv~Ll~~c~at  154 (200)
T PF15339_consen  131 KLMLGISLMTLFLFVILLAFCSAT  154 (200)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            388999999999999999887753


No 43 
>PF01998 DUF131:  Protein of unknown function DUF131;  InterPro: IPR002849 This archaebacterial protein family has no known function. The proteins are predicted to contain two transmembrane helices.
Probab=47.55  E-value=12  Score=24.31  Aligned_cols=26  Identities=35%  Similarity=0.687  Sum_probs=15.8

Q ss_pred             cCChhHHHHH---HHHHHHHHHHHHHHHH
Q 034219           20 NSPLPYMFGG---LLLVFGVIAVALMFLA   45 (101)
Q Consensus        20 ~SPvPYLFgG---La~MlgLIAvALliLa   45 (101)
                      ==|+|-.||.   ++..+.++|+.|+++.
T Consensus        31 IGPIPIvFGs~~~~~~~~~ilaiil~i~~   59 (64)
T PF01998_consen   31 IGPIPIVFGSSPRIAKIAMILAIILMILA   59 (64)
T ss_pred             EecccEEEcCCHHHHHHHHHHHHHHHHHH
Confidence            3488888885   4555555555555543


No 44 
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed
Probab=46.34  E-value=26  Score=26.77  Aligned_cols=30  Identities=17%  Similarity=0.269  Sum_probs=26.1

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           22 PLPYMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        22 PvPYLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      ..||+..|+.+++.|+.+|+.-.-+.+||.
T Consensus       113 ~~~~i~~G~ia~~lLl~LaiTS~~~~~rrL  142 (205)
T PRK05419        113 KRPYITVGMAAFLILLPLALTSTRASQRRL  142 (205)
T ss_pred             hchHHHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            478999999999999999999888887764


No 45 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=45.48  E-value=70  Score=23.62  Aligned_cols=17  Identities=41%  Similarity=0.671  Sum_probs=11.5

Q ss_pred             ccccCC-----hhHHHHHHHHH
Q 034219           17 VQWNSP-----LPYMFGGLLLV   33 (101)
Q Consensus        17 ~~W~SP-----vPYLFgGLa~M   33 (101)
                      .+|.+|     +|-++|||++.
T Consensus        75 sp~ps~p~d~aLp~VIGGLcaL   96 (126)
T PF03229_consen   75 SPGPSPPVDFALPLVIGGLCAL   96 (126)
T ss_pred             CCCCCCCcccchhhhhhHHHHH
Confidence            455554     57788888764


No 46 
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=44.90  E-value=45  Score=27.87  Aligned_cols=21  Identities=14%  Similarity=0.458  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 034219           30 LLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k   50 (101)
                      .+.|++|+..-||+-+||-.-
T Consensus         6 ~~~i~~lll~lllva~C~~s~   26 (310)
T COG4594           6 TAIILTLLLLLLLVAACSSSD   26 (310)
T ss_pred             hHHHHHHHHHHHHHHHhcCcC
Confidence            467888998889999998653


No 47 
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion]
Probab=43.93  E-value=24  Score=26.02  Aligned_cols=20  Identities=25%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 034219           28 GGLLLVFGVIAVALMFLACC   47 (101)
Q Consensus        28 gGLa~MlgLIAvALliLaCS   47 (101)
                      |..|++++||+.-|++|.+-
T Consensus        21 Ga~AVeFAlvap~ll~l~~g   40 (185)
T COG4961          21 GAAAVEFALVAPPLLLLVFG   40 (185)
T ss_pred             chHHHHHHHHHHHHHHHHHH
Confidence            56789999999999988764


No 48 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=43.70  E-value=43  Score=20.35  Aligned_cols=30  Identities=20%  Similarity=0.306  Sum_probs=16.9

Q ss_pred             ccccccCChhH-HHHHHHHHHHHHHHHHHHH
Q 034219           15 GLVQWNSPLPY-MFGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        15 ~~~~W~SPvPY-LFgGLa~MlgLIAvALliL   44 (101)
                      .+..|+.+.|. +...+++.+|.|...|+.+
T Consensus        10 ~~~~~~~~~pl~l~il~~f~~G~llg~l~~~   40 (68)
T PF06305_consen   10 NFLFGQFPLPLGLLILIAFLLGALLGWLLSL   40 (68)
T ss_pred             EEEeeeccchHHHHHHHHHHHHHHHHHHHHH
Confidence            45667777775 4445555566655554443


No 49 
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=42.12  E-value=44  Score=20.05  Aligned_cols=20  Identities=35%  Similarity=0.542  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034219           26 MFGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLa   45 (101)
                      |+.|-++.++.|++||+...
T Consensus        12 l~aG~~iVv~~i~~ali~VS   31 (39)
T PF06596_consen   12 LVAGAVIVVIPIAGALIFVS   31 (39)
T ss_dssp             HHHHH-HHHHHHHHHHHHHH
T ss_pred             HHhhhhhhhhhhhhheEEEe
Confidence            66777788888898888753


No 50 
>PRK13726 conjugal transfer pilus assembly protein TraE; Provisional
Probab=41.00  E-value=51  Score=25.10  Aligned_cols=27  Identities=7%  Similarity=-0.076  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           26 MFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      .|.+|+..+.|..++.++|+|.-|+..
T Consensus        16 ~~~~l~~l~~~~~~~~v~l~~~~~~~~   42 (188)
T PRK13726         16 AFIFLSVLIVLSLSVNVIQGVNNYRLQ   42 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            388888888888899999999988764


No 51 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=40.67  E-value=27  Score=28.07  Aligned_cols=32  Identities=13%  Similarity=0.191  Sum_probs=25.8

Q ss_pred             cccccccCChhHHHHHHHHHHHHHHHHHHHHH
Q 034219           14 AGLVQWNSPLPYMFGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        14 ~~~~~W~SPvPYLFgGLa~MlgLIAvALliLa   45 (101)
                      +....=.+-|-|+..|-++||-|+++.|-|--
T Consensus        51 ~~~ksKt~SVAyVLVG~Gv~LLLLSICL~IR~   82 (233)
T PF15345_consen   51 GNLKSKTFSVAYVLVGSGVALLLLSICLSIRD   82 (233)
T ss_pred             CcccceeEEEEEehhhHHHHHHHHHHHHHHHH
Confidence            44566667899999999999999998887754


No 52 
>PF14241 DUF4341:  Domain of unknown function (DUF4341)
Probab=40.42  E-value=46  Score=20.96  Aligned_cols=22  Identities=36%  Similarity=0.773  Sum_probs=15.0

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHH
Q 034219           21 SPLPYMFGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        21 SPvPYLFgGLa~MlgLIAvALliL   44 (101)
                      ||.+.++||+  ++|+-++.|+.+
T Consensus         1 Tp~~~l~GG~--lIGla~~~ll~~   22 (62)
T PF14241_consen    1 TPWSALIGGL--LIGLAASLLLLL   22 (62)
T ss_pred             CccHHHHHHH--HHHHHHHHHHHH
Confidence            5788888885  566666655554


No 53 
>PTZ00370 STEVOR; Provisional
Probab=40.11  E-value=31  Score=28.70  Aligned_cols=23  Identities=30%  Similarity=0.482  Sum_probs=15.7

Q ss_pred             HHH-HHHHHHHHHHHHH-Hhhhccc
Q 034219           29 GLL-LVFGVIAVALMFL-ACCHDKS   51 (101)
Q Consensus        29 GLa-~MlgLIAvALliL-aCSy~k~   51 (101)
                      |+| +.|-++||.|+|| .|=|||.
T Consensus       258 giaalvllil~vvliilYiwlyrrR  282 (296)
T PTZ00370        258 GIAALVLLILAVVLIILYIWLYRRR  282 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            444 4555689999998 6777553


No 54 
>PF09049 SNN_transmemb:  Stannin transmembrane;  InterPro: IPR015135 This region consists of a single highly hydrophobic transmembrane helix that transverses the lipid bilayer at a 20 degree angle with respect to the membrane normal. It contains a conserved cysteine residue (Cys32) that, together with Cys34 found in the stannin unstructured linker domain, constitutes the putative trimethyltin-binding site that resides at the end of the transmembrane domain close to the lipid/solvent interface []. ; PDB: 1ZZA_A.
Probab=39.76  E-value=76  Score=18.35  Aligned_cols=27  Identities=37%  Similarity=0.415  Sum_probs=14.4

