Query 034260 Match_columns 100 No_of_seqs 155 out of 1081 Neff 8.1 Searched_HMMs 46136 Date Fri Mar 29 11:32:01 2013 Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034260.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034260hhsearch_cdd -cpu 12 -v 0 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF00107 ADH_zinc_N: Zinc-bind 99.4 3.2E-13 6.9E-18 85.3 6.8 71 3-79 57-129 (130) 2 COG1063 Tdh Threonine dehydrog 99.4 3.4E-12 7.4E-17 93.5 8.6 85 2-93 236-326 (350) 3 KOG0024 Sorbitol dehydrogenase 99.3 5.2E-12 1.1E-16 91.6 8.3 85 4-94 242-329 (354) 4 TIGR01202 bchC 2-desacetyl-2-h 99.3 1.1E-11 2.5E-16 88.8 8.1 87 2-94 198-287 (308) 5 TIGR03366 HpnZ_proposed putati 99.3 3.4E-11 7.3E-16 85.2 8.1 88 2-95 185-279 (280) 6 cd08237 ribitol-5-phosphate_DH 99.2 9E-11 2E-15 85.2 8.0 85 4-94 222-315 (341) 7 PRK09880 L-idonate 5-dehydroge 99.2 2.3E-10 5E-15 82.9 9.2 85 4-94 235-321 (343) 8 PLN02827 Alcohol dehydrogenase 99.1 3.2E-10 7E-15 83.5 8.7 90 3-95 262-356 (378) 9 TIGR03451 mycoS_dep_FDH mycoth 99.1 5.5E-10 1.2E-14 81.3 9.3 89 3-94 244-337 (358) 10 PLN02178 cinnamyl-alcohol dehy 99.1 6.2E-10 1.3E-14 82.1 9.1 84 4-94 242-326 (375) 11 cd08281 liver_ADH_like1 Zinc-d 99.1 7.1E-10 1.5E-14 81.2 8.9 90 3-94 258-351 (371) 12 COG1062 AdhC Zn-dependent alco 99.1 3.4E-10 7.4E-15 82.7 6.9 88 3-94 253-345 (366) 13 cd08230 glucose_DH Glucose deh 99.1 7.9E-10 1.7E-14 80.4 8.1 86 3-94 237-335 (355) 14 PLN02514 cinnamyl-alcohol dehy 99.1 1.4E-09 2.9E-14 79.5 9.2 85 4-95 244-329 (357) 15 TIGR03201 dearomat_had 6-hydro 99.0 1.9E-09 4.1E-14 78.3 9.3 85 3-94 236-327 (349) 16 COG1064 AdhP Zn-dependent alco 99.0 1.5E-09 3.3E-14 79.5 8.7 82 5-93 230-314 (339) 17 PLN02586 probable cinnamyl alc 99.0 2E-09 4.3E-14 78.8 9.0 84 4-94 247-331 (360) 18 PRK10309 galactitol-1-phosphat 99.0 3.8E-09 8.2E-14 76.4 9.1 89 3-94 227-324 (347) 19 TIGR02819 fdhA_non_GSH formald 99.0 2.1E-09 4.6E-14 79.8 7.5 87 3-95 253-370 (393) 20 PLN02740 Alcohol dehydrogenase 99.0 4.1E-09 8.9E-14 77.5 8.4 89 4-95 268-361 (381) 21 cd08238 sorbose_phosphate_red 98.9 5.6E-09 1.2E-13 77.6 8.9 87 2-94 255-347 (410) 22 cd08239 THR_DH_like L-threonin 98.9 1.6E-08 3.4E-13 72.8 9.6 85 3-94 230-318 (339) 23 cd08233 butanediol_DH_like (2R 98.9 1.4E-08 3E-13 73.5 9.1 86 3-94 240-328 (351) 24 TIGR02822 adh_fam_2 zinc-bindi 98.9 1.9E-08 4.1E-13 72.8 9.0 85 4-95 223-309 (329) 25 KOG0022 Alcohol dehydrogenase, 98.8 3.2E-08 6.9E-13 72.0 7.3 88 2-94 260-354 (375) 26 cd08301 alcohol_DH_plants Plan 98.8 5E-08 1.1E-12 71.3 8.4 88 3-94 256-349 (369) 27 cd08277 liver_alcohol_DH_like 98.7 1E-07 2.3E-12 69.6 8.9 88 3-94 253-345 (365) 28 TIGR02818 adh_III_F_hyde S-(hy 98.7 1.2E-07 2.6E-12 69.5 8.6 89 4-95 255-348 (368) 29 cd08300 alcohol_DH_class_III c 98.7 1.6E-07 3.4E-12 68.8 9.2 88 3-94 255-348 (368) 30 PLN03154 putative allyl alcoho 98.7 1.1E-07 2.3E-12 69.4 8.2 90 2-94 226-323 (348) 31 cd08258 