Query         034231
Match_columns 100
No_of_seqs    52 out of 54
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 11:12:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034231.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034231hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13856 Gifsy-2:  ATP-binding   92.5    0.32 6.9E-06   32.5   4.7   32   38-74     62-93  (95)
  2 PF08207 EFP_N:  Elongation fac  85.6     1.9   4E-05   26.9   4.0   23   43-65      5-27  (58)
  3 PRK10377 PTS system glucitol/s  83.6     1.8 3.9E-05   31.1   3.7   24   38-61     47-70  (120)
  4 PF05954 Phage_GPD:  Phage late  82.1     1.6 3.5E-05   32.3   3.0   24   43-66    259-289 (292)
  5 TIGR00849 gutA PTS system, glu  82.0     2.3   5E-05   30.6   3.7   24   38-61     47-70  (121)
  6 COG3731 SrlB Phosphotransferas  76.0     3.8 8.3E-05   30.3   3.4   25   37-61     46-70  (123)
  7 PF03829 PTSIIA_gutA:  PTS syst  74.7     3.8 8.3E-05   29.2   3.0   24   38-61     47-70  (117)
  8 PF13785 DUF4178:  Domain of un  73.0     8.8 0.00019   26.2   4.5   35   43-80      1-35  (140)
  9 PF08308 PEGA:  PEGA domain;  I  63.5     3.8 8.2E-05   25.2   1.0   55   37-92      4-66  (71)
 10 cd04487 RecJ_OBF2_like RecJ_OB  62.4      15 0.00033   23.7   3.7   33   39-81     40-72  (73)
 11 PF08750 CNP1:  CNP1-like famil  53.1     5.4 0.00012   29.4   0.4   45   35-90     11-57  (139)
 12 PRK03999 translation initiatio  52.3      33 0.00072   24.6   4.4   23   42-64     10-32  (129)
 13 TIGR03361 VI_Rhs_Vgr type VI s  49.2      29 0.00063   29.0   4.2   26   41-66    287-319 (513)
 14 PF11213 DUF3006:  Protein of u  48.5      22 0.00049   22.7   2.8   28   32-59     23-51  (71)
 15 PRK11507 ribosome-associated p  48.2      22 0.00049   23.7   2.8   17   43-59     53-69  (70)
 16 PF13275 S4_2:  S4 domain; PDB:  47.1      19 0.00041   23.4   2.3   16   43-58     49-64  (65)
 17 PHA02561 D tail protein; Provi  45.5      43 0.00093   26.4   4.4   33   41-74    300-339 (351)
 18 TIGR02178 yeiP elongation fact  44.2      38 0.00083   26.0   3.8   24   43-66      5-28  (186)
 19 COG0231 Efp Translation elonga  42.3      44 0.00095   24.1   3.7   30   42-71      8-37  (131)
 20 TIGR00037 eIF_5A translation i  41.5      44 0.00096   24.0   3.6   22   43-64     12-33  (130)
 21 COG5402 Uncharacterized conser  41.1      39 0.00084   26.7   3.5   24   37-60    142-167 (194)
 22 PF08816 Ivy:  Inhibitor of ver  40.2      26 0.00056   25.2   2.3   18   45-62     34-51  (118)
 23 PRK04542 elongation factor P;   39.8      49  0.0011   25.5   3.8   24   43-66      7-30  (189)
 24 cd06219 DHOD_e_trans_like1 FAD  38.8   1E+02  0.0023   23.0   5.4   50   42-96     26-75  (248)
 25 PF00924 MS_channel:  Mechanose  37.5      33 0.00073   24.5   2.5   30   38-67     56-85  (206)
 26 TIGR03817 DECH_helic helicase/  37.2      65  0.0014   29.0   4.7   43   19-62    481-526 (742)
 27 PRK14578 elongation factor P;   37.1      57  0.0012   25.0   3.8   27   43-69      7-33  (187)
 28 smart00643 C345C Netrin C-term  37.0      33  0.0007   22.9   2.2   40   40-79     55-97  (114)
 29 PRK00529 elongation factor P;   36.6      63  0.0014   24.3   3.9   23   42-64      6-28  (186)
 30 PF01592 NifU_N:  NifU-like N t  35.4      17 0.00036   25.3   0.7   21   31-51     13-40  (126)
 31 PF06949 DUF1292:  Protein of u  35.3      41 0.00089   21.4   2.4   15   48-62     13-27  (76)
 32 PF10844 DUF2577:  Protein of u  34.9      73  0.0016   21.6   3.7   25   37-61     71-99  (100)
 33 PRK11325 scaffold protein; Pro  34.8      27 0.00058   24.6   1.6   11   41-51     33-43  (127)
 34 PRK11354 kil FtsZ inhibitor pr  34.7 1.5E+02  0.0032   20.2   5.2   19   43-61     16-34  (73)
 35 PF13785 DUF4178:  Domain of un  34.6      82  0.0018   21.4   4.0   26   40-65     66-91  (140)
 36 TIGR00038 efp translation elon  34.5      70  0.0015   24.0   3.9   22   43-64      6-27  (184)
 37 KOG1755 Profilin [Cytoskeleton  34.0      51  0.0011   24.3   3.0   42   29-70     41-83  (128)
 38 PF12218 End_N_terminal:  N ter  31.6      34 0.00073   23.0   1.6   34   44-77     21-54  (67)
 39 cd04466 S1_YloQ_GTPase S1_YloQ  31.1      80  0.0017   18.8   3.1   12   41-52     36-47  (68)
 40 PF02911 Formyl_trans_C:  Formy  30.8      89  0.0019   19.8   3.5   45   43-87     27-76  (100)
 41 PRK15094 magnesium/cobalt effl  30.4      62  0.0014   25.6   3.2   26   39-64    247-272 (292)
 42 cd03583 NTR_complement_C3 NTR/  28.8      58  0.0013   23.9   2.6   27   36-62     69-96  (149)
 43 PLN03107 eukaryotic translatio  27.1   1E+02  0.0022   23.0   3.7   24   41-64     24-47  (159)
 44 cd03581 NTR_Sfrp3_like NTR dom  26.7      96  0.0021   21.5   3.3   47   33-82     44-90  (111)
 45 PF00278 Orn_DAP_Arg_deC:  Pyri  26.4      57  0.0012   21.3   2.0   18   36-53     76-93  (116)
 46 PRK09993 C-lysozyme inhibitor;  26.4      57  0.0012   24.9   2.2   21   42-62     61-81  (153)
 47 PRK13767 ATP-dependent helicas  25.6 1.7E+02  0.0037   26.8   5.5   48   22-84    521-570 (876)
 48 PF05393 Hum_adeno_E3A:  Human   25.6      21 0.00046   25.3  -0.2   32    4-41     53-84  (94)
 49 TIGR01999 iscU FeS cluster ass  25.5      49  0.0011   23.1   1.6   11   41-51     31-41  (124)
 50 PTZ00414 10 kDa heat shock pro  25.3      86  0.0019   22.0   2.8   18   44-61     74-91  (100)
 51 cd06664 IscU_like Iron-sulfur   25.3      52  0.0011   22.3   1.7   12   41-52     29-40  (123)
 52 PF14427 Pput2613-deam:  Pput_2  25.0      47   0.001   24.5   1.5   33   21-54     35-74  (118)
 53 TIGR01646 vgr_GE Rhs element V  24.8   1E+02  0.0022   25.6   3.6   30   35-65    274-310 (483)
 54 COG3364 Zn-ribbon containing p  24.7      44 0.00095   24.4   1.3   24   67-90     67-98  (112)
 55 COG2871 NqrF Na+-transporting   23.8      90  0.0019   27.0   3.2   30   21-53    227-264 (410)
 56 cd07890 CYTH-like_AC_IV-like A  23.1      67  0.0014   22.8   2.0   20   35-54    117-136 (169)
 57 smart00675 DM11 Domains in hyp  23.1 1.2E+02  0.0026   22.8   3.4   42   32-82     45-86  (164)
 58 PRK11573 hypothetical protein;  22.6      92   0.002   26.0   3.0   26   39-64    369-394 (413)
 59 PRK14533 groES co-chaperonin G  21.7 1.3E+02  0.0028   20.5   3.1   18   44-61     65-82  (91)
 60 PRK10334 mechanosensitive chan  21.6 1.9E+02  0.0042   23.0   4.5   30   38-67    125-154 (286)
 61 COG0223 Fmt Methionyl-tRNA for  21.6 1.3E+02  0.0027   24.9   3.5   22   42-63    229-250 (307)
 62 TIGR03419 NifU_clost FeS clust  20.7      71  0.0015   22.2   1.7   12   41-52     28-39  (121)
 63 TIGR03520 GldE gliding motilit  20.5   1E+02  0.0022   25.5   2.9   27   38-64    372-398 (408)
 64 PRK12426 elongation factor P;   20.2 2.4E+02  0.0051   21.7   4.6   30   43-72      7-36  (185)
 65 smart00676 DM10 Domains in hyp  20.2   3E+02  0.0065   18.9   5.1   30   31-60     50-91  (104)

No 1  
>PF13856 Gifsy-2:  ATP-binding sugar transporter from pro-phage; PDB: 2PP6_A.
Probab=92.55  E-value=0.32  Score=32.53  Aligned_cols=32  Identities=31%  Similarity=0.659  Sum_probs=21.1