Q ss_pred             cCChhHHHHHHHHHHHHHHHH-HHHHHhhhc
Q 034219           20 NSPLPYMFGGLLLVFGVIAVA-LMFLACCHD   49 (101)
Q Consensus        20 ~SPvPYLFgGLa~MlgLIAvA-LliLaCSy~   49 (101)
                      |||+-   |-.-...-|||+| |-+|.|-.|
T Consensus         6 hsptt---gvvti~viliavaalg~licgcw   33 (33)
T PF09049_consen    6 HSPTT---GVVTIIVILIAVAALGALICGCW   33 (33)
T ss_dssp             TTTHH---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCc---cEEEehhHHHHHHHHhhhheecC
Confidence            55553   3334445567775 445666544


No 55 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=39.48  E-value=31  Score=28.63  Aligned_cols=23  Identities=26%  Similarity=0.454  Sum_probs=15.7

Q ss_pred             HHH-HHHHHHHHHHHHH-Hhhhccc
Q 034219           29 GLL-LVFGVIAVALMFL-ACCHDKS   51 (101)
Q Consensus        29 GLa-~MlgLIAvALliL-aCSy~k~   51 (101)
                      |+| +.|-++||.|+|| .|=|||.
T Consensus       262 giaalvllil~vvliiLYiWlyrrR  286 (295)
T TIGR01478       262 GIAALVLIILTVVLIILYIWLYRRR  286 (295)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            444 4555689999998 6777553


No 56 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=38.97  E-value=53  Score=27.54  Aligned_cols=19  Identities=26%  Similarity=0.267  Sum_probs=9.2

Q ss_pred             HHHHHHHHHhh--h-cccCCCC
Q 034219           37 IAVALMFLACC--H-DKSSITG   55 (101)
Q Consensus        37 IAvALliLaCS--y-~k~~s~~   55 (101)
                      .|++|.++.|+  + |+.-.+.
T Consensus       372 ~al~f~~~v~~~~~~W~~~~~~  393 (406)
T PF04906_consen  372 AALLFSILVCVVSHAWKYFRRR  393 (406)
T ss_pred             HHHHHHHHHHHhhHHHHHhcCC
Confidence            44555555555  3 5544433


No 57 
>COG3715 ManY Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]
Probab=38.68  E-value=86  Score=25.57  Aligned_cols=13  Identities=31%  Similarity=0.823  Sum_probs=10.4

Q ss_pred             CChhHHHHHHHHH
Q 034219           21 SPLPYMFGGLLLV   33 (101)
Q Consensus        21 SPvPYLFgGLa~M   33 (101)
                      .=.||+|.|+.+.
T Consensus       204 ~~~pff~lGFv~a  216 (265)
T COG3715         204 ELIPFFFLGFVLA  216 (265)
T ss_pred             chhHHHHHHHHHH
Confidence            4479999998765


No 58 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=38.51  E-value=30  Score=22.49  Aligned_cols=13  Identities=23%  Similarity=0.307  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHhhh
Q 034219           36 VIAVALMFLACCH   48 (101)
Q Consensus        36 LIAvALliLaCSy   48 (101)
                      ++|+|+++|+|.-
T Consensus         5 I~Aiaf~vLvi~l   17 (90)
T PF06103_consen    5 IAAIAFAVLVIFL   17 (90)
T ss_pred             HHHHHHHHHHHHH
Confidence            4556666665543


No 59 
>PRK09458 pspB phage shock protein B; Provisional
Probab=37.80  E-value=41  Score=22.72  Aligned_cols=28  Identities=21%  Similarity=0.152  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      ++|.+.-+++++|-||.+=|..-|+...
T Consensus         3 ~~fl~~PliiF~ifVaPiWL~LHY~sk~   30 (75)
T PRK09458          3 ALFLAIPLTIFVLFVAPIWLWLHYRSKR   30 (75)
T ss_pred             chHHHHhHHHHHHHHHHHHHHHhhcccc
Confidence            6788888899999999999988886543


No 60 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=37.73  E-value=47  Score=25.68  Aligned_cols=19  Identities=21%  Similarity=0.466  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHhhhccc
Q 034219           33 VFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        33 MlgLIAvALliLaCSy~k~   51 (101)
                      .+-+|-+-+||.-||+||.
T Consensus        39 vVliiiiivli~lcssRKk   57 (189)
T PF05568_consen   39 VVLIIIIIVLIYLCSSRKK   57 (189)
T ss_pred             HHHHHHHHHHHHHHhhhhH
Confidence            3334556677778998875


No 61 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=37.35  E-value=1.4e+02  Score=21.74  Aligned_cols=20  Identities=10%  Similarity=0.235  Sum_probs=15.5

Q ss_pred             CCCCceEEEecCCCCCceec
Q 034219           75 ALEPKIVVIMAGDDHPTRIA   94 (101)
Q Consensus        75 ~~e~kivVIMAGd~~PTfLA   94 (101)
                      +.+|.|+|=++|+..-.||-
T Consensus        71 ~l~~~fvvNl~~~~~~ryLk   90 (170)
T PRK05696         71 PMPRPFVFNVPGNGRDRLVQ   90 (170)
T ss_pred             ecCCCEEEEecCCCCceEEE
Confidence            44567999999888888874


No 62 
>PF05255 UPF0220:  Uncharacterised protein family (UPF0220);  InterPro: IPR007919 This family of proteins is functionally uncharacterised.
Probab=36.59  E-value=46  Score=24.98  Aligned_cols=26  Identities=27%  Similarity=0.336  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      .||.|+++|.|=++-|+-||.=-|-.
T Consensus       102 ~LFigf~l~fggl~~s~~vli~~yv~  127 (166)
T PF05255_consen  102 WLFIGFALSFGGLAGSVWVLILKYVV  127 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhccccc
Confidence            69999999999999999999866644


No 63 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=36.58  E-value=63  Score=20.85  Aligned_cols=27  Identities=30%  Similarity=0.411  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           26 MFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      .+-|.+--.|+|++.|+.++|-|+-..
T Consensus         5 ~~~~~a~a~~t~~~~l~fiavi~~ayr   31 (60)
T COG4736           5 MMRGFADAWGTIAFTLFFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            466778888999999999988886543


No 64 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=36.57  E-value=52  Score=23.08  Aligned_cols=26  Identities=19%  Similarity=0.289  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           27 FGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        27 FgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      ..++.++|-||.++.-|++|-..|..
T Consensus         3 Ll~il~llLll~l~asl~~wr~~~rq   28 (107)
T PF15330_consen    3 LLGILALLLLLSLAASLLAWRMKQRQ   28 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            44555566677777888888776553


No 65 
>PRK15065 PTS system mannose-specific transporter subunit IIC; Provisional
Probab=35.31  E-value=90  Score=25.11  Aligned_cols=27  Identities=19%  Similarity=0.363  Sum_probs=19.6

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 034219           22 PLPYMFGGLLLVFGV----IAVALMFLACCH   48 (101)
Q Consensus        22 PvPYLFgGLa~MlgL----IAvALliLaCSy   48 (101)
                      =.||+|.|+.+.--+    +++|++-.+|.+
T Consensus       206 ~~~ff~lGFvl~ayl~l~~l~iAiig~~iA~  236 (262)
T PRK15065        206 LMPFFYLGFVLAAFTNLNLIALGVIGVVLAL  236 (262)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            479999999877544    777776666655


No 66 
>PF11143 DUF2919:  Protein of unknown function (DUF2919);  InterPro: IPR021318  This bacterial family of proteins has no known function. Some members are annotated as YfeZ however this cannot be confirmed. 
Probab=35.07  E-value=50  Score=24.33  Aligned_cols=23  Identities=35%  Similarity=0.267  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 034219           29 GLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      .++..+|+.|+.++ +.|++|+..
T Consensus        57 ~lgL~~g~Pall~~-~l~~~R~~~   79 (149)
T PF11143_consen   57 YLGLAAGLPALLLM-LLSGRRHRS   79 (149)
T ss_pred             HHHHHHhHHHHHHH-HHHccCCCC
Confidence            46677899999888 888887743