Zn_ADH4 Alcohol dehydr 98.6 3.1E-07 6.7E-12 65.6 9.1 72 3-80 232-305 (306) 32 PRK10083 putative oxidoreducta 98.5 8.1E-07 1.8E-11 63.8 8.9 84 4-93 228-313 (339) 33 cd00401 AdoHcyase S-adenosyl-L 98.5 3.3E-07 7.1E-12 69.0 6.5 71 4-82 257-332 (413) 34 COG0604 Qor NADPH:quinone redu 98.5 1.4E-06 3.1E-11 63.5 9.4 90 2-94 209-303 (326) 35 cd08291 ETR_like_1 2-enoyl thi 98.5 9.6E-07 2.1E-11 63.3 8.3 89 2-94 210-303 (324) 36 cd08296 CAD_like Cinnamyl alco 98.5 1.9E-06 4.1E-11 62.0 9.4 84 4-94 228-312 (333) 37 cd08231 MDR_TM0436_like Hypoth 98.5 1.3E-06 2.8E-11 63.4 8.5 74 2-81 247-323 (361) 38 PLN02702 L-idonate 5-dehydroge 98.4 2.8E-06 6.1E-11 61.9 9.6 75 2-82 252-326 (364) 39 cd05279 Zn_ADH1 Liver alcohol 98.4 2.2E-06 4.7E-11 62.7 8.5 77 2-82 251-331 (365) 40 cd08285 NADP_ADH NADP(H)-depen 98.4 2E-06 4.3E-11 62.3 7.9 87 2-94 233-328 (351) 41 cd08240 6_hydroxyhexanoate_dh_ 98.4 3.4E-06 7.5E-11 60.9 9.1 84 4-93 243-327 (350) 42 cd08246 crotonyl_coA_red croto 98.4 3E-06 6.5E-11 62.4 8.6 84 4-94 285-370 (393) 43 cd08286 FDH_like_ADH2 formalde 98.3 7.1E-06 1.5E-10 59.1 9.7 73 3-82 234-307 (345) 44 cd08256 Zn_ADH2 Alcohol dehydr 98.3 4.8E-06 1E-10 60.2 8.7 85 3-93 242-329 (350) 45 PRK09424 pntA NAD(P) transhydr 98.3 1.6E-06 3.4E-11 66.9 6.3 74 3-82 247-331 (509) 46 cd08254 hydroxyacyl_CoA_DH 6-h 98.3 6.9E-06 1.5E-10 58.5 9.3 77 2-84 230-307 (338) 47 cd08242 MDR_like Medium chain 98.3 5.3E-06 1.2E-10 59.1 8.6 85 2-94 212-298 (319) 48 cd05283 CAD1 Cinnamyl alcohol 98.3 5.6E-06 1.2E-10 59.7 8.7 85 2-93 230-315 (337) 49 cd08287 FDH_like_ADH3 formalde 98.3 8.4E-06 1.8E-10 58.6 9.1 76 3-84 236-312 (345) 50 cd08274 MDR9 Medium chain dehy 98.3 8.7E-06 1.9E-10 58.5 8.8 84 2-92 241-326 (350) 51 PRK05396 tdh L-threonine 3-deh 98.2 9.2E-06 2E-10 58.5 8.7 56 2-57 230-285 (341) 52 KOG0023 Alcohol dehydrogenase, 98.2 4.1E-06 8.9E-11 61.3 6.2 73 6-84 248-323 (360) 53 cd05285 sorbitol_DH Sorbitol d 98.2 1.9E-05 4.2E-10 56.9 9.6 75 2-82 232-306 (343) 54 cd08278 benzyl_alcohol_DH Benz 98.2 1.1E-05 2.3E-10 59.1 8.2 79 2-83 252-333 (365) 55 TIGR02825 B4_12hDH leukotriene 98.2 1.3E-05 2.8E-10 57.4 8.5 89 2-93 205-303 (325) 56 cd08265 Zn_ADH3 Alcohol dehydr 98.2 1.8E-05 4E-10 58.3 8.9 79 2-84 273-352 (384) 57 TIGR01751 crot-CoA-red crotony 98.2 1.9E-05 4.1E-10 58.4 8.8 84 3-93 279-364 (398) 58 cd08295 double_bond_reductase_ 98.1 1.8E-05 3.8E-10 57.1 8.4 56 2-58 219-280 (338) 59 cd08284 FDH_like_2 Glutathione 98.1 2.9E-05 6.2E-10 55.8 9.4 77 2-84 233-311 (344) 60 cd05284 arabinose_DH_like D-ar 98.1 3.5E-05 7.7E-10 55.2 9.7 77 3-86 234-311 (340) 61 cd08262 Zn_ADH8 Alcohol dehydr 98.1 3.1E-05 6.7E-10 55.6 9.0 74 3-82 232-306 (341) 62 TIGR00692 tdh L-threonine 3-de 98.1 3.2E-05 7E-10 55.7 8.9 87 3-93 229-318 (340) 63 PRK13771 putative alcohol dehy 98.1 3.9E-05 8.6E-10 54.8 8.9 83 4-93 225-310 (334) 64 cd08283 FDH_like_1 Glutathione 98.0 5E-05 1.1E-09 56.0 9.1 74 3-82 