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEe
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEP   74 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l   74 (100)
                      .+++ |++|+.|+++|++|+|..    ++...|.|++
T Consensus        62 d~~~-P~~gd~v~~dG~~y~V~~----~~~~~G~~~I   93 (95)
T PF13856_consen   62 DYPK-PRRGDRVVIDGESYTVTR----FQEEDGMYVI   93 (95)
T ss_dssp             S------TT-EEEETTEEEEEEE----EEEETTEEEE
T ss_pred             CCCC-CCCCCEEEECCeEEEEeE----EecCCCEEEE
Confidence            3555 999999999999999974    5566687765


No 2  
>PF08207 EFP_N:  Elongation factor P (EF-P) KOW-like domain;  InterPro: IPR013185  This entry represents the N-terminal domain of homologues of elongation factor P, which probably are translation initiation factors. ; PDB: 3TRE_A 1YBY_A 1IZ6_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H 3OYY_B.
Probab=85.59  E-value=1.9  Score=26.86  Aligned_cols=23  Identities=26%  Similarity=0.510  Sum_probs=19.4

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHRY   65 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrY   65 (100)
                      ..+|..|+++|+-|.|++..|.=
T Consensus         5 lr~G~~i~~~g~~~~V~~~~~~k   27 (58)
T PF08207_consen    5 LRKGMVIEIDGEPYVVLDFQHVK   27 (58)
T ss_dssp             --TTSEEEETTEEEEEEEEEEEC
T ss_pred             ccCCCEEEECCEEEEEEEEEEEC
Confidence            46899999999999999998864


No 3  
>PRK10377 PTS system glucitol/sorbitol-specific transporter subunit IIA; Provisional
Probab=83.64  E-value=1.8  Score=31.12  Aligned_cols=24  Identities=25%  Similarity=0.335  Sum_probs=21.3

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAV   61 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~r   61 (100)
                      .++...++|+.+.++++.|.|..+
T Consensus        47 ~~~~~i~~Gd~l~i~~~~Y~ItaV   70 (120)
T PRK10377         47 ELKGALQPGLQFELGQHRYPVTAV   70 (120)
T ss_pred             cccCccCCCCEEEECCEEEEEEEE
Confidence            456778999999999999999876


No 4  
>PF05954 Phage_GPD:  Phage late control gene D protein (GPD); PDB: 2P5Z_X 3D37_A 1WRU_A 3CDD_E.
Probab=82.06  E-value=1.6  Score=32.31  Aligned_cols=24  Identities=38%  Similarity=0.696  Sum_probs=21.5

Q ss_pred             CCCCCeEEEcC-------eEEEEEEEEEEEE
Q 034231           43 LQCGESVTIEG-------QAYTISAVTHRYQ   66 (100)
Q Consensus        43 pqpG~~le~eg-------~sY~Vl~rrHrYq   66 (100)
                      ..||..|++.|       ..|+|.+++|++.
T Consensus       259 l~~G~~v~l~~~~~~~~~g~y~I~~V~h~~~  289 (292)
T PF05954_consen  259 LRPGRRVTLSGHPGGEFDGEYLITEVEHSFS  289 (292)
T ss_dssp             B-TTEEEEEEETTTTCEEEEEEEEEEEEEEE
T ss_pred             ECcCCEEEEcCCcCccCCCcEEEEEEEEEEE
Confidence            69999999999       7899999999987


No 5  
>TIGR00849 gutA PTS system, glucitol/sorbitol-specific IIA component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria.The system in E.Coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.
Probab=81.96  E-value=2.3  Score=30.65  Aligned_cols=24  Identities=33%  Similarity=0.462  Sum_probs=20.6

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAV   61 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~r   61 (100)
                      .+....++|+.+.++++.|.|..+
T Consensus        47 ~~~~~i~~Gd~l~i~~~~Y~ItaV   70 (121)
T TIGR00849        47 EVKGTLKPGQVFMIGGIAYPVTAV   70 (121)
T ss_pred             cccCCcCCCCEEEECCEEEEEEEE
Confidence            345568999999999999999876


No 6  
>COG3731 SrlB Phosphotransferase system sorbitol-specific component IIA [Carbohydrate transport and metabolism]
Probab=76.04  E-value=3.8  Score=30.26  Aligned_cols=25  Identities=36%  Similarity=0.580  Sum_probs=21.8

Q ss_pred             EEcCCCCCCCCeEEEcCeEEEEEEE
Q 034231           37 RCFPPNLQCGESVTIEGQAYTISAV   61 (100)
Q Consensus        37 ~~Lp~~pqpG~~le~eg~sY~Vl~r   61 (100)
                      -.+..+.|||+.++++++.|.|..+
T Consensus        46 ~e~~~~l~~G~~l~lg~~~y~ItaV   70 (123)
T COG3731          46 GELQEALQPGDRLTLGGHCYPITAV   70 (123)
T ss_pred             CcccccCCCCCEEEECCceEEEEEe
Confidence            3466778999999999999999986


No 7  
>PF03829 PTSIIA_gutA:  PTS system glucitol/sorbitol-specific IIA component;  InterPro: IPR004716 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  The Man family is unique in several respects among PTS permease families:   It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.   This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria. The system in Escherichia coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0005737 cytoplasm; PDB: 2F9H_A.
Probab=74.72  E-value=3.8  Score=29.22  Aligned_cols=24  Identities=38%  Similarity=0.643  Sum_probs=17.0

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAV   61 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~r   61 (100)
                      .+...+++|+.+.++++.|.|..+
T Consensus        47 ~~~~~i~~Gd~l~i~~~~y~ItaV   70 (117)
T PF03829_consen   47 ELKGDIKPGDTLIIGGQEYTITAV   70 (117)
T ss_dssp             GGG----TT-EEEETTEEEEEEEE
T ss_pred             cccCCcCCCCEEEECCeEEEEEEE
Confidence            466779999999999999999876


No 8  
>PF13785 DUF4178:  Domain of unknown function (DUF4178)
Probab=73.02  E-value=8.8  Score=26.24  Aligned_cols=35  Identities=29%  Similarity=0.259  Sum_probs=25.5

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLD   80 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~   80 (100)
                      .++|+.+.++|+.|+|..+-. |  +.+.|.=.+--|+
T Consensus         1 L~~G~~~~~~g~~~~ViG~~~-~--~~~~~~W~E~~L~   35 (140)
T PF13785_consen    1 LQLGDIGRIDGKDYTVIGRIQ-Y--DYEGGFWTEYLLY   35 (140)
T ss_pred             CCCCCEEEECCeEEEEEEEEE-E--ECCCCeeEEEEEE
Confidence            478999999999999988654 4  4555555554444


No 9  
>PF08308 PEGA:  PEGA domain;  InterPro: IPR013229 This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins. It is named after the characteristic PEGA sequence motif found in this domain. The secondary structure of this domain is predicted to be beta-strands.
Probab=63.50  E-value=3.8  Score=25.21  Aligned_cols=55  Identities=22%  Similarity=0.319  Sum_probs=36.6

Q ss_pred             EEcCCCCCCCCeEEEcCeE-------EE-EEEEEEEEEEecceEEecceeEEEeecchhhHHHH
Q 034231           37 RCFPPNLQCGESVTIEGQA-------YT-ISAVTHRYQLRKGKYEPSEKRLDVLSSSRYILNLY   92 (100)
Q Consensus        37 ~~Lp~~pqpG~~le~eg~s-------Y~-Vl~rrHrYqLr~GrY~l~~i~L~Vq~~~Ry~~n~~   92 (100)
                      +.+..+|. |..|.++|+.       .. +..-.|+..++...|+.....+.|.+....-+|..
T Consensus         4 l~V~s~p~-gA~V~vdg~~~G~tp~~~~~l~~G~~~v~v~~~Gy~~~~~~v~v~~~~~~~v~~~   66 (71)
T PF08308_consen    4 LRVTSNPS-GAEVYVDGKYIGTTPLTLKDLPPGEHTVTVEKPGYEPYTKTVTVKPGETTTVNVT   66 (71)
T ss_pred             EEEEEECC-CCEEEECCEEeccCcceeeecCCccEEEEEEECCCeeEEEEEEECCCCEEEEEEE
Confidence            33333433 5666666632       22 44678999999999999999999997665555443


No 10 
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=62.40  E-value=15  Score=23.67  Aligned_cols=33  Identities=24%  Similarity=0.520  Sum_probs=25.8

Q ss_pred             cCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEE
Q 034231           39 FPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDV   81 (100)
Q Consensus        39 Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~V   81 (100)
                      +...|.+|+.|++.|.   |.       +.+|+|++.-..+.|
T Consensus        40 ~~~~l~~Gd~V~v~G~---v~-------~~~G~~ql~v~~i~~   72 (73)
T cd04487          40 AYPEVEVGDIVRVTGE---VE-------PRDGQLQIEVESLEV   72 (73)
T ss_pred             CcCCCCCCCEEEEEEE---Ee-------cCCeEEEEEEeeEEE
Confidence            6677999999999998   22       278999987666665


No 11 
>PF08750 CNP1:  CNP1-like family;  InterPro: IPR014861 This group of proteins are likely to be lipoproteins. CNP1 (cryptic neisserial protein) has been expressed in Escherichia coli and shown to be localised periplasmicly []. 
Probab=53.07  E-value=5.4  Score=29.37  Aligned_cols=45  Identities=20%  Similarity=0.183  Sum_probs=31.3