No 67 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=34.69  E-value=65  Score=22.36  Aligned_cols=24  Identities=21%  Similarity=0.192  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHhhhcccCCCCC
Q 034219           33 VFGVIAVALMFLACCHDKSSITGP   56 (101)
Q Consensus        33 MlgLIAvALliLaCSy~k~~s~~~   56 (101)
                      |-.||++-.+||.--..++||+++
T Consensus        28 MtILivLVIIiLlImlfqsSS~~~   51 (85)
T PF10717_consen   28 MTILIVLVIIILLIMLFQSSSNGN   51 (85)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCC
Confidence            334444443444333445555543


No 68 
>PHA00736 hypothetical protein
Probab=34.36  E-value=37  Score=22.99  Aligned_cols=14  Identities=43%  Similarity=0.887  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHH
Q 034219           26 MFGGLLLVFGVIAV   39 (101)
Q Consensus        26 LFgGLa~MlgLIAv   39 (101)
                      ||-|+++++||||=
T Consensus        57 lfwgi~vifgliag   70 (79)
T PHA00736         57 LFWGITVIFGLIAG   70 (79)
T ss_pred             HHHHHHHHHHHHHH
Confidence            78899999999974


No 69 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=34.31  E-value=67  Score=21.80  Aligned_cols=25  Identities=20%  Similarity=0.315  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           26 MFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      .|..+++++.++|+-+.++.|.+++
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~~   97 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKRS   97 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccc
Confidence            4555666666666666655555544


No 70 
>PRK13415 flagella biosynthesis protein FliZ; Provisional
Probab=33.22  E-value=1.5e+02  Score=23.63  Aligned_cols=24  Identities=17%  Similarity=0.342  Sum_probs=13.0

Q ss_pred             cccccccCChhHHHHHHHHHHHHHHH
Q 034219           14 AGLVQWNSPLPYMFGGLLLVFGVIAV   39 (101)
Q Consensus        14 ~~~~~W~SPvPYLFgGLa~MlgLIAv   39 (101)
                      ++.+.|.  +-=++++|+++++||-+
T Consensus        61 ~~~s~~~--l~qmi~aL~~VI~Liy~   84 (219)
T PRK13415         61 SSVSAFD--FVKLIGATLFVIFLIYA   84 (219)
T ss_pred             CCccHHH--HHHHHHHHHHHHHHHHH
Confidence            5556665  34466666555544443


No 71 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=32.33  E-value=49  Score=22.72  Aligned_cols=20  Identities=40%  Similarity=0.217  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHhhhcccC
Q 034219           33 VFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        33 MlgLIAvALliLaCSy~k~~   52 (101)
                      .+|++++.++|++.-+||.-
T Consensus         7 v~~~~~v~~~i~~y~~~k~~   26 (87)
T PF10883_consen    7 VGGVGAVVALILAYLWWKVK   26 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44667777777777778763


No 72 
>PF01794 Ferric_reduct:  Ferric reductase like transmembrane component;  InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane [] that include a potential FAD binding domain. Mutations in the sequence of cytochrome b-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0016021 integral to membrane
Probab=32.30  E-value=93  Score=20.09  Aligned_cols=27  Identities=15%  Similarity=0.339  Sum_probs=18.9

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhh
Q 034219           22 PLPYMFGGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        22 PvPYLFgGLa~MlgLIAvALliLaCSy   48 (101)
                      .-+|...|+.+++.++.+++.-+.+-|
T Consensus        76 ~~~~~~~G~~a~~~l~~l~~tS~~~~R  102 (125)
T PF01794_consen   76 TGPYNLTGIIALLLLLILAVTSFPWIR  102 (125)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346667777777777777776666666


No 73 
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional
Probab=32.20  E-value=1.8e+02  Score=23.19  Aligned_cols=25  Identities=20%  Similarity=0.218  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 034219           23 LPYMFGGLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        23 vPYLFgGLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      .+.+|.||.++     ++|+.+.|..|+..
T Consensus        12 ~~~~~~~~~~~-----~~~~~~~~~~~~~~   36 (333)
T PTZ00260         12 RMLIVLGLVVG-----LALLFYPYISWPDD   36 (333)
T ss_pred             HHHHHHHHHHH-----HHHHHHHHhhhhhh
Confidence            44556665444     55666666677654


No 74 
>PF12048 DUF3530:  Protein of unknown function (DUF3530);  InterPro: IPR022529  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 272 to 336 amino acids in length. These proteins are distantly related to alpa/beta hydrolases so they may act as enzymes. 
Probab=32.14  E-value=60  Score=25.97  Aligned_cols=12  Identities=17%  Similarity=0.454  Sum_probs=7.7

Q ss_pred             CceEEEecCCCC
Q 034219           78 PKIVVIMAGDDH   89 (101)
Q Consensus        78 ~kivVIMAGd~~   89 (101)
                      +.|+-|.+||++
T Consensus        62 ~e~~~L~~~~~~   73 (310)
T PF12048_consen   62 DEVQWLQAGEER   73 (310)
T ss_pred             hhcEEeecCCEE
Confidence            566677776663


No 75 
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=31.77  E-value=95  Score=19.81  Aligned_cols=19  Identities=32%  Similarity=0.338  Sum_probs=14.1

Q ss_pred             cCChhHHHHHHHHHHHHHH
Q 034219           20 NSPLPYMFGGLLLVFGVIA   38 (101)
Q Consensus        20 ~SPvPYLFgGLa~MlgLIA   38 (101)
                      -+|-.-++..+++++||+.
T Consensus        54 ~~P~~~lil~l~~~~Gl~l   72 (82)
T PF13807_consen   54 VSPKRALILALGLFLGLIL   72 (82)
T ss_pred             CCCcHHHHHHHHHHHHHHH
Confidence            3566778888888888854


No 76 
>PF15240 Pro-rich:  Proline-rich
Probab=30.29  E-value=36  Score=26.33  Aligned_cols=13  Identities=31%  Similarity=0.554  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .|.|..||||.|.
T Consensus         2 LlVLLSvALLALS   14 (179)
T PF15240_consen    2 LLVLLSVALLALS   14 (179)
T ss_pred             hhHHHHHHHHHhh
Confidence            3567889999885


No 77 
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism]
Probab=30.29  E-value=1.2e+02  Score=27.93  Aligned_cols=27  Identities=26%  Similarity=0.445  Sum_probs=22.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           24 PYMFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        24 PYLFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      =|.|.||.+++.++++.++|+..--||
T Consensus       673 r~~y~gl~~~~~~~~~i~~i~~~~v~r  699 (735)
T KOG3626|consen  673 RYRYLGLHIILKVIALILLIIDLYVWR  699 (735)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            478999999999999988888655555


No 78 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=30.13  E-value=66  Score=20.06  Aligned_cols=21  Identities=19%  Similarity=0.566  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 034219           30 LLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k   50 (101)
                      +++|+.+++.++.+-+|---+
T Consensus         6 i~~i~~~l~~~~~l~~CnTv~   26 (48)
T PRK10081          6 IAAIFSVLVLSTVLTACNTTR   26 (48)
T ss_pred             HHHHHHHHHHHHHHhhhhhhh
Confidence            567777788888788895443


No 79 
>PF10826 DUF2551:  Protein of unknown function (DUF2551) ;  InterPro: IPR020501 This entry contains proteins with no known function.
Probab=29.77  E-value=42  Score=23.12  Aligned_cols=19  Identities=26%  Similarity=0.483  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 034219           27 FGGLLLVFGVIAVALMFLA   45 (101)
Q Consensus        27 FgGLa~MlgLIAvALliLa   45 (101)
                      .=|.|+|+|+|+-=|=||-
T Consensus        43 ~~~VasMVG~i~SrlGIL~   61 (83)
T PF10826_consen   43 YRGVASMVGLIHSRLGILS   61 (83)
T ss_pred             HHHHHHHHHHHHHhhhhee
Confidence            3488999999998888884


No 80 
>PF04133 Vps55:  Vacuolar protein sorting 55 ;  InterPro: IPR007262 Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase. Both Vps55 and obesity receptor gene-related protein are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [].
Probab=29.71  E-value=58  Score=23.29  Aligned_cols=19  Identities=32%  Similarity=0.515  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHhhhccc
Q 034219           33 VFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        33 MlgLIAvALliLaCSy~k~   51 (101)
                      .++-|++-|+||+|.-+|+
T Consensus         6 ~~~aiG~lL~IL~CAL~~n   24 (120)
T PF04133_consen    6 FFLAIGFLLVILSCALYKN   24 (120)
T ss_pred             HHHHHHHHHHHHHHHHhcc
Confidence            3456788899999988776