253-349 (386) 65 cd08279 Zn_ADH_class_III Class 98.0 5.6E-05 1.2E-09 55.1 9.2 89 2-93 249-342 (363) 66 cd08264 Zn_ADH_like2 Alcohol d 98.0 6E-05 1.3E-09 53.7 9.1 70 3-79 222-293 (325) 67 cd08260 Zn_ADH6 Alcohol dehydr 98.0 5.7E-05 1.2E-09 54.4 8.7 74 4-83 233-310 (345) 68 cd08297 CAD3 Cinnamyl alcohol 98.0 9.7E-05 2.1E-09 53.1 9.9 77 2-84 232-310 (341) 69 cd05188 MDR Medium chain reduc 98.0 8.4E-05 1.8E-09 50.9 8.8 56 2-57 199-255 (271) 70 cd08232 idonate-5-DH L-idonate 98.0 7.4E-05 1.6E-09 53.6 8.8 72 4-82 231-303 (339) 71 cd08292 ETR_like_2 2-enoyl thi 98.0 8.9E-05 1.9E-09 52.6 8.8 57 2-59 206-263 (324) 72 PF13602 ADH_zinc_N_2: Zinc-bi 97.9 2.8E-06 6.1E-11 53.2 0.8 86 2-95 17-108 (127) 73 cd08261 Zn_ADH7 Alcohol dehydr 97.9 0.00016 3.5E-09 51.9 9.7 76 3-84 226-302 (337) 74 cd08276 MDR7 Medium chain dehy 97.9 0.00014 3E-09 51.6 9.3 83 3-92 228-312 (336) 75 cd08269 Zn_ADH9 Alcohol dehydr 97.9 0.00017 3.6E-09 50.8 9.4 81 2-84 196-278 (312) 76 cd05281 TDH Threonine dehydrog 97.9 0.00011 2.4E-09 52.9 8.6 75 3-82 230-306 (341) 77 cd08235 iditol_2_DH_like L-idi 97.9 0.00017 3.6E-09 51.8 9.4 74 3-82 233-309 (343) 78 cd08294 leukotriene_B4_DH_like 97.9 8.4E-05 1.8E-09 52.9 7.8 56 2-58 209-271 (329) 79 cd08299 alcohol_DH_class_I_II_ 97.9 8.7E-05 1.9E-09 54.6 8.0 87 3-93 259-351 (373) 80 cd08282 PFDH_like Pseudomonas 97.9 0.0001 2.2E-09 54.1 8.3 85 3-93 242-353 (375) 81 PRK09422 ethanol-active dehydr 97.8 0.00019 4.1E-09 51.4 9.0 75 4-84 230-305 (338) 82 cd08244 MDR_enoyl_red Possible 97.8 0.00025 5.5E-09 50.2 9.2 56 3-59 210-266 (324) 83 cd08263 Zn_ADH10 Alcohol dehyd 97.8 0.0002 4.3E-09 52.2 8.8 77 2-84 254-334 (367) 84 cd08236 sugar_DH NAD(P)-depend 97.8 0.00032 7E-09 50.4 9.4 57 3-59 226-285 (343) 85 cd08234 threonine_DH_like L-th 97.8 0.00034 7.3E-09 49.9 9.3 74 3-83 225-301 (334) 86 cd08255 2-desacetyl-2-hydroxye 97.7 0.00031 6.8E-09 48.9 8.7 57 3-59 158-214 (277) 87 cd05282 ETR_like 2-enoyl thioe 97.7 0.00031 6.6E-09 49.7 8.5 57 2-59 205-262 (323) 88 cd08266 Zn_ADH_like1 Alcohol d 97.7 0.00047 1E-08 48.8 9.3 84 3-93 234-319 (342) 89 KOG1197 Predicted quinone oxid 97.7 7.6E-05 1.6E-09 53.5 5.1 88 2-94 213-308 (336) 90 TIGR02823 oxido_YhdH putative 97.7 0.00039 8.5E-09 49.4 8.6 55 4-59 211-266 (323) 91 cd08298 CAD2 Cinnamyl alcohol 97.7 0.00047 1E-08 49.2 8.9 83 3-93 224-308 (329) 92 cd08289 MDR_yhfp_like Yhfp put 97.7 0.00017 3.7E-09 51.2 6.6 55 3-58 212-267 (326) 93 cd08270 MDR4 Medium chain dehy 97.7 0.00047 1E-08 48.5 8.7 87 3-92 191-281 (305) 94 PTZ00354 alcohol dehydrogenase 97.7 0.00048 1E-08 48.8 8.6 57 2-59 208-266 (334) 95 cd05278 FDH_like Formaldehyde 97.7 0.00036 7.8E-09 50.1 8.0 76 3-84 235-312 (347) 96 cd05288 PGDH Prostaglandin deh 97.6 0.00051 1.1E-08 48.9 8.0 55 3-58 213-273 (329) 97 cd08245 CAD Cinnamyl alcohol d 97.6 0.001 2.2E-08 47.5 9.6 76 3-84 224-301 (330) 98 cd05280 MDR_yhdh_yhfp Yhdh and 97.6 0.00045 