Q ss_pred             eeEEcCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEEeecc--hhhHH
Q 034231           35 GIRCFPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVLSSS--RYILN   90 (100)
Q Consensus        35 G~~~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~Vq~~~--Ry~~n   90 (100)
                      ....||+.|+.+++++++=..           -...+|.+|..+|.|-+.+  ||+|+
T Consensus        11 ~~~~LPp~P~~~~l~~f~v~~-----------~~~~~f~ID~~Sisvg~DgvVRY~lv   57 (139)
T PF08750_consen   11 AEVPLPPAPQDANLLPFDVSP-----------TSPLKFFIDPKSISVGPDGVVRYTLV   57 (139)
T ss_pred             cccCCCCCCCcCCccEEECCC-----------CCCceEEEchhheEECCCCcEEEEEE
Confidence            345789999999998876411           1345777887777777766  77654


No 12 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=52.27  E-value=33  Score=24.55  Aligned_cols=23  Identities=26%  Similarity=0.502  Sum_probs=20.5

Q ss_pred             CCCCCCeEEEcCeEEEEEEEEEE
Q 034231           42 NLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      ...+|+.|+++|.-|.|++..|.
T Consensus        10 ~lrkG~~i~~~g~p~~V~~~~~~   32 (129)
T PRK03999         10 ELKEGSYVVIDGEPCKIVEISKS   32 (129)
T ss_pred             HccCCCEEEECCEEEEEEEEEee
Confidence            45789999999999999999875


No 13 
>TIGR03361 VI_Rhs_Vgr type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
Probab=49.15  E-value=29  Score=29.00  Aligned_cols=26  Identities=27%  Similarity=0.414  Sum_probs=22.6

Q ss_pred             CCCCCCCeEEEcCe-------EEEEEEEEEEEE
Q 034231           41 PNLQCGESVTIEGQ-------AYTISAVTHRYQ   66 (100)
Q Consensus        41 ~~pqpG~~le~eg~-------sY~Vl~rrHrYq   66 (100)
                      +..+||.+|++.|.       .|+|.+++|...
T Consensus       287 ~~l~~G~~~~l~~~~~~~~~g~ylVt~v~H~~~  319 (513)
T TIGR03361       287 RRLAPGYLFTLSGHPRAALNREYLVVSVHHHGR  319 (513)
T ss_pred             CeEcCCCEEEeCCCCCcccCCCEEEEEEEEEEE
Confidence            45889999999874       599999999995


No 14 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=48.53  E-value=22  Score=22.73  Aligned_cols=28  Identities=18%  Similarity=0.221  Sum_probs=22.3

Q ss_pred             ceeeeEEcCCCCCCCCeEEE-cCeEEEEE
Q 034231           32 KCLGIRCFPPNLQCGESVTI-EGQAYTIS   59 (100)
Q Consensus        32 r~LG~~~Lp~~pqpG~~le~-eg~sY~Vl   59 (100)
                      -.+-.-.||..-+.|++|.+ ++.+|.+.
T Consensus        23 ~~vp~~~LP~~~keGDvl~i~~~~~~~~d   51 (71)
T PF11213_consen   23 IDVPRSRLPEGAKEGDVLEIGEDGSIEID   51 (71)
T ss_pred             EEEEHHHCCCCCCcccEEEECCCceEEEC
Confidence            34556679999999999999 77777764


No 15 
>PRK11507 ribosome-associated protein; Provisional
Probab=48.24  E-value=22  Score=23.65  Aligned_cols=17  Identities=18%  Similarity=0.538  Sum_probs=15.4

Q ss_pred             CCCCCeEEEcCeEEEEE
Q 034231           43 LQCGESVTIEGQAYTIS   59 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl   59 (100)
                      ..||+.|+++|+.|.|.
T Consensus        53 l~~GD~V~~~g~~~~v~   69 (70)
T PRK11507         53 IVAGQTVSFAGHSVQVV   69 (70)
T ss_pred             CCCCCEEEECCEEEEEe
Confidence            68999999999999875


No 16 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=47.11  E-value=19  Score=23.44  Aligned_cols=16  Identities=38%  Similarity=0.827  Sum_probs=13.3

Q ss_pred             CCCCCeEEEcCeEEEE
Q 034231           43 LQCGESVTIEGQAYTI   58 (100)
Q Consensus        43 pqpG~~le~eg~sY~V   58 (100)
                      ..||+.|++++..|.|
T Consensus        49 l~~GD~V~~~~~~~~V   64 (65)
T PF13275_consen   49 LRPGDVVEIDGEEYRV   64 (65)
T ss_dssp             --SSEEEEETTEEEEE
T ss_pred             CCCCCEEEECCEEEEE
Confidence            6799999999999987


No 17 
>PHA02561 D tail protein; Provisional
Probab=45.48  E-value=43  Score=26.44  Aligned_cols=33  Identities=27%  Similarity=0.424  Sum_probs=25.5

Q ss_pred             CCCCCCCeEEEc-------CeEEEEEEEEEEEEEecceEEe
Q 034231           41 PNLQCGESVTIE-------GQAYTISAVTHRYQLRKGKYEP   74 (100)
Q Consensus        41 ~~pqpG~~le~e-------g~sY~Vl~rrHrYqLr~GrY~l   74 (100)
                      +...||..|++.       +..|+|.+++|+|.-.+| |.-
T Consensus       300 ~~l~aG~~v~l~g~~~~~~~g~y~V~sv~H~~~~~~g-y~t  339 (351)
T PHA02561        300 ADLAPELPVEVSGFKPEIDEGEWSIDKVTHRLNRGGG-YTT  339 (351)
T ss_pred             cceecCceEEEEecCccccCCeEEEEEEEEEEeCCCC-EEE
Confidence            557999999996       467999999999864444 543


No 18 
>TIGR02178 yeiP elongation factor P-like protein YeiP. This model represents the family of Escherichia coli protein YeiP, a close homolog of elongation factor P (TIGR00038) and probably itself a translation factor. Member of this family are found only in some Gammaproteobacteria, including E. coli and Vibrio cholerae.
Probab=44.16  E-value=38  Score=26.01  Aligned_cols=24  Identities=17%  Similarity=0.315  Sum_probs=21.0

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQ   66 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYq   66 (100)
                      ..+|..|+++|+-|.|++..|.=.
T Consensus         5 lk~G~~i~~dg~~~~V~~~~~~kp   28 (186)
T TIGR02178         5 MKKGSIVEYNGKTLLIKDIQRSSP   28 (186)
T ss_pred             ccCCCEEEECCEEEEEEEEEEECC
Confidence            568999999999999999998533


No 19 
>COG0231 Efp Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) [Translation, ribosomal structure and biogenesis]
Probab=42.33  E-value=44  Score=24.11  Aligned_cols=30  Identities=23%  Similarity=0.484  Sum_probs=24.0

Q ss_pred             CCCCCCeEEEcCeEEEEEEEEEEEEEecce
Q 034231           42 NLQCGESVTIEGQAYTISAVTHRYQLRKGK   71 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rrHrYqLr~Gr   71 (100)
                      ...+|.+|.++|..|.|++..|-=.=|+|.
T Consensus         8 ~lr~G~~i~~dg~~~~V~~~~~~KpGKg~a   37 (131)
T COG0231           8 ELRKGLYIVIDGEPYVVVEISHVKPGKGGA   37 (131)
T ss_pred             HccCCCEEEECCeEEEEEEEEEccCCCCCc
Confidence            357899999999999999998864444444


No 20 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=41.47  E-value=44  Score=23.95  Aligned_cols=22  Identities=27%  Similarity=0.520  Sum_probs=20.2

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      ..+|.+|+++|.-|.|++..|.
T Consensus        12 irkG~~i~~~g~p~~V~e~~~~   33 (130)
T TIGR00037        12 LRVGGYVVIDGRPCKIVDISTS   33 (130)
T ss_pred             ccCCCEEEECCEEEEEEEEEec
Confidence            5689999999999999999886


No 21 
>COG5402 Uncharacterized conserved protein [Function unknown]
Probab=41.08  E-value=39  Score=26.72  Aligned_cols=24  Identities=17%  Similarity=0.332  Sum_probs=18.4

Q ss_pred             EEcCCCCCCCCeEEEcCeE--EEEEE
Q 034231           37 RCFPPNLQCGESVTIEGQA--YTISA   60 (100)
Q Consensus        37 ~~Lp~~pqpG~~le~eg~s--Y~Vl~   60 (100)
                      +.+.+.+|||+|+-++|.-  ++||.
T Consensus       142 I~vsp~a~pgnWl~~~g~g~f~lVlt  167 (194)
T COG5402         142 ITVSPDAQPGNWLPVRGEGNFILVLT  167 (194)
T ss_pred             EEECCCCCCCceeEecCCccEEEEEE
Confidence            5677889999999998854  55553