No 81 
>cd02435 CCC1 CCC1. CCC1: This domain is present in the CCC1, an iron and manganese transporter of Saccharomyces cerevisiae. CCC1 is a transmembrane protein that is located in the vacuole and transfers the iron and manganese ions from the cytosol to the vacuole. This domain may be unique to certain fungi and plants.
Probab=29.27  E-value=86  Score=24.59  Aligned_cols=29  Identities=38%  Similarity=0.474  Sum_probs=16.7

Q ss_pred             hhHHHH-----HHHHHHHHHHHHHHHHHhhhccc
Q 034219           23 LPYMFG-----GLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        23 vPYLFg-----GLa~MlgLIAvALliLaCSy~k~   51 (101)
                      +||+|.     ++...+++-.++|+++-+.+-+.
T Consensus       173 lPy~~~~~~~~a~~~si~l~~~aL~ilG~~~s~~  206 (241)
T cd02435         173 LPYFFVSTVGEALLLSVIVTLVALFVFGYVKTWF  206 (241)
T ss_pred             HHHHHccchhHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            478773     45555555566666665555443


No 82 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=29.05  E-value=96  Score=26.04  Aligned_cols=25  Identities=8%  Similarity=0.303  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHhhhcccCCCC
Q 034219           31 LLVFGVIAVALMFLACCHDKSSITG   55 (101)
Q Consensus        31 a~MlgLIAvALliLaCSy~k~~s~~   55 (101)
                      +..+.|+.+-..+.||-.||...|.
T Consensus       166 GPlIVl~GLCFFVVAHvKKr~nln~  190 (319)
T PF15471_consen  166 GPLIVLVGLCFFVVAHVKKRNNLNG  190 (319)
T ss_pred             hhHHHHHhhhhhheeeeeeccCCCc
Confidence            3445566667778888888875543


No 83 
>PLN00090 photosystem II reaction center M protein; Provisional
Probab=28.86  E-value=82  Score=22.71  Aligned_cols=13  Identities=31%  Similarity=0.115  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHH
Q 034219           33 VFGVIAVALMFLA   45 (101)
Q Consensus        33 MlgLIAvALliLa   45 (101)
                      .+|+||.+|.||.
T Consensus        75 iLafIATaLFIlI   87 (113)
T PLN00090         75 FGAYLAVALGTFL   87 (113)
T ss_pred             HHHHHHHHHHHHH
Confidence            4667777776653


No 84 
>PRK12430 putative bifunctional flagellar biosynthesis protein FliO/FliP; Provisional
Probab=28.78  E-value=1.1e+02  Score=26.31  Aligned_cols=17  Identities=6%  Similarity=0.044  Sum_probs=12.9

Q ss_pred             CCCCCCCceEEEecCCC
Q 034219           72 PPAALEPKIVVIMAGDD   88 (101)
Q Consensus        72 ~~~~~e~kivVIMAGd~   88 (101)
                      .++-.+|+|||+=.||+
T Consensus        65 ~sLG~RERVVvVeV~d~   81 (379)
T PRK12430         65 LSLGSNESIIIVEIKQL   81 (379)
T ss_pred             cccCCcceEEEEEECCE
Confidence            35566789999888876


No 85 
>PLN00085 photosystem II reaction center protein M (PsbM); Provisional
Probab=28.67  E-value=49  Score=24.80  Aligned_cols=15  Identities=40%  Similarity=0.642  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHhh
Q 034219           33 VFGVIAVALMFLACC   47 (101)
Q Consensus        33 MlgLIAvALliLaCS   47 (101)
                      .||+||.+|.||.=+
T Consensus        82 iLgfIAtaLFIlIPT   96 (149)
T PLN00085         82 ILGVIATALFIIIPT   96 (149)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            588999999887533


No 86 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=28.44  E-value=2.1e+02  Score=20.72  Aligned_cols=19  Identities=26%  Similarity=0.337  Sum_probs=13.1

Q ss_pred             CCCCceEEEe-cCCCCCceec
Q 034219           75 ALEPKIVVIM-AGDDHPTRIA   94 (101)
Q Consensus        75 ~~e~kivVIM-AGd~~PTfLA   94 (101)
                      +.| .|+|=+ .+++..+||-
T Consensus        63 ~L~-~f~VNL~~~~~~~rylk   82 (162)
T PRK07021         63 PLE-TFTVNLQPDDDADRVLY   82 (162)
T ss_pred             ecC-CEEEEcCCCCCCceEEE
Confidence            445 488888 5666788874


No 87 
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=28.39  E-value=78  Score=22.99  Aligned_cols=15  Identities=20%  Similarity=0.355  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHH
Q 034219           25 YMFGGLLLVFGVIAV   39 (101)
Q Consensus        25 YLFgGLa~MlgLIAv   39 (101)
                      =++++|.++++||.+
T Consensus        20 qv~~~L~lVl~lI~~   34 (124)
T PRK11486         20 QVSGALIGIIALILA   34 (124)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            366777666665543


No 88 
>PRK10884 SH3 domain-containing protein; Provisional
Probab=27.98  E-value=53  Score=25.33  Aligned_cols=17  Identities=29%  Similarity=0.821  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034219           25 YMFGGLLLVFGVIAVALM   42 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALl   42 (101)
                      |+.||+.+.+||| +.|+
T Consensus       174 f~~Gg~v~~~Gll-lGli  190 (206)
T PRK10884        174 FMYGGGVAGIGLL-LGLL  190 (206)
T ss_pred             HHHchHHHHHHHH-HHHH
Confidence            6789999999998 4444


No 89 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=27.98  E-value=77  Score=29.71  Aligned_cols=23  Identities=17%  Similarity=0.248  Sum_probs=13.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHh
Q 034219           24 PYMFGGLLLVFGVIAVALMFLAC   46 (101)
Q Consensus        24 PYLFgGLa~MlgLIAvALliLaC   46 (101)
                      =||.+-|+.|+.|+-+-|-+|.|
T Consensus       273 ~fLl~ILG~~~livl~lL~vLl~  295 (807)
T PF10577_consen  273 VFLLAILGGTALIVLILLCVLLC  295 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45666666666665555555555


No 90 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=27.88  E-value=20  Score=26.21  Aligned_cols=18  Identities=28%  Similarity=0.368  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHhhhccc
Q 034219           34 FGVIAVALMFLACCHDKS   51 (101)
Q Consensus        34 lgLIAvALliLaCSy~k~   51 (101)
                      |.+|-..||++-|-|.|.
T Consensus        32 L~VILgiLLliGCWYckR   49 (118)
T PF14991_consen   32 LIVILGILLLIGCWYCKR   49 (118)
T ss_dssp             ------------------
T ss_pred             HHHHHHHHHHHhheeeee
Confidence            334444567777777443


No 91 
>PF01594 UPF0118:  Domain of unknown function DUF20;  InterPro: IPR002549  This is a family of hypothetical proteins. A number of the sequence records state they are transmembrane proteins or putative permeases. It is not clear what source suggested that these proteins might be permeases and this information should be treated with caution.
Probab=27.87  E-value=90  Score=23.86  Aligned_cols=26  Identities=19%  Similarity=0.277  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           25 YMFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        25 YLFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      ++||-+++++|...++++...|-+||
T Consensus       302 ~~fG~~G~il~~pi~~~~~~~~~~~~  327 (327)
T PF01594_consen  302 YLFGFIGLILAPPILAVIKAIFEEYR  327 (327)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHhC
Confidence            57888889999988888888887765


No 92 
>PRK11246 hypothetical protein; Provisional
Probab=27.74  E-value=99  Score=24.61  Aligned_cols=30  Identities=17%  Similarity=0.112  Sum_probs=20.6

Q ss_pred             hhHHHHHHHHHHHH-HHHHHHHHHhhhcccC
Q 034219           23 LPYMFGGLLLVFGV-IAVALMFLACCHDKSS   52 (101)
Q Consensus        23 vPYLFgGLa~MlgL-IAvALliLaCSy~k~~   52 (101)
                      .-|++..+|+..|+ ++..|+-+-=++|+.+
T Consensus       164 ~~r~Mll~al~iG~lL~~~l~~~~~~~~~~~  194 (218)
T PRK11246        164 ILRLMLLLALAIGIVLTRTLLQGKRTRWQQS  194 (218)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccccccC
Confidence            34577777777776 5667777767777765