9.7E-09 48.9 7.6 56 3-59 212-268 (325) 99 cd08241 QOR1 Quinone oxidoredu 97.5 0.0014 3E-08 45.8 9.0 56 3-59 207-263 (323) 100 cd08293 PTGR2 Prostaglandin re 97.5 0.0012 2.6E-08 47.4 8.7 35 2-37 222-256 (345) 101 cd08259 Zn_ADH5 Alcohol dehydr 97.4 0.0021 4.5E-08 45.6 9.3 83 4-93 226-310 (332) 102 cd08243 quinone_oxidoreductase 97.4 0.0011 2.4E-08 46.5 7.7 55 2-57 206-265 (320) 103 cd05276 p53_inducible_oxidored 97.4 0.0023 5E-08 44.6 8.9 56 3-59 207-263 (323) 104 cd05286 QOR2 Quinone oxidoredu 97.3 0.0024 5.3E-08 44.4 8.7 55 2-57 203-258 (320) 105 cd08290 ETR 2-enoyl thioester 97.3 0.0018 3.9E-08 46.4 8.0 55 4-59 221-276 (341) 106 cd08252 AL_MDR Arginate lyase 97.3 0.0012 2.5E-08 47.1 6.7 55 3-59 216-270 (336) 107 KOG0025 Zn2+-binding dehydroge 97.3 0.0016 3.5E-08 47.5 7.0 88 4-94 233-329 (354) 108 TIGR02824 quinone_pig3 putativ 97.2 0.004 8.7E-08 43.6 8.6 56 3-59 207-263 (325) 109 cd08272 MDR6 Medium chain dehy 97.2 0.0045 9.7E-08 43.4 8.7 53 3-59 210-262 (326) 110 cd05289 MDR_like_2 alcohol deh 97.0 0.0062 1.3E-07 42.3 8.2 80 3-92 207-287 (309) 111 COG2130 Putative NADP-dependen 97.0 0.003 6.5E-08 46.3 6.6 57 2-59 217-280 (340) 112 cd08253 zeta_crystallin Zeta-c 97.0 0.0063 1.4E-07 42.5 7.7 54 3-57 212-265 (325) 113 cd08275 MDR3 Medium chain dehy 96.9 0.01 2.2E-07 42.0 8.8 56 3-59 205-277 (337) 114 TIGR02817 adh_fam_1 zinc-bindi 96.9 0.0087 1.9E-07 42.7 8.4 52 3-57 215-266 (336) 115 cd08267 MDR1 Medium chain dehy 96.7 0.02 4.3E-07 40.2 8.5 38 2-39 206-244 (319) 116 KOG1196 Predicted NAD-dependen 96.4 0.012 2.5E-07 43.2 5.8 55 2-57 221-281 (343) 117 KOG1198 Zinc-binding oxidoredu 96.3 0.009 2E-07 44.2 5.2 92 2-94 223-323 (347) 118 cd08249 enoyl_reductase_like e 96.3 0.0063 1.4E-07 43.9 4.2 38 2-39 219-258 (339) 119 cd08288 MDR_yhdh Yhdh putative 96.3 0.052 1.1E-06 38.4 8.6 55 4-59 212-267 (324) 120 smart00829 PKS_ER Enoylreducta 96.3 0.021 4.6E-07 39.1 6.4 53 3-57 174-228 (288) 121 cd05195 enoyl_red enoyl reduct 96.2 0.0095 2E-07 40.8 4.3 54 2-57 177-232 (293) 122 cd08250 Mgc45594_like Mgc45594 96.2 0.032 6.9E-07 39.7 7.1 55 2-58 205-270 (329) 123 PRK10754 quinone oxidoreductas 96.2 0.011 2.3E-07 42.1 4.7 46 2-48 207-253 (327) 124 cd08268 MDR2 Medium chain dehy 96.1 0.029 6.4E-07 39.2 6.6 55 3-58 212-267 (328) 125 cd08273 MDR8 Medium chain dehy 96.1 0.035 7.6E-07 39.4 7.1 36 3-39 202-237 (331) 126 cd08248 RTN4I1 Human Reticulon 95.7 0.021 4.5E-07 41.0 4.5 34 3-37 226-259 (350) 127 TIGR01532 E4PD_g-proteo D-eryt 95.3 0.027 5.9E-07 41.4 3.9 37 3-39 88-124 (325) 128 cd08271 MDR5 Medium chain dehy 95.0 0.054 1.2E-06 38.1 4.8 36 2-38 207-242 (325) 129 smart00846 Gp_dh_N Glyceraldeh 95.0 0.032 6.9E-07 36.6 3.2 38 3-40 86-123 (149) 130 cd08247 AST1_like AST1 is a cy 94.9 0.053 1.1E-06 39.2 4.5 34 2-35 223-259 (352) 131 PRK05476 S-adenosyl-L-homocyst 94.8 0.063 1.4E-06 40.9 4.8 40 4-43 267-307 (425) 132 PF00044 Gp_dh_N: Glyceraldehy 