No 22 
>PF08816 Ivy:  Inhibitor of vertebrate lysozyme (Ivy);  InterPro: IPR014453 C-type lysozyme enzymes, such as hen egg white lysozyme (HEWL), provide anti-bacterial activity by cleaving peptidoglycan in Gram-positive bacterial cell walls. In humans, C-type lysozyme is found in all secretions, including tears and saliva. Certain Gram-positive bacteria can produce proteins with anti-lysozyme activity known as Inhibitor of Vertebrate Lysozyme (IVY), which act as virulence factors [, ]. IVY proteins have a 3-layer alpha(2)/beta(5)/alpha(2) topology, and contain a protruding 5-residue loop that is essential for their inhibitory effect [].; GO: 0043086 negative regulation of catalytic activity, 0042597 periplasmic space; PDB: 1GPQ_A 1XS0_A 1UUZ_B.
Probab=40.20  E-value=26  Score=25.18  Aligned_cols=18  Identities=33%  Similarity=0.552  Sum_probs=16.6

Q ss_pred             CCCeEEEcCeEEEEEEEE
Q 034231           45 CGESVTIEGQAYTISAVT   62 (100)
Q Consensus        45 pG~~le~eg~sY~Vl~rr   62 (100)
                      |+++|+++|+.|+|....
T Consensus        34 P~~~V~~~G~~Y~v~~~C   51 (118)
T PF08816_consen   34 PMEAVTIDGKPYLVGSAC   51 (118)
T ss_dssp             EEEEEEETTEEEEEEEEE
T ss_pred             CCeeEEECCEEEEEeccc
Confidence            899999999999998865


No 23 
>PRK04542 elongation factor P; Provisional
Probab=39.78  E-value=49  Score=25.49  Aligned_cols=24  Identities=13%  Similarity=0.282  Sum_probs=21.1

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQ   66 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYq   66 (100)
                      ...|..|+++|+-|.|++..|.=.
T Consensus         7 ik~G~~i~~~g~~~~V~~~~h~kp   30 (189)
T PRK04542          7 IKKGMVVEYNGKLLLVKDIDRQSP   30 (189)
T ss_pred             cCCCCEEEECCEEEEEEEEEEECC
Confidence            568999999999999999988644


No 24 
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD,
Probab=38.79  E-value=1e+02  Score=23.02  Aligned_cols=50  Identities=12%  Similarity=0.042  Sum_probs=31.1

Q ss_pred             CCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEEeecchhhHHHHHHHh
Q 034231           42 NLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVLSSSRYILNLYLENL   96 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~Vq~~~Ry~~n~~l~~l   96 (100)
                      ..+||+++.+.-.   .....|-|.+-+.--+-..+.+.|+..+..  ..+|+++
T Consensus        26 ~~~pGQf~~l~~~---~~~~~~pySi~s~~~~~~~~~~~vk~~G~~--t~~l~~l   75 (248)
T cd06219          26 KAKPGQFVIVRAD---EKGERIPLTIADWDPEKGTITIVVQVVGKS--TRELATL   75 (248)
T ss_pred             cCCCCcEEEEEcC---CCCCccceEeEEEcCCCCEEEEEEEeCCch--HHHHHhc
Confidence            4689999988521   011245788776533345688999888763  4555554


No 25 
>PF00924 MS_channel:  Mechanosensitive ion channel;  InterPro: IPR006685 Mechanosensitive (MS) channels provide protection against hypo-osmotic shock, responding both to stretching of the cell membrane and to membrane depolarisation. They are present in the membranes of organisms from the three domains of life: bacteria, archaea, and eukarya []. There are two families of MS channels: large-conductance MS channels (MscL) and small-conductance MS channels (MscS or YGGB). The pressure threshold for MscS opening is 50% that of MscL []. The MscS family is much larger and more variable in size and sequence than the MscL family. Much of the diversity in MscS proteins occurs in the size of the transmembrane regions, which ranges from three to eleven transmembrane helices, although the three C-terminal helices are conserved. This family contains sequences form the MscS family of proteins. MscS folds as a homo-heptamer with a cylindrical shape, and can be divided into transmembrane and extramembrane regions: an N-terminal periplasmic region, a transmembrane region, and a C-terminal cytoplasmic region (middle and C-terminal domains). The transmembrane region forms a channel through the membrane that opens into a chamber enclosed by the extramembrane portion, the latter connecting to the cytoplasm through distinct portals [].; GO: 0055085 transmembrane transport, 0016020 membrane; PDB: 2OAU_E 2VV5_F.
Probab=37.50  E-value=33  Score=24.45  Aligned_cols=30  Identities=17%  Similarity=0.300  Sum_probs=20.8

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAVTHRYQL   67 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqL   67 (100)
                      .++.+-..||||+++|....|.+..-+|--
T Consensus        56 ~~~~pf~vGD~I~i~~~~G~V~~I~l~~t~   85 (206)
T PF00924_consen   56 LFERPFKVGDRIEIGGVEGRVEEIGLRSTR   85 (206)
T ss_dssp             HCC-SS-TT-EEESSS-EEEEEEE-SSEEE
T ss_pred             hccCCccCCCEEEEEEeehHHHhcCcceee
Confidence            356678999999999999999998877753


No 26 
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=37.24  E-value=65  Score=28.95  Aligned_cols=43  Identities=19%  Similarity=0.293  Sum_probs=35.0

Q ss_pred             ccceEEEEeCCCCceeeeEEcCC---CCCCCCeEEEcCeEEEEEEEE
Q 034231           19 IHPYKVVEITPPPKCLGIRCFPP---NLQCGESVTIEGQAYTISAVT   62 (100)
Q Consensus        19 slp~EV~~~t~p~r~LG~~~Lp~---~pqpG~~le~eg~sY~Vl~rr   62 (100)
                      .-.|.|++ ....+.+|.+..+-   ..+||..+-+.|++|.|.+..
T Consensus       481 ~~~~~v~~-~~~~~~ig~~d~~~a~~~~~~gavy~~~g~~y~v~~~d  526 (742)
T TIGR03817       481 GAPVAIVE-AETGRLLGTVDAGAAHSTVHPGAVYLHQGESYVVDELD  526 (742)
T ss_pred             CCcEEEEE-CCCCeEEEEECHHHHHHHhCCCcEEEECCeEEEEEEEE
Confidence            44688888 66678899887654   489999999999999998764


No 27 
>PRK14578 elongation factor P; Provisional
Probab=37.07  E-value=57  Score=25.02  Aligned_cols=27  Identities=15%  Similarity=0.281  Sum_probs=22.4

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEEEec
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQLRK   69 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYqLr~   69 (100)
                      ..+|.+|+++|.-|.|++..|.=-=++
T Consensus         7 ik~G~~i~~dg~~~~V~~~~~~kpg~~   33 (187)
T PRK14578          7 FKKGLVIQLDGAPCLLLDVTFQSPSAR   33 (187)
T ss_pred             cCCCCEEEECCEEEEEEEEEEEcCCCC
Confidence            568999999999999999998754333


No 28 
>smart00643 C345C Netrin C-terminal Domain.
Probab=36.98  E-value=33  Score=22.86  Aligned_cols=40  Identities=15%  Similarity=0.433  Sum_probs=27.0

Q ss_pred             CCCCCCCCeEEE-cCeEEEEEEEEEE-EEEe-cceEEecceeE
Q 034231           40 PPNLQCGESVTI-EGQAYTISAVTHR-YQLR-KGKYEPSEKRL   79 (100)
Q Consensus        40 p~~pqpG~~le~-eg~sY~Vl~rrHr-YqLr-~GrY~l~~i~L   79 (100)
                      .+..+|..-..+ .|++|+|+..... +... .|+|.++.-++
T Consensus        55 ~~~~~C~cp~~l~~g~~YLImG~~~~~~~~~~~~~~~l~~~s~   97 (114)
T smart00643       55 ISRASCRCPLLLKKGKSYLIMGKSGDLWDVKGRGQYVLGKNSW   97 (114)
T ss_pred             eeccccCCccccCCCCEEEEecCCCCccccCCccEEEeCCCeE
Confidence            344778777655 7999999997532 3334 47788876443


No 29 
>PRK00529 elongation factor P; Validated
Probab=36.56  E-value=63  Score=24.27  Aligned_cols=23  Identities=26%  Similarity=0.563  Sum_probs=20.5

Q ss_pred             CCCCCCeEEEcCeEEEEEEEEEE
Q 034231           42 NLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      ...+|+.|.++|+-|.|++..|.
T Consensus         6 ~ik~G~~I~~~g~~~~V~~~~~~   28 (186)
T PRK00529          6 DLRKGLVIEIDGEPYVVLEFEHV   28 (186)
T ss_pred             hcCCCCEEEECCEEEEEEEEEEe
Confidence            35789999999999999998885


No 30 
>PF01592 NifU_N:  NifU-like N terminal domain;  InterPro: IPR002871 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] []. FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins [, ]. It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly []. The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA []. SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA [], acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins []. Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen []. This entry represents the N-terminal of NifU and homologous proteins. NifU contains two domains: an N-terminal and a C-terminal domain (IPR001075 from INTERPRO) []. These domains exist either together or on different polypeptides, both domains being found in organisms that do not fix nitrogen (e.g. yeast), so they have a broader significance in the cell than nitrogen fixation. ; GO: 0005506 iron ion binding, 0051536 iron-sulfur cluster binding, 0016226 iron-sulfur cluster assembly; PDB: 3LVL_A 4EB5_C 4EB7_C 1WFZ_A 2Z7E_C 2AZH_A 1XJS_A 1Q48_A 1R9P_A 2KQK_A ....
Probab=35.40  E-value=17  Score=25.29  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=14.0