No 93 
>PF06800 Sugar_transport:  Sugar transport protein;  InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes.; GO: 0015144 carbohydrate transmembrane transporter activity, 0034219 carbohydrate transmembrane transport, 0016021 integral to membrane
Probab=27.51  E-value=77  Score=25.63  Aligned_cols=32  Identities=25%  Similarity=0.405  Sum_probs=23.6

Q ss_pred             cccccCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           16 LVQWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        16 ~~~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      |..|++..-+++|-+|+.+-++.+.|    ||+++.
T Consensus        94 fgEW~~~~~~~~G~~Al~liiiGv~l----ts~~~~  125 (269)
T PF06800_consen   94 FGEWTTTTQKIIGFLALVLIIIGVIL----TSYQDK  125 (269)
T ss_pred             cCCCCCcchHHHHHHHHHHHHHHHHH----hccccc
Confidence            68899999999888887777666654    555543


No 94 
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=27.42  E-value=46  Score=26.03  Aligned_cols=14  Identities=50%  Similarity=0.804  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHhh
Q 034219           34 FGVIAVALMFLACC   47 (101)
Q Consensus        34 lgLIAvALliLaCS   47 (101)
                      -+||++||..|+|-
T Consensus        85 t~lI~~alAfl~Cv   98 (186)
T PF06387_consen   85 TRLIAFALAFLGCV   98 (186)
T ss_pred             hHHHHHHHHHHHHH
Confidence            36788888888887


No 95 
>PF06814 Lung_7-TM_R:  Lung seven transmembrane receptor;  InterPro: IPR009637 This family represents a conserved region with eukaryotic lung seven transmembrane receptors and related proteins.; GO: 0016021 integral to membrane
Probab=27.28  E-value=1e+02  Score=23.98  Aligned_cols=38  Identities=29%  Similarity=0.489  Sum_probs=31.8

Q ss_pred             cccccccCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           14 AGLVQWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        14 ~~~~~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      |.++.=+-|.|.+++.++++-++.++.-+.+.+.|||.
T Consensus        38 gyL~a~~~pl~~~y~~~~i~y~~~~~~W~~~~~~~~~~   75 (295)
T PF06814_consen   38 GYLPAGEYPLPPFYGVMSIVYAVLLIIWLFLCFKNRKS   75 (295)
T ss_pred             CCCChhhcccHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            45566678899999999999999988888888888875


No 96 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=26.68  E-value=21  Score=29.15  Aligned_cols=13  Identities=15%  Similarity=0.376  Sum_probs=0.0

Q ss_pred             HHHHHHHhhhccc
Q 034219           39 VALMFLACCHDKS   51 (101)
Q Consensus        39 vALliLaCSy~k~   51 (101)
                      ||.+|.+|.|||.
T Consensus       161 IA~iIa~icyrrk  173 (290)
T PF05454_consen  161 IAGIIACICYRRK  173 (290)
T ss_dssp             -------------
T ss_pred             HHHHHHHHhhhhh
Confidence            3445555555443


No 97 
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily. Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene.
Probab=26.39  E-value=1.1e+02  Score=25.26  Aligned_cols=30  Identities=13%  Similarity=-0.103  Sum_probs=23.6

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 034219           22 PLPYMFGGLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        22 PvPYLFgGLa~MlgLIAvALliLaCSy~k~   51 (101)
                      |-+-++.++++++|++.-..+++.+.++..
T Consensus       411 P~~~~~l~~g~~~Gl~lg~~~~~l~e~ld~  440 (498)
T TIGR03007       411 PNRPLLMLAGLLGGLGAGIGLAFLLSQLRP  440 (498)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            666688888899998877777887877654


No 98 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=26.15  E-value=1.9e+02  Score=21.31  Aligned_cols=24  Identities=13%  Similarity=0.254  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 034219           29 GLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      -|-+|++|+.+++.+.+.+++...
T Consensus         3 ~l~a~~~Lvl~~~~lva~a~~Tg~   26 (135)
T TIGR03054         3 LLIAMLGLVLLTFALVAFAVLTGV   26 (135)
T ss_pred             HHHHHHHHHHHHHHHhheeeecCC
Confidence            467899999999999999998843


No 99 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=26.08  E-value=85  Score=16.65  Aligned_cols=11  Identities=27%  Similarity=0.443  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHh
Q 034219           36 VIAVALMFLAC   46 (101)
Q Consensus        36 LIAvALliLaC   46 (101)
                      |+.+.|+.++.
T Consensus        10 l~~~gl~~l~~   20 (25)
T PF07589_consen   10 LLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHH
Confidence            33334444444


No 100
>TIGR03363 VI_chp_8 type VI secretion-associated protein, ImpA family. This protein family is one of two related families in type VI secretion systems that contain an ImpA-related N-terminal domain (pfam06812).
Probab=26.00  E-value=33  Score=28.03  Aligned_cols=8  Identities=50%  Similarity=1.331  Sum_probs=7.1

Q ss_pred             cCChhHHH
Q 034219           20 NSPLPYMF   27 (101)
Q Consensus        20 ~SPvPYLF   27 (101)
                      |||||||.
T Consensus       313 hSPvp~Ll  320 (353)
T TIGR03363       313 HSPVPYLI  320 (353)
T ss_pred             CCcHHHHH
Confidence            89999986


No 101
>PF12259 DUF3609:  Protein of unknown function (DUF3609);  InterPro: IPR022048  This domain family is found in eukaryotes and viruses, and is typically between 348 and 360 amino acids in length. 
Probab=25.97  E-value=59  Score=27.18  Aligned_cols=23  Identities=22%  Similarity=0.072  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 034219           29 GLLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy~k~~   52 (101)
                      ..+..++||++ |+.|+|-||+..
T Consensus       302 ~v~~~~vli~v-l~~~~~~~~~~~  324 (361)
T PF12259_consen  302 AVCGAIVLIIV-LISLAWLYRTFR  324 (361)
T ss_pred             ehhHHHHHHHH-HHHHHhheeehH
Confidence            34455666655 667777776653


No 102
>PF03381 CDC50:  LEM3 (ligand-effect modulator 3) family / CDC50 family;  InterPro: IPR005045 Members of this family have no known function. They have predicted transmembrane helices.; GO: 0016020 membrane
Probab=25.91  E-value=1.4e+02  Score=23.75  Aligned_cols=32  Identities=13%  Similarity=0.043  Sum_probs=23.3

Q ss_pred             ccCChhHHHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           19 WNSPLPYMFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        19 W~SPvPYLFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      .+--..++|..+++...++++.|+++-+.+-|
T Consensus       241 kn~~Lgi~ylvvg~i~~v~~i~~~~~~~~~~r  272 (278)
T PF03381_consen  241 KNYFLGIAYLVVGGICLVLAIIFLIIHYFKPR  272 (278)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence            34446777888888888888888888776544


No 103
>cd01059 CCC1_like CCC1-related family of proteins. CCC1_like: This protein family includes the proteins related to CCC1, a yeast vacuole transmembrane protein responsible for the iron and manganese transport from the cytosol into vacuole. It also includes the proteins similar to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation.
Probab=25.57  E-value=1.3e+02  Score=21.32  Aligned_cols=29  Identities=38%  Similarity=0.567  Sum_probs=15.0

Q ss_pred             hhHHHHH---HHHHHHH---HHHHHHHHHhhhccc
Q 034219           23 LPYMFGG---LLLVFGV---IAVALMFLACCHDKS   51 (101)
Q Consensus        23 vPYLFgG---La~MlgL---IAvALliLaCSy~k~   51 (101)
                      .||+|..   ++..+.+   ..++|+++.+...|.
T Consensus        79 lp~~~~~~~~~a~~~si~~~~~~~l~~~g~~~~~~  113 (143)
T cd01059          79 LPYLLLPAGSLALAVSVALVVALALFLLGAFVAKL  113 (143)
T ss_pred             HHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4787763   3444433   344555555555554