94.4 0.032 7E-07 36.8 2.2 37 4-40 88-124 (151) 133 PRK11873 arsM arsenite S-adeno 94.2 0.15 3.4E-06 35.8 5.5 37 3-39 145-187 (272) 134 PLN02358 glyceraldehyde-3-phos 94.2 0.098 2.1E-06 38.8 4.6 38 3-40 94-131 (338) 135 cd08251 polyketide_synthase po 93.9 0.13 2.9E-06 35.6 4.6 35 3-38 188-222 (303) 136 PTZ00434 cytosolic glyceraldeh 93.6 0.071 1.5E-06 39.8 3.0 37 4-40 104-140 (361) 137 TIGR00936 ahcY adenosylhomocys 93.5 0.21 4.7E-06 37.9 5.4 43 4-48 250-293 (406) 138 PLN03096 glyceraldehyde-3-phos 93.4 0.17 3.7E-06 38.3 4.7 37 3-39 149-185 (395) 139 PRK15425 gapA glyceraldehyde-3 93.2 0.16 3.4E-06 37.6 4.2 36 4-39 89-124 (331) 140 PLN02237 glyceraldehyde-3-phos 93.0 0.24 5.2E-06 38.0 4.9 37 3-39 164-200 (442) 141 TIGR01534 GAPDH-I glyceraldehy 92.9 0.2 4.3E-06 37.0 4.4 36 4-39 90-125 (327) 142 PRK07403 glyceraldehyde-3-phos 92.9 0.24 5.1E-06 36.8 4.7 36 4-39 90-125 (337) 143 PRK07729 glyceraldehyde-3-phos 92.8 0.22 4.7E-06 37.1 4.5 36 3-38 88-123 (343) 144 PRK08955 glyceraldehyde-3-phos 92.8 0.22 4.7E-06 36.9 4.4 35 4-38 88-122 (334) 145 PRK13535 erythrose 4-phosphate 92.2 0.27 5.9E-06 36.4 4.3 36 3-38 90-125 (336) 146 PTZ00023 glyceraldehyde-3-phos 91.9 0.28 6.1E-06 36.4 4.1 37 3-39 89-125 (337) 147 PLN02494 adenosylhomocysteinas 90.5 0.33 7.2E-06 37.6 3.4 37 4-40 309-346 (477) 148 PLN02272 glyceraldehyde-3-phos 89.3 0.55 1.2E-05 35.9 3.7 37 4-40 174-210 (421) 149 PF03447 NAD_binding_3: Homose 89.3 0.81 1.8E-05 28.1 3.9 30 4-33 59-88 (117) 150 TIGR00438 rrmJ cell division p 89.2 1.1 2.4E-05 29.8 4.8 36 3-38 97-149 (188) 151 PTZ00353 glycosomal glyceralde 87.8 0.61 1.3E-05 34.7 3.0 36 4-39 92-127 (342) 152 PRK08306 dipicolinate synthase 85.5 2.5 5.5E-05 30.5 5.2 52 4-57 210-261 (296) 153 PRK13943 protein-L-isoaspartat 85.4 1.9 4.1E-05 31.7 4.5 31 4-34 149-179 (322) 154 PRK13301 putative L-aspartate 85.4 1.5 3.2E-05 31.7 3.8 37 2-38 60-96 (267) 155 PRK00377 cbiT cobalt-precorrin 85.4 2.4 5.1E-05 28.5 4.7 32 3-34 110-144 (198) 156 COG0057 GapA Glyceraldehyde-3- 85.3 0.95 2.1E-05 33.6 2.9 37 4-40 89-126 (335) 157 PF01113 DapB_N: Dihydrodipico 83.0 1.4 2.9E-05 27.7 2.6 33 5-38 68-100 (124) 158 PRK13942 protein-L-isoaspartat 81.4 2.6 5.7E-05 28.8 3.7 31 4-34 145-175 (212) 159 PF06962 rRNA_methylase: Putat 81.4 1.3 2.8E-05 28.9 2.1 24 16-39 73-96 (140) 160 TIGR02469 CbiT precorrin-6Y C5 80.5 5.2 0.00011 23.9 4.5 32 4-35 88-122 (124) 161 TIGR00561 pntA NAD(P) transhyd 80.5 2.2 4.8E-05 33.5 3.4 36 3-38 246-287 (511) 162 PTZ00075 Adenosylhomocysteinas 80.1 1.3 2.9E-05 34.4 2.1 35 4-38 309-344 (476) 163 KOG1202 Animal-type fatty acid 79.9 3.8 8.2E-05 36.0 4.7 76 2-81 1623-1702(2376) 164 PRK08289 glyceraldehyde-3-phos 79.0 2.3 4.9E-05 33.1 3.0 36 4-39 224-262 (477) 165 COG2518 Pcm Protein-L-isoaspar 78.7 1.6 3.5E-05 30.4 1.9 31 4-34 138-168 (209) 166 PRK13303 L-aspartate dehydroge 77.5 4.4 9.5E-05 28.8 4.0 30 4-33 61-90 (265) 167 PRK12771 