Q ss_pred             CceeeeEEcCC-------CCCCCCeEEE
Q 034231           31 PKCLGIRCFPP-------NLQCGESVTI   51 (100)
Q Consensus        31 ~r~LG~~~Lp~-------~pqpG~~le~   51 (100)
                      |+..|.+.-++       ||.||++|++
T Consensus        13 P~~~g~l~~~~~~~~~~~n~~CGD~i~i   40 (126)
T PF01592_consen   13 PRNYGKLEDADAGTGEAGNPSCGDEIRI   40 (126)
T ss_dssp             TSSBSSSTTTSSEEEEEEETTTTEEEEE
T ss_pred             CCCCCCCCCCCcceeeecCCCCCCEEEE
Confidence            45555554444       6899999875


No 31 
>PF06949 DUF1292:  Protein of unknown function (DUF1292);  InterPro: IPR009711 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.
Probab=35.25  E-value=41  Score=21.39  Aligned_cols=15  Identities=13%  Similarity=0.459  Sum_probs=12.8

Q ss_pred             eEEEcCeEEEEEEEE
Q 034231           48 SVTIEGQAYTISAVT   62 (100)
Q Consensus        48 ~le~eg~sY~Vl~rr   62 (100)
                      .++++|++|+|+.-.
T Consensus        13 ~f~~~~~~Y~~l~~~   27 (76)
T PF06949_consen   13 EFEVDGKEYIVLVPV   27 (76)
T ss_pred             EEEECCeEEEEEEec
Confidence            688999999999864


No 32 
>PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=34.92  E-value=73  Score=21.57  Aligned_cols=25  Identities=28%  Similarity=0.507  Sum_probs=19.4

Q ss_pred             EEcCCCCCCCCeEEE----cCeEEEEEEE
Q 034231           37 RCFPPNLQCGESVTI----EGQAYTISAV   61 (100)
Q Consensus        37 ~~Lp~~pqpG~~le~----eg~sY~Vl~r   61 (100)
                      +.+.+....|++|-+    +||.|+|+-|
T Consensus        71 i~~~~~Lk~GD~V~ll~~~~gQ~yiVlDk   99 (100)
T PF10844_consen   71 ITFTDGLKVGDKVLLLRVQGGQKYIVLDK   99 (100)
T ss_pred             EEEecCCcCCCEEEEEEecCCCEEEEEEe
Confidence            556667889999876    7888988865


No 33 
>PRK11325 scaffold protein; Provisional
Probab=34.79  E-value=27  Score=24.59  Aligned_cols=11  Identities=18%  Similarity=0.604  Sum_probs=9.2

Q ss_pred             CCCCCCCeEEE
Q 034231           41 PNLQCGESVTI   51 (100)
Q Consensus        41 ~~pqpG~~le~   51 (100)
                      -||.||+.|++
T Consensus        33 ~np~CGD~i~l   43 (127)
T PRK11325         33 GAPACGDVMKL   43 (127)
T ss_pred             cCCCCccEEEE
Confidence            47889999876


No 34 
>PRK11354 kil FtsZ inhibitor protein; Reviewed
Probab=34.71  E-value=1.5e+02  Score=20.22  Aligned_cols=19  Identities=37%  Similarity=0.476  Sum_probs=17.5

Q ss_pred             CCCCCeEEEcCeEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAV   61 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~r   61 (100)
                      ..||..|-++|++|..+..
T Consensus        16 V~PG~~v~~~grty~ASAN   34 (73)
T PRK11354         16 VTPGDYVLHEGRTYIASAN   34 (73)
T ss_pred             cCCceEEEEcCcEEEEEec
Confidence            6899999999999999876


No 35 
>PF13785 DUF4178:  Domain of unknown function (DUF4178)
Probab=34.64  E-value=82  Score=21.40  Aligned_cols=26  Identities=27%  Similarity=0.455  Sum_probs=22.3

Q ss_pred             CCCCCCCCeEEEcCeEEEEEEEEEEE
Q 034231           40 PPNLQCGESVTIEGQAYTISAVTHRY   65 (100)
Q Consensus        40 p~~pqpG~~le~eg~sY~Vl~rrHrY   65 (100)
                      ..+..||+.++++|+.|.+.+...-.
T Consensus        66 ~~~~~~~~~~~~~g~~y~~~e~~~a~   91 (140)
T PF13785_consen   66 DDNLPPGDTVTYDGKRYRLDESGTAR   91 (140)
T ss_pred             ccccCCCCEEEECCeEEEEEEeEEEE
Confidence            56778999999999999999886655


No 36 
>TIGR00038 efp translation elongation factor P. function: involved in peptide bond synthesis. stimulate efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (by similarity). The trusted cutoff of this model is set high enough to exclude members of TIGR02178, an EFP-like protein of certain Gammaproteobacteria.
Probab=34.49  E-value=70  Score=24.02  Aligned_cols=22  Identities=23%  Similarity=0.537  Sum_probs=20.1

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEE
Q 034231           43 LQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      ..+|+.|.++|+-|.|++..|.
T Consensus         6 ik~G~~I~~~g~~~~V~~~~~~   27 (184)
T TIGR00038         6 LRKGLVIELDGEPYVVLEFEHV   27 (184)
T ss_pred             ccCCCEEEECCEEEEEEEEEEe
Confidence            5789999999999999999884


No 37 
>KOG1755 consensus Profilin [Cytoskeleton]
Probab=34.03  E-value=51  Score=24.35  Aligned_cols=42  Identities=21%  Similarity=0.271  Sum_probs=29.3

Q ss_pred             CCCceeeeEEc-CCCCCCCCeEEEcCeEEEEEEEEEEEEEecc
Q 034231           29 PPPKCLGIRCF-PPNLQCGESVTIEGQAYTISAVTHRYQLRKG   70 (100)
Q Consensus        29 ~p~r~LG~~~L-p~~pqpG~~le~eg~sY~Vl~rrHrYqLr~G   70 (100)
                      |.+...+..-+ +++-.+++=++++|+.|+|.+-.-++.++++
T Consensus        41 ~~e~~~~v~~F~d~~~~~~~Gl~L~Gqkylv~~ge~~~~~~gk   83 (128)
T KOG1755|consen   41 PSEIPAIVAGFKDPGGLAGTGLTLGGQKYLVVRGEEGRVIRGK   83 (128)
T ss_pred             HHHHHHHHhcccCcccccccceeecccEEEEEecccceEEecc
Confidence            33333333334 4556789999999999999998876666554


No 38 
>PF12218 End_N_terminal:  N terminal extension of bacteriophage endosialidase;  InterPro: IPR024429 This entry represents the N-terminal extension domain of endosialidases which is approximately 70 amino acids in length. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain [].; PDB: 3JU4_A 3GVL_A 3GVK_B 3GVJ_A 1V0E_B 1V0F_E.
Probab=31.55  E-value=34  Score=23.00  Aligned_cols=34  Identities=12%  Similarity=0.317  Sum_probs=21.4

Q ss_pred             CCCCeEEEcCeEEEEEEEEEEEEEecceEEecce
Q 034231           44 QCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEK   77 (100)
Q Consensus        44 qpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i   77 (100)
                      -+|.-|+-.|.+|.|+..--.=+++++||--.+|
T Consensus        21 ~~g~~IDg~GlTykVs~lPd~srf~N~rF~~eri   54 (67)
T PF12218_consen   21 PVGRKIDGAGLTYKVSSLPDISRFKNARFVYERI   54 (67)
T ss_dssp             -TTS-EE-TT-EEEESS---GGGEES-EEEE-SS
T ss_pred             CCCeEEecCCceEEEeeCccHHhhccceEEEeec
Confidence            4799999999999999998888888888865544


No 39 
>cd04466 S1_YloQ_GTPase S1_YloQ_GTPase: YloQ GTase family (also known as YjeQ and CpgA), S1-like RNA-binding domain. Proteins in the YloQ GTase family bind the ribosome and have GTPase activity. The precise role of this family is unknown. The protein structure is composed of three domains: an N-terminal S1 domain, a central GTPase domain, and a C-terminal zinc finger domain. This N-terminal S1 domain binds ssRNA. The central GTPase domain contains nucleotide-binding signature motifs: G1 (walker A), G3 (walker B) and G4 motifs. Experiments show that the bacterial YloQ and YjeQ proteins have low intrinsic GTPase activity. The C-terminal zinc-finger domain has structural similarity to a portion of the DNA-repair protein Rad51. This suggests a possible role for this GTPase as a regulator of translation, perhaps as a translation initiation factor. This family is classified based on the N-terminal S1 domain.
Probab=31.08  E-value=80  Score=18.79  Aligned_cols=12  Identities=25%  Similarity=0.354  Sum_probs=9.9

Q ss_pred             CCCCCCCeEEEc
Q 034231           41 PNLQCGESVTIE   52 (100)
Q Consensus        41 ~~pqpG~~le~e   52 (100)
                      ..|-.||||.++
T Consensus        36 ~~~~VGD~V~~~   47 (68)
T cd04466          36 NPPAVGDRVEFE   47 (68)
T ss_pred             CCCCCCcEEEEE
Confidence            458999999875