No 104
>COG4885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.49  E-value=59  Score=27.14  Aligned_cols=23  Identities=39%  Similarity=0.472  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccc
Q 034219           29 GLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy~k~   51 (101)
                      |+...++|||+++.-+|--+|++
T Consensus       289 GF~~~~aL~Av~~~~~a~~rRrs  311 (312)
T COG4885         289 GFEVVFALMAVAGVALARKRRRS  311 (312)
T ss_pred             CcHHHHHHHHHHHHHHHHHHhhc
Confidence            67788899999988888777664


No 105
>CHL00066 psbH photosystem II protein H
Probab=25.43  E-value=1e+02  Score=20.85  Aligned_cols=21  Identities=14%  Similarity=0.159  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 034219           30 LLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k   50 (101)
                      +++.|+|+||.|+|+.=-|..
T Consensus        43 Mgv~m~lf~vfl~iiLeiyNs   63 (73)
T CHL00066         43 MGVAMALFAVFLSIILEIYNS   63 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhCc
Confidence            466788899999888765543


No 106
>PRK13792 lysozyme inhibitor; Provisional
Probab=25.43  E-value=39  Score=24.61  Aligned_cols=21  Identities=24%  Similarity=0.384  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHhhhccc
Q 034219           31 LLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        31 a~MlgLIAvALliLaCSy~k~   51 (101)
                      ++++.|+.+++|+-+||.-..
T Consensus         4 ~l~~ll~~~~~lLsaCs~~~~   24 (127)
T PRK13792          4 ALWLLLAAVPVVLVACGGSDD   24 (127)
T ss_pred             HHHHHHHHHHhheecccCCCC
Confidence            356777888888999998654


No 107
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=25.40  E-value=20  Score=27.12  Aligned_cols=23  Identities=26%  Similarity=0.323  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccc
Q 034219           29 GLLLVFGVIAVALMFLACCHDKS   51 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy~k~   51 (101)
                      |++.-+.|++++|+.+.|-++|.
T Consensus        57 GVGg~ill~il~lvf~~c~r~kk   79 (154)
T PF04478_consen   57 GVGGPILLGILALVFIFCIRRKK   79 (154)
T ss_pred             cccHHHHHHHHHhheeEEEeccc
Confidence            44443334445555555655554


No 108
>PTZ00201 amastin surface glycoprotein; Provisional
Probab=25.36  E-value=1.4e+02  Score=23.03  Aligned_cols=25  Identities=8%  Similarity=0.343  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcc
Q 034219           26 MFGGLLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        26 LFgGLa~MlgLIAvALliLaCSy~k   50 (101)
                      -+.=.|-.|-+|.+.++.|-|..+.
T Consensus       154 ~Llv~AW~L~iinii~lllp~~~~~  178 (192)
T PTZ00201        154 ALLVVAWILDILNIIFLLLPCTVPA  178 (192)
T ss_pred             HHHHHHHHHHHHHHHHHHhccccCC
Confidence            3444567788999999999994433


No 109
>TIGR03501 gamma_C_targ gammaproteobacterial enzyme C-terminal transmembrane domain. This homology domain, largely restricted to a subset of the gamma proteobacteria that excludes the enterobacteria, is found at the extreme carboxyl-terminus of a diverse set of proteins, most of which are enzymes with conventional signal sequences and with hydrolytic activities: nucleases, proteases, agarases, etc. Species that have this domain at all typically have from two to fifteen proteins tagged with this domain at the C-terminus. The agarase AgaA from Vibro sp. strain JT0107 is secreted into the medium, while the same protein heterologously expressed in E. coli is retained in the cell fraction. This suggests cleavage and release in species with this domain. Both this suggestion, and the chemical structure of the domain (motif, hydrophobic predicted transmembrane helix, cluster of basic residues) closely parallels that of the LPXTG/sortase system and the PEP-CTERM/exosortase(EpsH) system.
Probab=24.72  E-value=80  Score=17.18  Aligned_cols=17  Identities=18%  Similarity=0.425  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHhhhcc
Q 034219           34 FGVIAVALMFLACCHDK   50 (101)
Q Consensus        34 lgLIAvALliLaCSy~k   50 (101)
                      ||..++.+|.+..-+||
T Consensus         5 lGwl~LllL~~~~~rRr   21 (26)
T TIGR03501         5 LGWLSLLLLLLLGLRRR   21 (26)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            45566666655554444


No 110
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=24.40  E-value=71  Score=23.20  Aligned_cols=17  Identities=29%  Similarity=0.341  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 034219           32 LVFGVIAVALMFLACCH   48 (101)
Q Consensus        32 ~MlgLIAvALliLaCSy   48 (101)
                      +++++|++||+...-+-
T Consensus        10 lLi~vIglAL~aFIv~d   26 (145)
T PF13623_consen   10 LLIIVIGLALFAFIVGD   26 (145)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45677888887775554


No 111
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=24.33  E-value=82  Score=29.33  Aligned_cols=25  Identities=20%  Similarity=0.289  Sum_probs=21.3

Q ss_pred             cCChhHHHHHHHHHHHHHHHHHHHH
Q 034219           20 NSPLPYMFGGLLLVFGVIAVALMFL   44 (101)
Q Consensus        20 ~SPvPYLFgGLa~MlgLIAvALliL   44 (101)
                      ++-.=|+|--+.-|||+.+|||||=
T Consensus       425 ~~~~E~Vf~~~~w~mGVFvFslliG  449 (815)
T KOG0499|consen  425 QTLFEIVFQLLNWFMGVFVFSLLIG  449 (815)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4445699999999999999999984


No 112
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=24.16  E-value=63  Score=24.20  Aligned_cols=18  Identities=11%  Similarity=0.401  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHhhhcccC
Q 034219           35 GVIAVALMFLACCHDKSS   52 (101)
Q Consensus        35 gLIAvALliLaCSy~k~~   52 (101)
                      .+|++.|++.+|+..+..
T Consensus         5 ~~l~l~lll~~C~~~~~~   22 (216)
T PF11153_consen    5 LLLLLLLLLTGCSTNPNE   22 (216)
T ss_pred             HHHHHHHHHHhhcCCCcc
Confidence            345588899999987754


No 113
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=24.13  E-value=37  Score=24.75  Aligned_cols=7  Identities=29%  Similarity=0.301  Sum_probs=3.8

Q ss_pred             ccCChhH
Q 034219           19 WNSPLPY   25 (101)
Q Consensus        19 W~SPvPY   25 (101)
                      -++|.-|
T Consensus        69 ~~~p~~~   75 (179)
T PF13908_consen   69 SYDPPIY   75 (179)
T ss_pred             ccCcccc
Confidence            3456555


No 114
>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2. A subgroup of PA-domain containing proteins belonging to the peptidase family M28. Family M28 contains aminopeptidases and carboxypeptidases, and has co-catalytic zinc ions. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following members of the peptidase family M28: i) prostate-specific membrane antigen (PSMA), ii) yeast aminopeptidase Y, and ii) human TfR (transferrin receptor)1 and human TfR2. The proteins listed above belong to other subgroups; relatively litt
Probab=23.74  E-value=60  Score=24.04  Aligned_cols=15  Identities=33%  Similarity=0.439  Sum_probs=12.9

Q ss_pred             CCCCCCceEEEecCC
Q 034219           73 PAALEPKIVVIMAGD   87 (101)
Q Consensus        73 ~~~~e~kivVIMAGd   87 (101)
                      -+|-+.|||||+.||
T Consensus        45 g~DVkGKiVvvl~~~   59 (157)
T cd04821          45 GLDVKGKTVVILVND   59 (157)
T ss_pred             CCCcCCcEEEEEcCC
Confidence            458899999999886


No 115
>PF04976 DmsC:  DMSO reductase anchor subunit (DmsC);  InterPro: IPR007059 The terminal electron transfer enzyme dimethyl sulphoxide reductase of Escherichia coli is a heterotrimeric enzyme composed of a membrane extrinsic catalytic dimer (DmsAB) and a membrane intrinsic polytopic anchor subunit (DmsC) []. This family represents DmsC.; GO: 0019645 anaerobic electron transport chain, 0016021 integral to membrane
Probab=23.61  E-value=1.2e+02  Score=23.89  Aligned_cols=27  Identities=37%  Similarity=0.582  Sum_probs=19.1