putative glutamate sy 77.1 0.21 4.6E-06 38.9 -3.0 31 4-34 222-252 (564) 168 COG2242 CobL Precorrin-6B meth 76.9 5 0.00011 27.5 3.9 34 4-37 102-137 (187) 169 PRK13944 protein-L-isoaspartat 76.8 4.5 9.7E-05 27.4 3.7 31 4-34 142-172 (205) 170 TIGR03840 TMPT_Se_Te thiopurin 76.6 5.3 0.00011 27.5 4.1 34 4-37 113-154 (213) 171 PRK00517 prmA ribosomal protei 75.8 9.1 0.0002 26.7 5.2 52 5-56 180-234 (250) 172 PF10369 ALS_ss_C: Small subun 75.7 4.7 0.0001 23.3 3.1 28 7-34 38-65 (75) 173 TIGR00080 pimt protein-L-isoas 75.2 4.6 9.9E-05 27.5 3.4 31 4-34 146-176 (215) 174 COG0275 Predicted S-adenosylme 74.8 3.8 8.2E-05 30.2 3.0 23 16-38 225-247 (314) 175 PRK04207 glyceraldehyde-3-phos 74.8 7.1 0.00015 28.8 4.6 33 4-36 78-110 (341) 176 TIGR01546 GAPDH-II_archae glyc 73.2 6.3 0.00014 29.3 3.9 37 4-40 75-111 (333) 177 PRK00312 pcm protein-L-isoaspa 72.8 7.7 0.00017 26.2 4.1 32 4-35 144-175 (212) 178 PF02875 Mur_ligase_C: Mur lig 71.9 8.3 0.00018 22.4 3.6 34 3-36 12-49 (91) 179 PF08241 Methyltransf_11: Meth 71.5 3.2 7E-05 23.4 1.7 30 4-33 60-95 (95) 180 PF01135 PCMT: Protein-L-isoas 71.5 2.5 5.5E-05 29.1 1.5 33 4-36 141-174 (209) 181 cd02440 AdoMet_MTases S-adenos 71.0 13 0.00028 20.5 4.3 31 4-34 66-103 (107) 182 PRK00107 gidB 16S rRNA methylt 70.8 12 0.00025 25.3 4.5 32 4-35 112-145 (187) 183 KOG1661 Protein-L-isoaspartate 69.9 5.9 0.00013 28.0 3.0 32 4-35 162-193 (237) 184 TIGR00406 prmA ribosomal prote 69.8 11 0.00024 26.9 4.6 36 4-39 225-263 (288) 185 COG1712 Predicted dinucleotide 68.1 8.4 0.00018 27.5 3.4 36 3-38 59-94 (255) 186 TIGR00006 S-adenosyl-methyltra 67.9 7.2 0.00016 28.6 3.2 23 16-38 221-243 (305) 187 PF01118 Semialdhyde_dh: Semia 66.2 13 0.00029 22.9 3.8 32 4-35 66-97 (121) 188 TIGR03855 NAD_NadX aspartate d 64.9 16 0.00034 25.6 4.3 32 3-34 36-67 (229) 189 TIGR02752 MenG_heptapren 2-hep 64.0 17 0.00036 24.7 4.3 34 4-37 114-153 (231) 190 KOG1540 Ubiquinone biosynthesi 63.2 11 0.00024 27.5 3.3 30 11-40 190-219 (296) 191 PF01209 Ubie_methyltran: ubiE 62.5 6.1 0.00013 27.6 2.0 37 4-40 116-158 (233) 192 PRK11207 tellurite resistance 60.9 25 0.00054 23.6 4.7 33 3-35 94-134 (197) 193 PRK14967 putative methyltransf 60.7 23 0.00049 24.1 4.5 19 17-35 141-159 (223) 194 PLN02490 MPBQ/MSBQ methyltrans 60.6 20 0.00042 26.7 4.4 33 4-36 178-216 (340) 195 PRK08287 cobalt-precorrin-6Y C 59.9 25 0.00055 23.1 4.5 32 4-35 97-131 (187) 196 TIGR00036 dapB dihydrodipicoli 59.8 17 0.00036 25.9 3.8 34 4-38 68-101 (266) 197 TIGR00477 tehB tellurite resis 59.5 19 0.00041 24.1 3.9 32 4-35 94-133 (195) 198 PRK14874 aspartate-semialdehyd 59.3 18 0.00038 26.6 4.0 27 4-30 63-89 (334) 199 PF12847 Methyltransf_18: Meth 58.8 7.7 0.00017 22.9 1.7 32 3-34 69-110 (112) 200 COG2910 Putative NADH-flavin r 58.7 22 0.00047 24.7 4.0 42 4-46 62-114 (211) 201 PRK13304 L-aspartate dehydroge 58.0 20 0.00043 25.4 3.9 31 4-34 61-91 (265) 202 PRK08324 short chain dehydroge 