No 40 
>PF02911 Formyl_trans_C:  Formyl transferase, C-terminal domain;  InterPro: IPR005793 Methionyl-tRNA formyltransferase (2.1.2.9 from EC) transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and by impairing its binding to EFTU-GTP. This family also includes formyltetrahydrofolate dehydrogenases, which produce formate from formyl-tetrahydrofolate. These enzymes contain an N-terminal domain in common with other formyl transferase enzymes (IPR002376 from INTERPRO). The C-terminal domain has an open beta-barrel fold [].; GO: 0016742 hydroxymethyl-, formyl- and related transferase activity, 0009058 biosynthetic process; PDB: 3RFO_D 1Z7E_C 2BLN_A 1YRW_A 1FMT_A 2FMT_B 3Q0I_A 3R8X_A 3TQQ_A 2BW0_A ....
Probab=30.78  E-value=89  Score=19.83  Aligned_cols=45  Identities=16%  Similarity=-0.003  Sum_probs=29.0

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEEEe----cc-eEEecceeEEEeecchh
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQLR----KG-KYEPSEKRLDVLSSSRY   87 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYqLr----~G-rY~l~~i~L~Vq~~~Ry   87 (100)
                      |.||-|.+++|+...|.+.+--=.-.    -| -...++-.|.|+...-+
T Consensus        27 p~pga~~~~~~~~i~i~~~~~~~~~~~~~~pG~i~~~~~~~l~V~~~dg~   76 (100)
T PF02911_consen   27 PYPGAFTTFNGKRIKILKAEPLEDDSSSNPPGTIVYIDKNGLLVACGDGA   76 (100)
T ss_dssp             TTT-EEEEETTEEEEEEEEEEEETTSSSSSTTBEEEEETTEEEEETSBSE
T ss_pred             CCCCEEEeeCCeEEEEEeeeecccccccccCceEEEEcCCEEEEEECCcE
Confidence            88999999999999888876442222    34 23344446777665443


No 41 
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional
Probab=30.44  E-value=62  Score=25.63  Aligned_cols=26  Identities=23%  Similarity=0.464  Sum_probs=22.2

Q ss_pred             cCCCCCCCCeEEEcCeEEEEEEEEEE
Q 034231           39 FPPNLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        39 Lp~~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      |...|.+|+.|+++|-.|.|++..-+
T Consensus       247 l~~iP~~Gd~i~~~~~~f~V~~~~~~  272 (292)
T PRK15094        247 FGHLPARGETIDIDGYQFKVAMADSR  272 (292)
T ss_pred             hCcCCCCCCEEEECCEEEEEEEccCC
Confidence            44569999999999999999987655


No 42 
>cd03583 NTR_complement_C3 NTR/C345C domain, complement C3 subfamily; The NTR domain found in complement C3 is also known as the C345C domain because it occurs at the C-terminus of complement C3, C4 and C5. Complement C3 plays a pivotal role in the activation of the complement systems, as all pathways (classical, alternative, and lectin) result in the processing of C3 by C3 convertase. The larger fragment, activated C3b, contains the NTR/C345C domain and binds covalently, via a reactive thioester, to cell surface carbohydrates including components of bacterial cell walls and immune aggregates. The smaller cleavage product, C3a, acts independently as a diffusible signal to mediate local inflammatory processes. The structure of C3 shows that the NTR/C345C domain is located in an exposed position relative to the rest of the molecule. The function of the domain in complement C3 is poorly understood.
Probab=28.80  E-value=58  Score=23.87  Aligned_cols=27  Identities=30%  Similarity=0.660  Sum_probs=22.6

Q ss_pred             eEEcCCCCCCCCeEEE-cCeEEEEEEEE
Q 034231           36 IRCFPPNLQCGESVTI-EGQAYTISAVT   62 (100)
Q Consensus        36 ~~~Lp~~pqpG~~le~-eg~sY~Vl~rr   62 (100)
                      .+.|=.-++|-+.+.+ +|++|+|+...
T Consensus        69 ~r~F~~r~sCr~~l~l~~gk~YLIMG~~   96 (149)
T cd03583          69 TRTFISHPKCREALNLKEGKDYLIMGLS   96 (149)
T ss_pred             eEEEEecCCCcchhccCCCCEEEEEeCC
Confidence            4447777999888888 99999999887


No 43 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=27.09  E-value=1e+02  Score=23.01  Aligned_cols=24  Identities=17%  Similarity=0.378  Sum_probs=21.6

Q ss_pred             CCCCCCCeEEEcCeEEEEEEEEEE
Q 034231           41 PNLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        41 ~~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      ....+|.+|.++|.-|.|++..|.
T Consensus        24 ~~lKkG~~I~~~g~pc~V~e~~~~   47 (159)
T PLN03107         24 GTIRKGGYIVIKGRPCKVVEVSTS   47 (159)
T ss_pred             HhccCCCEEEECCEEEEEEEEEec
Confidence            457899999999999999999886


No 44 
>cd03581 NTR_Sfrp3_like NTR domain, Secreted frizzled-related protein (Sfrp) 3-like subfamily; composed of proteins similar to human Sfrp3 and Sfrp4. Sfrps are soluble proteins containing an NTR domain C-terminal to a cysteine-rich Frizzled domain. They show diverse functions and are thought to work in Wnt signaling indirectly, as modulators or antagonists by binding Wnt ligands, and directly, via the Wnt receptor, Frizzled. They participate in regulating the patterning along the anteroposterior axis in vertebrates. Human Sfrp3 may suppress the growth and invasiveness of androgen-independent prostate cancer cells.
Probab=26.74  E-value=96  Score=21.53  Aligned_cols=47  Identities=13%  Similarity=0.044  Sum_probs=34.5

Q ss_pred             eeeeEEcCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEEe
Q 034231           33 CLGIRCFPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVL   82 (100)
Q Consensus        33 ~LG~~~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~Vq   82 (100)
                      .=|.+.|=.+.+|-.-....|++|+||.....   ..++|-+++-++--+
T Consensus        44 ~~~~~~l~~~~~C~cp~l~~gk~YLImG~~~~---~~~~~~ld~~S~Ve~   90 (111)
T cd03581          44 PRDTVTLYTNSGCLCPPLTPNEEYIIMGYEDE---ERSRLLLVEGSLAEK   90 (111)
T ss_pred             CCceEEEEEcCCCCCccccCCCEEEEEecCCC---CcceEEeCCceEEEE
Confidence            34566666778898888889999999999744   247788877666543


No 45 
>PF00278 Orn_DAP_Arg_deC:  Pyridoxal-dependent decarboxylase, C-terminal sheet domain;  InterPro: IPR022643 These enzymes are collectively known as group IV decarboxylases []. Pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates can be classified into two different families on the basis of sequence similarities [, ]. Members of this family while most probably evolutionary related, do not share extensive regions of sequence similarities. The proteins contain a conserved lysine residue which is known, in mouse ODC [], to be the site of attachment of the pyridoxal-phosphate group. The proteins also contain a stretch of three consecutive glycine residues and has been proposed to be part of a substrate- binding region []. This entry represents the C-terminal region of the Orn/DAP/Arg decarboxylases.; GO: 0003824 catalytic activity; PDB: 1TWI_B 1TUF_A 3MT1_A 3N2B_C 2O0T_A 1HKW_A 1HKV_A 3VAB_A 3N2O_A 7ODC_A ....
Probab=26.42  E-value=57  Score=21.26  Aligned_cols=18  Identities=22%  Similarity=0.403  Sum_probs=15.0

Q ss_pred             eEEcCCCCCCCCeEEEcC
Q 034231           36 IRCFPPNLQCGESVTIEG   53 (100)
Q Consensus        36 ~~~Lp~~pqpG~~le~eg   53 (100)
                      ...||..+++|+||.+++
T Consensus        76 ~~~lP~~l~~GD~l~f~~   93 (116)
T PF00278_consen   76 DVMLPKELEVGDWLVFEN   93 (116)
T ss_dssp             EEEEESTTTTT-EEEESS
T ss_pred             eccCCCCCCCCCEEEEec
Confidence            678888999999999986


No 46 
>PRK09993 C-lysozyme inhibitor; Provisional
Probab=26.36  E-value=57  Score=24.87  Aligned_cols=21  Identities=14%  Similarity=0.347  Sum_probs=17.4

Q ss_pred             CCCCCCeEEEcCeEEEEEEEE
Q 034231           42 NLQCGESVTIEGQAYTISAVT   62 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rr   62 (100)
                      +.-|.+.|+++|++|.|....
T Consensus        61 tssP~~~V~~~G~~YlVg~~C   81 (153)
T PRK09993         61 TYSPAQTVTLGDETYQVMSAC   81 (153)
T ss_pred             CCCchhheeeCCceEEEeccc
Confidence            456799999999999998643


No 47 
>PRK13767 ATP-dependent helicase; Provisional
Probab=25.63  E-value=1.7e+02  Score=26.79  Aligned_cols=48  Identities=19%  Similarity=0.236  Sum_probs=35.6