Q ss_pred             ccccccCChhH-HHHHHHHHHHHHHHHH
Q 034219           15 GLVQWNSPLPY-MFGGLLLVFGVIAVAL   41 (101)
Q Consensus        15 ~~~~W~SPvPY-LFgGLa~MlgLIAvAL   41 (101)
                      ....||+|..+ .|.|-++++|....++
T Consensus       141 ~vp~W~~~~T~~~f~~tal~~G~~l~~~  168 (276)
T PF04976_consen  141 TVPAWNSPWTPISFLGTALLLGAALAAL  168 (276)
T ss_pred             chhcccCchHHHHHHHHHHHHHHHHHHH
Confidence            44678888655 7888888888865543


No 116
>PF11353 DUF3153:  Protein of unknown function (DUF3153);  InterPro: IPR021499  This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=23.51  E-value=96  Score=23.32  Aligned_cols=7  Identities=29%  Similarity=-0.021  Sum_probs=4.6

Q ss_pred             ccccccc
Q 034219           14 AGLVQWN   20 (101)
Q Consensus        14 ~~~~~W~   20 (101)
                      ..+|.|+
T Consensus       177 ~~~w~pn  183 (209)
T PF11353_consen  177 ASFWVPN  183 (209)
T ss_pred             EEEEecc
Confidence            4557777


No 117
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain. PolD2 (DNA polymerase delta, subunit 2) is an auxiliary subunit of the eukaryotic DNA polymerase delta (PolD) complex thought to play a regulatory role and to serve as a scaffold for PolD assembly by interacting simultaneously with all of the other three subunits.  PolD2 is catalytically inactive and lacks the active site residues required for phosphoesterase activity in other members of this superfamily.  PolD2 is also involved in the recruitment of several proteins regulating DNA metabolism, including p21, PDIP1, PDIP38, PDIP46, and WRN. Human PolD consists of four subunits: p125 (PolD1), p50 (PolD2), p66(PolD3), and p12(PolD4).  PolD is one of three major replicases in eukaryotes. PolD also plays an essential role in translesion DNA synthesis, homologous recombination, and DNA repair.  Within the PolD complex, PolD2 tightly associates with PolD3.  PolD2 belongs to the metallophosphatase (MPP) superfamily
Probab=23.46  E-value=50  Score=26.24  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=14.0

Q ss_pred             EEEecCCCCCceeccc
Q 034219           81 VVIMAGDDHPTRIARP   96 (101)
Q Consensus        81 vVIMAGd~~PTfLA~P   96 (101)
                      |+||+|+.-|+-.+-|
T Consensus        97 V~imPG~~Dp~~~~lP  112 (257)
T cd07387          97 VDLMPGEFDPANHSLP  112 (257)
T ss_pred             EEECCCCCCcccccCC
Confidence            7899999999988855


No 118
>TIGR02830 spore_III_AG stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG.
Probab=23.19  E-value=76  Score=24.40  Aligned_cols=18  Identities=28%  Similarity=0.480  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034219           30 LLLVFGVIAVALMFLACC   47 (101)
Q Consensus        30 La~MlgLIAvALliLaCS   47 (101)
                      +.+.|+||.++|||+.=.
T Consensus         5 ~l~il~l~GvlLli~s~~   22 (186)
T TIGR02830         5 YLLVLLLIGLLLLIVSSF   22 (186)
T ss_pred             HHHHHHHHHHHHHHhhcc
Confidence            345677888888887643


No 119
>PRK14061 unknown domain/lipoate-protein ligase A fusion protein; Provisional
Probab=23.05  E-value=1.7e+02  Score=26.17  Aligned_cols=30  Identities=20%  Similarity=0.106  Sum_probs=21.5

Q ss_pred             hhHHHHHHHHHHHH-HHHHHHHHHhhhcccC
Q 034219           23 LPYMFGGLLLVFGV-IAVALMFLACCHDKSS   52 (101)
Q Consensus        23 vPYLFgGLa~MlgL-IAvALliLaCSy~k~~   52 (101)
                      +-|++..+|+..|+ +|.-|+=+-=++|+.+
T Consensus       164 ~~~~m~l~~~~~g~~l~~~l~~~~~~~~~~~  194 (562)
T PRK14061        164 ILRLMLLLSLAIGVVLTRTLLQGKRTRWQQS  194 (562)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCccccccC
Confidence            45788888888886 5666666667777765


No 120
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=22.64  E-value=48  Score=25.92  Aligned_cols=28  Identities=21%  Similarity=0.217  Sum_probs=16.4

Q ss_pred             hhHHHHHHHHHH--HHHHHHHHHH-Hhhhccc
Q 034219           23 LPYMFGGLLLVF--GVIAVALMFL-ACCHDKS   51 (101)
Q Consensus        23 vPYLFgGLa~Ml--gLIAvALliL-aCSy~k~   51 (101)
                      .| +|.+|..+-  -|||++++.. .|-.||+
T Consensus        99 ~~-~lI~lv~~g~~lLla~~~~~~Y~~~~Rrs  129 (202)
T PF06365_consen   99 YP-TLIALVTSGSFLLLAILLGAGYCCHQRRS  129 (202)
T ss_pred             ce-EEEehHHhhHHHHHHHHHHHHHHhhhhcc
Confidence            35 899999888  4455444443 2333444


No 121
>PHA03231 glycoprotein BALF4; Provisional
Probab=22.51  E-value=74  Score=29.85  Aligned_cols=29  Identities=31%  Similarity=0.454  Sum_probs=20.1

Q ss_pred             ccccCChhHHHHHHHHHHHHHHHHHHHHHhhhc
Q 034219           17 VQWNSPLPYMFGGLLLVFGVIAVALMFLACCHD   49 (101)
Q Consensus        17 ~~W~SPvPYLFgGLa~MlgLIAvALliLaCSy~   49 (101)
                      +..+-|    ||||+.+|.+||+-++++.-.+|
T Consensus       698 sFl~NP----FGg~~iillvia~vv~v~l~~rr  726 (829)
T PHA03231        698 SFLKNP----FGGLAIGLLVIAVLVAVFLAYRR  726 (829)
T ss_pred             HHhcCc----hHHHHHHHHHHHHhhhhhHHHHH
Confidence            444445    89999988888877666654443


No 122
>PRK02624 psbH photosystem II reaction center protein H; Provisional
Probab=22.33  E-value=1.3e+02  Score=19.87  Aligned_cols=21  Identities=10%  Similarity=0.191  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 034219           30 LLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k   50 (101)
                      .++.|+|+++.|+|+.=-|..
T Consensus        31 Mgv~m~Lf~vFl~iiLeIYNs   51 (64)
T PRK02624         31 MAVFMVLFLVFLLIILQIYNQ   51 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHhCc
Confidence            466788899999888766644


No 123
>PRK13823 conjugal transfer protein TrbD; Provisional
Probab=22.29  E-value=75  Score=21.94  Aligned_cols=11  Identities=27%  Similarity=0.468  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHH
Q 034219           30 LLLVFGVIAVA   40 (101)
Q Consensus        30 La~MlgLIAvA   40 (101)
                      |+.+.|+||++
T Consensus        25 l~i~~g~la~~   35 (94)
T PRK13823         25 LVMFSGLLAGI   35 (94)
T ss_pred             HHHHHHHHHHH
Confidence            44444444444


No 124
>PF04964 Flp_Fap:  Flp/Fap pilin component;  InterPro: IPR007047  This entry is for the fimbriae associated protein Flp/Fap pilin component.
Probab=21.82  E-value=86  Score=18.64  Aligned_cols=13  Identities=38%  Similarity=0.542  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHH
Q 034219           31 LLVFGVIAVALMF   43 (101)
Q Consensus        31 a~MlgLIAvALli   43 (101)
                      +++.++|+++++.
T Consensus        14 ali~alia~~ii~   26 (46)
T PF04964_consen   14 ALIAALIAVAIIA   26 (46)
T ss_pred             HHHHHHHHHHHHH
Confidence            4567777777663


No 125
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=21.61  E-value=24  Score=27.14  Aligned_cols=17  Identities=41%  Similarity=0.983  Sum_probs=12.4