57.9 19 0.00042 28.9 4.3 35 4-38 498-560 (681) 203 PRK08618 ornithine cyclodeamin 57.5 20 0.00043 26.2 4.0 41 4-46 192-233 (325) 204 PRK00050 16S rRNA m(4)C1402 me 57.5 15 0.00032 26.9 3.2 23 16-38 217-239 (296) 205 TIGR01296 asd_B aspartate-semi 56.9 20 0.00043 26.5 3.9 28 3-30 60-87 (339) 206 PRK08317 hypothetical protein; 56.7 28 0.00061 23.1 4.4 33 4-36 87-125 (241) 207 PRK14901 16S rRNA methyltransf 56.1 27 0.00058 26.6 4.6 19 16-34 365-383 (434) 208 TIGR01934 MenG_MenH_UbiE ubiqu 55.8 27 0.00058 23.1 4.2 35 4-38 106-146 (223) 209 PRK13255 thiopurine S-methyltr 55.6 20 0.00043 24.7 3.6 33 4-36 116-156 (218) 210 PF08351 DUF1726: Domain of un 54.9 29 0.00062 20.8 3.8 36 1-36 8-46 (92) 211 PLN02232 ubiquinone biosynthes 54.7 17 0.00037 23.5 3.0 35 4-38 44-84 (160) 212 KOG4300 Predicted methyltransf 54.3 31 0.00066 24.5 4.2 37 4-40 145-187 (252) 213 TIGR00518 alaDH alanine dehydr 54.0 15 0.00032 27.5 2.9 36 4-39 230-271 (370) 214 PF01795 Methyltransf_5: MraW 54.0 11 0.00023 27.9 2.1 23 16-38 222-244 (310) 215 COG2226 UbiE Methylase involve 53.7 28 0.00061 24.7 4.1 37 4-40 119-161 (238) 216 TIGR00563 rsmB ribosomal RNA s 53.6 32 0.0007 26.0 4.7 20 16-35 349-368 (426) 217 PF14258 DUF4350: Domain of un 53.0 21 0.00045 19.7 2.8 20 16-35 51-70 (70) 218 PRK11036 putative S-adenosyl-L 52.8 36 0.00077 23.6 4.5 32 4-35 112-149 (255) 219 PRK11188 rrmJ 23S rRNA methylt 52.6 33 0.00071 23.4 4.2 19 16-34 146-164 (209) 220 PRK04266 fibrillarin; Provisio 52.3 32 0.00069 23.9 4.2 31 4-34 141-175 (226) 221 cd05213 NAD_bind_Glutamyl_tRNA 52.0 21 0.00046 25.8 3.4 33 4-37 238-273 (311) 222 TIGR00119 acolac_sm acetolacta 51.7 24 0.00053 23.3 3.3 28 7-34 119-146 (157) 223 PRK05134 bifunctional 3-demeth 51.4 28 0.00061 23.6 3.8 34 3-36 113-152 (233) 224 PRK09489 rsmC 16S ribosomal RN 51.1 22 0.00048 26.3 3.4 24 15-38 283-306 (342) 225 PRK13302 putative L-aspartate 51.1 29 0.00062 24.7 3.9 31 4-34 67-97 (271) 226 PRK11088 rrmA 23S rRNA methylt 50.8 16 0.00034 25.8 2.5 31 4-35 151-181 (272) 227 PF13241 NAD_binding_7: Putati 50.7 41 0.00089 20.1 4.0 36 4-39 60-95 (103) 228 TIGR00138 gidB 16S rRNA methyl 50.6 40 0.00087 22.4 4.3 31 4-34 109-141 (181) 229 PLN02781 Probable caffeoyl-CoA 50.2 31 0.00067 24.0 3.8 32 4-35 144-178 (234) 230 PF13659 Methyltransf_26: Meth 50.1 14 0.00031 21.9 2.0 19 16-34 96-114 (117) 231 PLN02233 ubiquinone biosynthes 49.3 22 0.00048 25.0 3.1 36 4-39 145-186 (261) 232 PRK08300 acetaldehyde dehydrog 48.9 32 0.0007 25.3 3.9 52 4-56 70-127 (302) 233 PRK10258 biotin biosynthesis p 48.4 53 0.0011 22.6 4.8 35 4-38 103-143 (251) 234 COG4091 Predicted homoserine d 48.3 26 0.00057 26.8 3.4 34 4-37 101-135 (438) 235 PRK07402 precorrin-6B methylas 47.5 43 0.00094 22.2 4.1 23 15-37 122-144 (196) 236 COG0769 MurE UDP-N-acetylmuram 46.8 1.3E+02 0.0028 23.5 7.0 72 4-81 332-412 (475) 237 TIGR02072 BioC biotin biosynth 46.6 59 0.0013 21.6 