Q ss_pred             eEEEEeCCCCceeeeEE--cCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEEeec
Q 034231           22 YKVVEITPPPKCLGIRC--FPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVLSS   84 (100)
Q Consensus        22 ~EV~~~t~p~r~LG~~~--Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~Vq~~   84 (100)
                      +.|+.  ...+-+|.+.  +-....||+.|.++|+.|.|...             ++-.++|.++
T Consensus       521 ~~V~~--~~g~~iG~lde~f~~~l~~g~~f~l~g~~w~~~~~-------------~~~~v~V~~a  570 (876)
T PRK13767        521 CDVYT--EDGKYVGNLEEEFLERLEPGDVFVLGGRTYEFLYS-------------RGSKVYVDPA  570 (876)
T ss_pred             EEEEe--cCCCEEEEechHHHccCCCCCEEEECCCEEEEEEE-------------eCCEEEEEEC
Confidence            44443  5778899998  44669999999999999987542             3356677666


No 48 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=25.59  E-value=21  Score=25.34  Aligned_cols=32  Identities=28%  Similarity=0.441  Sum_probs=18.2

Q ss_pred             eeeeeccccccCCCCccceEEEEeCCCCceeeeEEcCC
Q 034231            4 VVCRKKERDRDHKNNIHPYKVVEITPPPKCLGIRCFPP   41 (100)
Q Consensus         4 ~~~~~~~~~~~~~~~slp~EV~~~t~p~r~LG~~~Lp~   41 (100)
                      |-|+||+|+|.-  --=|+  +.  -.|+.+|+|.++-
T Consensus        53 vCC~kRkrsRrP--IYrPv--I~--~~P~~~~~~~~~G   84 (94)
T PF05393_consen   53 VCCKKRKRSRRP--IYRPV--IG--LEPQNLQIHRDDG   84 (94)
T ss_pred             HHHHHhhhccCC--ccccc--cc--cCCCcccccccCC
Confidence            347889988843  22222  11  2467777776654


No 49 
>TIGR01999 iscU FeS cluster assembly scaffold IscU. This model represents IscU, a homolog of the N-terminal region of NifU, an Fe-S cluster assembly protein found mostly in nitrogen-fixing bacteria. IscU is considered part of the IscSUA-hscAB-fdx system of Fe-S assembly, whereas NifU is found in nitrogenase-containing (nitrogen-fixing) species. A NifU-type protein is also found in Helicobacter and Campylobacter. IscU and NifU are considered scaffold proteins on which Fe-S clusters are assembled before transfer to apoproteins. This model excludes true NifU proteins as in Klebsiella pneumoniae and Anabaena sp. as well as archaeal homologs. It includes largely proteobacterial and eukaryotic forms.
Probab=25.48  E-value=49  Score=23.05  Aligned_cols=11  Identities=18%  Similarity=0.604  Sum_probs=9.0

Q ss_pred             CCCCCCCeEEE
Q 034231           41 PNLQCGESVTI   51 (100)
Q Consensus        41 ~~pqpG~~le~   51 (100)
                      -||.||+.|++
T Consensus        31 ~np~CGD~i~l   41 (124)
T TIGR01999        31 GAPACGDVMKL   41 (124)
T ss_pred             CCCCCccEEEE
Confidence            48899999875


No 50 
>PTZ00414 10 kDa heat shock protein; Provisional
Probab=25.33  E-value=86  Score=22.01  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=13.8

Q ss_pred             CCCCeEEEcCeEEEEEEE
Q 034231           44 QCGESVTIEGQAYTISAV   61 (100)
Q Consensus        44 qpG~~le~eg~sY~Vl~r   61 (100)
                      .-|..|+++|+.|+|++-
T Consensus        74 y~Gtevk~dg~ey~i~~e   91 (100)
T PTZ00414         74 FGGSSVKVEGEEFFLYNE   91 (100)
T ss_pred             CCCcEEEECCEEEEEEEh
Confidence            446778889999998763


No 51 
>cd06664 IscU_like Iron-sulfur cluster scaffold-like proteins. IscU_like and NifU_like proteins. IscU and NifU function as a scaffold for the assembly of [2Fe-2S] clusters before they are transferred to apo target proteins. They are highly conserved and play vital roles in the ISC and NIF systems of Fe-S protein maturation. NIF genes participate in nitrogen fixation in several isolated bacterial species. The NifU domain, however, is also found in bacteria that do not fix nitrogen, so it may have wider significance in the cell. Human IscU interacts with frataxin, the Friedreich ataxia gene product, and incorrectly spliced IscU has been shown to disrupt iron homeostasis in skeletal muscle and cause myopathy.
Probab=25.27  E-value=52  Score=22.29  Aligned_cols=12  Identities=33%  Similarity=0.695  Sum_probs=9.6

Q ss_pred             CCCCCCCeEEEc
Q 034231           41 PNLQCGESVTIE   52 (100)
Q Consensus        41 ~~pqpG~~le~e   52 (100)
                      .||.||+.|++.
T Consensus        29 ~n~~CGD~v~l~   40 (123)
T cd06664          29 GNPLCGDEITLY   40 (123)
T ss_pred             CCCCCCceEEEE
Confidence            478899998874


No 52 
>PF14427 Pput2613-deam:  Pput_2613-like deaminase
Probab=25.02  E-value=47  Score=24.46  Aligned_cols=33  Identities=24%  Similarity=0.264  Sum_probs=24.2

Q ss_pred             ceEEEEeCCCCceeeeE-------EcCCCCCCCCeEEEcCe
Q 034231           21 PYKVVEITPPPKCLGIR-------CFPPNLQCGESVTIEGQ   54 (100)
Q Consensus        21 p~EV~~~t~p~r~LG~~-------~Lp~~pqpG~~le~eg~   54 (100)
                      +-|=.+ +=|+++|..|       +|+++-+||+.+.|+|+
T Consensus        35 ~~e~~L-gFP~~slaTHTE~ri~~~l~~~~~~Gd~m~I~G~   74 (118)
T PF14427_consen   35 EAERKL-GFPESSLATHTEARITRDLPLNQVPGDRMLIDGQ   74 (118)
T ss_pred             CCcccc-CCchhhhhhhhHhHHHhhcCccccCCceEEEeee
Confidence            334444 5566666554       68999999999999996


No 53 
>TIGR01646 vgr_GE Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
Probab=24.83  E-value=1e+02  Score=25.57  Aligned_cols=30  Identities=23%  Similarity=0.346  Sum_probs=23.0

Q ss_pred             eeEEcCCCCCCCCeEEEcCe-------EEEEEEEEEEE
Q 034231           35 GIRCFPPNLQCGESVTIEGQ-------AYTISAVTHRY   65 (100)
Q Consensus        35 G~~~Lp~~pqpG~~le~eg~-------sY~Vl~rrHrY   65 (100)
                      |.-..+. ..||.+|++.|.       .|+|.+++|+.
T Consensus       274 G~~~~~~-L~~G~~~~l~~~~~~~~~~~~~v~~v~h~~  310 (483)
T TIGR01646       274 GEGNAAG-LAPGQLFVLSGHPRNDQNNGYLIVSAIHSI  310 (483)
T ss_pred             EEeCCCe-ecCCCEEEecCCCCcccCCCEEEEEEEEEE
Confidence            4444333 889999999764       59999999994


No 54 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=24.75  E-value=44  Score=24.40  Aligned_cols=24  Identities=33%  Similarity=0.581  Sum_probs=18.1

Q ss_pred             EecceEEe--------cceeEEEeecchhhHH
Q 034231           67 LRKGKYEP--------SEKRLDVLSSSRYILN   90 (100)
Q Consensus        67 Lr~GrY~l--------~~i~L~Vq~~~Ry~~n   90 (100)
                      ++-|.|++        ++|.+-+|+.+||++-
T Consensus        67 ~~pG~YeiNl~~Lld~~~iVval~EeG~Y~I~   98 (112)
T COG3364          67 LRPGVYEINLESLLDRDEIVVALQEEGRYFIH   98 (112)
T ss_pred             ecCceEEEehhhhccCCceEEEEccCCeEEEE
Confidence            45677764        5778889999999974


No 55 
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]
Probab=23.82  E-value=90  Score=26.98  Aligned_cols=30  Identities=40%  Similarity=0.539  Sum_probs=23.2

Q ss_pred             ceEEEEeCCCCceeeeEEcC--------CCCCCCCeEEEcC
Q 034231           21 PYKVVEITPPPKCLGIRCFP--------PNLQCGESVTIEG   53 (100)
Q Consensus        21 p~EV~~~t~p~r~LG~~~Lp--------~~pqpG~~le~eg   53 (100)
                      -+.||.+|||++.=   ..|        |+..||+-|++-|
T Consensus       227 ~~NvRIAtPPp~~~---~~PpG~mSSyi~sLKpGDKvtisG  264 (410)
T COG2871         227 KLNVRIATPPPRNP---DAPPGQMSSYIWSLKPGDKVTISG  264 (410)
T ss_pred             EEEEEeccCCCCCC---CCCccceeeeEEeecCCCeEEEec
Confidence            37899999999874   344        4578999998876


No 56 
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily. This subgroup contains class IV ACs and similar proteins. AC catalyzes the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. cAMP is a key signaling molecule which conveys a variety of signals in different cell types. In prokaryotes, cAMP is a catabolite derepression signal which triggers the expression of metabolic pathways including the lactose operon. Six non-homologous classes of ACs have been identified (I-VI). Class IV ACs are found in this group. In bacteria, the gene encoding Class IV AC has been designated cyaB and the protein as AC2. AC-IV occurs in addition to AC-I in bacterial pathogens such as Yersinia pestis (plague disease). The role of AC-IV is unknown but it has been speculated that it may be a factor in pathogenesis, perhaps providing cAMP for a secondary internal signaling function, or for secretion and uptake into host cells, where it may disrupt normal cel
Probab=23.14  E-value=67  Score=22.83  Aligned_cols=20  Identities=20%  Similarity=-0.019  Sum_probs=17.7