Q ss_pred             cccccccCChhHHHHHHH
Q 034219           14 AGLVQWNSPLPYMFGGLL   31 (101)
Q Consensus        14 ~~~~~W~SPvPYLFgGLa   31 (101)
                      .+||-|-||.- |++||+
T Consensus        90 sgFWgwlsPfa-Ll~gl~  106 (173)
T PF15470_consen   90 SGFWGWLSPFA-LLGGLA  106 (173)
T ss_pred             CCchhhhcHHH-Hhcccc
Confidence            79999999853 455554


No 126
>PF04961 FTCD_C:  Formiminotransferase-cyclodeaminase;  InterPro: IPR007044 Enzymes containing the cyclodeaminase domain function in channeling one-carbon units to the folate pool. In most cases, this domain catalyses the cyclisation of formimidoyltetrahydrofolate to methenyltetrahydrofolate as shown in reaction (1). In the methylotrophic bacterium Methylobacterium extorquens, however, it catalyses the interconversion of formyltetrahydrofolate and methylenetetrahydrofolate [],as shown in reaction (2) (1) 5-formimidoyltetrahydrofolate = 5,10-methenyltetrahydrofolate + NH(3) (2) 10- formyltetrahydrofolate = 5,10-methenyltetrahydrofolate + H(2)O In prokaryotes, this domain mostly occurs on its own, while in eukaryotes it is fused to a glutamate formiminotransferase domain (which catalyses the previous step in the pathway) to form the bifunctional enzyme formiminotransferase-cyclodeaminase []. The eukaryotic enzyme is a circular tetramer of homodimers [], while the prokaryotic enzyme is a dimer [, ].  The crystal structure of the cyclodeaminase enzyme (Q9X1P6 from SWISSPROT) from Thermaotogoa maritima has been studied []. It is a homodimer, where each monomer is composed of six alpha helices arranged in an up and down helical bundle, forming a novel fold. The location of the active site is not known, but sequence alignments revealed two clusters of conserved residues located in a deep pocket within the dimmer interface. This pocket was large enough to accommodate the reaction product and it was postulated that this is the active site.; GO: 0003824 catalytic activity, 0044237 cellular metabolic process; PDB: 2PFD_C 1O5H_B.
Probab=21.39  E-value=1.2e+02  Score=22.64  Aligned_cols=21  Identities=19%  Similarity=0.197  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q 034219           28 GGLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        28 gGLa~MlgLIAvALliLaCSy   48 (101)
                      |+.+++.|-++.||+.++|-+
T Consensus        20 GsaaAl~gAlgaaL~~Mv~~l   40 (184)
T PF04961_consen   20 GSAAALSGALGAALGSMVANL   40 (184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            567899999999999999876


No 127
>COG1704 LemA Uncharacterized conserved protein [Function unknown]
Probab=21.16  E-value=96  Score=24.15  Aligned_cols=23  Identities=17%  Similarity=0.339  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccC
Q 034219           30 LLLVFGVIAVALMFLACCHDKSS   52 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k~~   52 (101)
                      +...+++|.+.+++.+|+|..+.
T Consensus         4 ~~i~l~vi~il~ll~~~~yN~lv   26 (185)
T COG1704           4 FLIILAVIVILLLLAVGGYNGLV   26 (185)
T ss_pred             hHHHHHHHHHHHHHHHHhhhhHH
Confidence            44566677777777799997764


No 128
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=21.15  E-value=69  Score=17.46  Aligned_cols=19  Identities=16%  Similarity=0.441  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhh
Q 034219           29 GLLLVFGVIAVALMFLACCH   48 (101)
Q Consensus        29 GLa~MlgLIAvALliLaCSy   48 (101)
                      |+++++.|. +-|+|.-||+
T Consensus         5 ~FalivVLF-ILLiIvG~s~   23 (24)
T PF09680_consen    5 GFALIVVLF-ILLIIVGASC   23 (24)
T ss_pred             cchhHHHHH-HHHHHhccee
Confidence            455555443 3356667776


No 129
>TIGR03750 conj_TIGR03750 conjugative transfer region protein, TIGR03750 family. Members of this protein family are found occasionally on plasmids. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=21.09  E-value=1.5e+02  Score=21.15  Aligned_cols=28  Identities=18%  Similarity=0.108  Sum_probs=18.9

Q ss_pred             ChhHHHHHHHH--HHHHHHHHHHHHHhhhc
Q 034219           22 PLPYMFGGLLL--VFGVIAVALMFLACCHD   49 (101)
Q Consensus        22 PvPYLFgGLa~--MlgLIAvALliLaCSy~   49 (101)
                      |.-++++++++  ...+|.++|.|+.|..+
T Consensus        40 ~l~~~~~~w~~~p~~~lig~~l~v~~gg~~   69 (111)
T TIGR03750        40 LLALLAGPWALIPTGALLGPILVVLIGGKL   69 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Confidence            33355665554  45678888999999874


No 130
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=21.01  E-value=1.8e+02  Score=20.63  Aligned_cols=27  Identities=11%  Similarity=0.183  Sum_probs=21.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhc
Q 034219           23 LPYMFGGLLLVFGVIAVALMFLACCHD   49 (101)
Q Consensus        23 vPYLFgGLa~MlgLIAvALliLaCSy~   49 (101)
                      .|+--..||+.|.++...|+++.|--+
T Consensus        39 ~pwK~I~la~~Lli~G~~li~~g~l~~   65 (115)
T PF05915_consen   39 IPWKSIALAVFLLIFGTVLIIIGLLLF   65 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            568888999999999998888876544


No 131
>PLN00055 photosystem II reaction center protein H; Provisional
Probab=20.61  E-value=1.4e+02  Score=20.14  Aligned_cols=21  Identities=14%  Similarity=0.159  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 034219           30 LLLVFGVIAVALMFLACCHDK   50 (101)
Q Consensus        30 La~MlgLIAvALliLaCSy~k   50 (101)
                      .++.|+|+||.|+|+.=-|..
T Consensus        43 Mg~~m~lf~vfl~iileiyNs   63 (73)
T PLN00055         43 MGVAMALFAVFLSIILEIYNS   63 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc
Confidence            456788889998888755543


No 132
>PF07937 DUF1686:  Protein of unknown function (DUF1686);  InterPro: IPR012468 The members of this family are all hypothetical proteins of unknown function expressed by the eukaryotic parasite Encephalitozoon cuniculi GB-M1. The region in question is approximately 250 amino acids long. 
Probab=20.56  E-value=94  Score=24.27  Aligned_cols=18  Identities=17%  Similarity=0.384  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHhhhcc
Q 034219           33 VFGVIAVALMFLACCHDK   50 (101)
Q Consensus        33 MlgLIAvALliLaCSy~k   50 (101)
                      -.|+|.||+++|.++|-+
T Consensus       129 ~~g~Vvfa~lLllv~y~e  146 (185)
T PF07937_consen  129 CVGLVVFAILLLLVSYME  146 (185)
T ss_pred             ehHHHHHHHHHHHHHHHH
Confidence            368999999999999964


No 133
>cd02437 CCC1_like_1 CCC1-related protein family. CCC1_like_1: This is a protein family closely related to CCC1, a family of proteins involved in iron and manganese transport. Yeast CCC1 is a vacuole transmembrane protein responsible for the iron and manganese accumulation in vacuole.
Probab=20.42  E-value=1.8e+02  Score=21.29  Aligned_cols=15  Identities=20%  Similarity=0.226  Sum_probs=7.1

Q ss_pred             HHHHHHHHHhhhccc
Q 034219           37 IAVALMFLACCHDKS   51 (101)
Q Consensus        37 IAvALliLaCSy~k~   51 (101)
                      ..++|.++-+.+.|.
T Consensus       131 ~~~~L~~~G~~~~~~  145 (175)
T cd02437         131 VLAILFILGLVIGKI  145 (175)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            334444455555554


No 134
>PRK12361 hypothetical protein; Provisional
Probab=20.24  E-value=1.4e+02  Score=25.46  Aligned_cols=14  Identities=14%  Similarity=0.188  Sum_probs=10.6

Q ss_pred             HHHHHHHHHhhhcc
Q 034219           37 IAVALMFLACCHDK   50 (101)
Q Consensus        37 IAvALliLaCSy~k   50 (101)
                      .|++|++.++-|+-
T Consensus        37 ~~~~~~~v~~~y~~   50 (547)
T PRK12361         37 ISLSLFLVGSAYWF   50 (547)
T ss_pred             HHHHHHHHHHHHHh
Confidence            67788888888854


Done!