Q ss_pred             eeEEcCCCCCCCCeEEEcCe
Q 034231           35 GIRCFPPNLQCGESVTIEGQ   54 (100)
Q Consensus        35 G~~~Lp~~pqpG~~le~eg~   54 (100)
                      +.++||+.+-.|.++|+|..
T Consensus       117 ~~v~lD~~~~lG~f~EiE~~  136 (169)
T cd07890         117 TRVHLDRVEGLGDFVEIEVV  136 (169)
T ss_pred             EEEEEEccCCCCceEEEEEE
Confidence            58899999999999999864


No 57 
>smart00675 DM11 Domains in hypothetical proteins in Drosophila including 2 in CG15241 and CG9329.
Probab=23.10  E-value=1.2e+02  Score=22.82  Aligned_cols=42  Identities=10%  Similarity=0.161  Sum_probs=33.2

Q ss_pred             ceeeeEEcCCCCCCCCeEEEcCeEEEEEEEEEEEEEecceEEecceeEEEe
Q 034231           32 KCLGIRCFPPNLQCGESVTIEGQAYTISAVTHRYQLRKGKYEPSEKRLDVL   82 (100)
Q Consensus        32 r~LG~~~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY~l~~i~L~Vq   82 (100)
                      ..=|.+..-|..|||+-|++..+.         |++.+|..++--.++.++
T Consensus        45 ~vsGn~t~~wdi~P~DrI~~~~~~---------~~~eRG~W~PTv~s~~~~   86 (164)
T smart00675       45 HISGNITVIWDVQPTDRISARVSV---------MHFERGTWQPTVFNMATP   86 (164)
T ss_pred             EEeeeEEEEEecCCCCeEEEEEEE---------EEecCCeeeeeEEeeecc
Confidence            345888889999999999987765         467889999877776654


No 58 
>PRK11573 hypothetical protein; Provisional
Probab=22.64  E-value=92  Score=25.98  Aligned_cols=26  Identities=19%  Similarity=0.128  Sum_probs=22.2

Q ss_pred             cCCCCCCCCeEEEcCeEEEEEEEEEE
Q 034231           39 FPPNLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        39 Lp~~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      |..-|.+|+.++++|-.|.|.+...|
T Consensus       369 lg~iP~~Ge~~~~~~~~f~V~~~~~~  394 (413)
T PRK11573        369 LEEIPVAGTRVRIGEYDIDILDVQDN  394 (413)
T ss_pred             hCcCCCCCCEEEECCEEEEEEEecCC
Confidence            44568999999999999999988755


No 59 
>PRK14533 groES co-chaperonin GroES; Provisional
Probab=21.69  E-value=1.3e+02  Score=20.54  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=12.4

Q ss_pred             CCCCeEEEcCeEEEEEEE
Q 034231           44 QCGESVTIEGQAYTISAV   61 (100)
Q Consensus        44 qpG~~le~eg~sY~Vl~r   61 (100)
                      .-|..|+++|+.|+|+.-
T Consensus        65 y~g~ev~~~~~~y~iv~e   82 (91)
T PRK14533         65 YAGTEIKIDDEDYIIIDV   82 (91)
T ss_pred             CCCeEEEECCEEEEEEEh
Confidence            345567778888888753


No 60 
>PRK10334 mechanosensitive channel MscS; Provisional
Probab=21.60  E-value=1.9e+02  Score=22.98  Aligned_cols=30  Identities=23%  Similarity=0.186  Sum_probs=25.7

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAVTHRYQL   67 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~rrHrYqL   67 (100)
                      .++.+-+.||||+++|..=.|.+..-|+.-
T Consensus       125 ~~~rpf~vGD~I~i~~~~G~V~~I~~r~T~  154 (286)
T PRK10334        125 VMFRPFRAGEYVDLGGVAGTVLSVQIFSTT  154 (286)
T ss_pred             HhcCCCCCCCEEEECCEEEEEEEEEeEEEE
Confidence            467788999999999999999988888754


No 61 
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis]
Probab=21.57  E-value=1.3e+02  Score=24.94  Aligned_cols=22  Identities=18%  Similarity=0.099  Sum_probs=19.5

Q ss_pred             CCCCCCeEEEcCeEEEEEEEEE
Q 034231           42 NLQCGESVTIEGQAYTISAVTH   63 (100)
Q Consensus        42 ~pqpG~~le~eg~sY~Vl~rrH   63 (100)
                      +|.||-|.+++|+.+.|.+.+.
T Consensus       229 ~P~Pga~~~~~~~~iki~~a~~  250 (307)
T COG0223         229 NPWPGAWTELGGKRIKIWEARV  250 (307)
T ss_pred             CCCCceEEEECCeEEEEEEEEE
Confidence            4999999999999999988764


No 62 
>TIGR03419 NifU_clost FeS cluster assembly scaffold protein NifU, Clostridium type. NifU and NifS form a pair of iron-sulfur (FeS) cluster biosynthesis proteins much simpler than the ISC and SUF systems. Members of this protein family are a distinct group of NifU-like proteins, found always to a NifS-like protein and restricted to species that lack a SUF system. Typically, NIF systems service a smaller number of FeS-containing proteins than do ISC or SUF. Members of this particular branch typically are found, almost half the time, near the mnmA gene, involved in the carboxymethylaminomethyl modification of U34 in some tRNAs (see GenProp0704). While other NifU proteins are associated with nitrogen fixation, this family is not.
Probab=20.68  E-value=71  Score=22.21  Aligned_cols=12  Identities=33%  Similarity=0.617  Sum_probs=9.8

Q ss_pred             CCCCCCCeEEEc
Q 034231           41 PNLQCGESVTIE   52 (100)
Q Consensus        41 ~~pqpG~~le~e   52 (100)
                      .||.||+.|++.
T Consensus        28 ~np~CGD~i~l~   39 (121)
T TIGR03419        28 GNPKCGDIMKIF   39 (121)
T ss_pred             CCCCCccEEEEE
Confidence            489999998874


No 63 
>TIGR03520 GldE gliding motility-associated protein GldE. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype.
Probab=20.52  E-value=1e+02  Score=25.53  Aligned_cols=27  Identities=26%  Similarity=0.293  Sum_probs=22.3

Q ss_pred             EcCCCCCCCCeEEEcCeEEEEEEEEEE
Q 034231           38 CFPPNLQCGESVTIEGQAYTISAVTHR   64 (100)
Q Consensus        38 ~Lp~~pqpG~~le~eg~sY~Vl~rrHr   64 (100)
                      +|..-|++|+.++++|-.|.|.+...+
T Consensus       372 ~l~~iP~~G~~~~~~~~~f~V~~~~~~  398 (408)
T TIGR03520       372 ISGGFPKKGEKITFENFEFTIEAMDKK  398 (408)
T ss_pred             HhCcCCCCCCEEEECCEEEEEEEccCC
Confidence            345569999999999999999987654


No 64 
>PRK12426 elongation factor P; Provisional
Probab=20.19  E-value=2.4e+02  Score=21.71  Aligned_cols=30  Identities=13%  Similarity=0.274  Sum_probs=23.7

Q ss_pred             CCCCCeEEEcCeEEEEEEEEEEEEEecceE
Q 034231           43 LQCGESVTIEGQAYTISAVTHRYQLRKGKY   72 (100)
Q Consensus        43 pqpG~~le~eg~sY~Vl~rrHrYqLr~GrY   72 (100)
                      ..+|..|+++|+-|.|++..|.=.=++|.+
T Consensus         7 ik~G~~i~~~g~~~~V~~~~h~kPGkg~A~   36 (185)
T PRK12426          7 LSVGMFISTKDGLYKVVSVSKVTGPKGETF   36 (185)
T ss_pred             cCCCCEEEECCEEEEEEEEEEecCCCCceE
Confidence            468999999999999999999654444433


No 65 
>smart00676 DM10 Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases.
Probab=20.19  E-value=3e+02  Score=18.86  Aligned_cols=30  Identities=20%  Similarity=0.412  Sum_probs=23.6

Q ss_pred             CceeeeEEcCC------------CCCCCCeEEEcCeEEEEEE
Q 034231           31 PKCLGIRCFPP------------NLQCGESVTIEGQAYTISA   60 (100)
Q Consensus        31 ~r~LG~~~Lp~------------~pqpG~~le~eg~sY~Vl~   60 (100)
                      +.-|-+..+|.            ....|.+|.+-|..|.|..
T Consensus        50 g~fLkR~rvp~~~~~~~~~y~~~Dl~vG~~v~i~gr~f~I~d   91 (104)
T smart00676       50 GTFLRRQRVPKPPPDDPEYYHASDLNVGTTINVFGRQFRIYD   91 (104)
T ss_pred             ccEeeeeEcCCCCccccCccCHHHcCCCCEEEEeCEEEEEEE
Confidence            55688888877            3567999999999988753


Done!