4.7 33 4-36 98-136 (240) 238 PRK00216 ubiE ubiquinone/menaq 46.3 49 0.0011 22.1 4.3 35 4-38 121-161 (239) 239 PRK11705 cyclopropane fatty ac 46.2 50 0.0011 24.8 4.6 33 4-36 228-268 (383) 240 PRK14188 bifunctional 5,10-met 46.0 22 0.00047 26.0 2.6 33 4-38 201-233 (296) 241 PF05724 TPMT: Thiopurine S-me 46.0 19 0.00041 24.9 2.2 33 4-36 116-156 (218) 242 PF00899 ThiF: ThiF family; I 45.9 35 0.00077 21.2 3.3 32 4-35 92-123 (135) 243 PLN03075 nicotianamine synthas 45.7 45 0.00097 24.4 4.2 32 4-35 195-233 (296) 244 cd01483 E1_enzyme_family Super 45.6 35 0.00075 21.4 3.3 32 4-35 89-120 (143) 245 PRK11895 ilvH acetolactate syn 44.6 35 0.00076 22.7 3.2 29 6-34 119-147 (161) 246 TIGR02886 spore_II_AA anti-sig 44.5 31 0.00068 20.3 2.8 11 27-37 70-80 (106) 247 TIGR02716 C20_methyl_CrtF C-20 44.3 30 0.00065 24.7 3.1 20 17-36 236-255 (306) 248 CHL00100 ilvH acetohydroxyacid 44.1 36 0.00079 22.9 3.3 29 6-34 119-147 (174) 249 PRK05562 precorrin-2 dehydroge 44.1 78 0.0017 22.2 5.1 52 4-55 85-137 (223) 250 TIGR00537 hemK_rel_arch HemK-r 44.0 30 0.00065 22.6 2.9 23 16-38 121-143 (179) 251 TIGR00417 speE spermidine synt 43.4 56 0.0012 23.1 4.4 21 16-36 167-187 (270) 252 PRK12335 tellurite resistance 42.8 52 0.0011 23.4 4.2 33 3-35 183-223 (287) 253 COG0112 GlyA Glycine/serine hy 42.8 1E+02 0.0022 23.8 5.7 28 12-39 96-123 (413) 254 TIGR02853 spore_dpaA dipicolin 41.9 1.2E+02 0.0027 21.7 6.0 51 4-56 209-259 (287) 255 PTZ00098 phosphoethanolamine N 41.8 35 0.00075 24.1 3.1 35 4-38 117-159 (263) 256 PRK14904 16S rRNA methyltransf 41.8 50 0.0011 25.2 4.1 20 17-36 359-378 (445) 257 PRK00048 dihydrodipicolinate r 41.6 48 0.001 23.3 3.8 32 4-36 60-91 (257) 258 PRK13256 thiopurine S-methyltr 41.5 49 0.0011 23.2 3.7 34 4-37 124-165 (226) 259 PRK14968 putative methyltransf 40.7 36 0.00079 21.9 2.9 19 17-35 130-148 (188) 260 PF01408 GFO_IDH_MocA: Oxidore 40.3 52 0.0011 19.6 3.4 26 4-29 62-87 (120) 261 PF01728 FtsJ: FtsJ-like methy 40.3 33 0.0007 22.4 2.6 22 17-38 121-142 (181) 262 COG2519 GCD14 tRNA(1-methylade 40.2 67 0.0015 23.1 4.3 32 4-35 163-195 (256) 263 PF00670 AdoHcyase_NAD: S-aden 39.7 19 0.00041 24.1 1.4 45 4-50 78-123 (162) 264 PF04019 DUF359: Protein of un 39.3 80 0.0017 20.0 4.2 36 5-40 62-97 (121) 265 cd05007 SIS_Etherase N-acetylm 39.2 34 0.00074 24.2 2.7 23 16-38 37-59 (257) 266 COG2227 UbiG 2-polyprenyl-3-me 38.9 77 0.0017 22.7 4.4 35 3-37 123-163 (243) 267 TIGR00446 nop2p NOL1/NOP2/sun 38.8 35 0.00076 24.1 2.7 19 17-35 181-199 (264) 268 PF13847 Methyltransf_31: Meth 38.8 46 0.001 21.0 3.1 35 3-37 72-112 (152) 269 PRK14902 16S rRNA methyltransf 38.1 70 0.0015 24.3 4.4 19 17-35 361-379 (444) 270 PF08704 GCD14: tRNA methyltra 37.2 31 0.00066 24.5 2.2 32 4-35 113-146 (247) 271 PRK07340 ornithine cyclodeamin 36.9 26 0.00056 25.4 1.8 42 4-47 188-230 (304) 272 smart00859 Semialdhyde_dh Semi 36.8 97 0.0021 18.7 4.3 33 4-36 65-100 (122) 273 PF13460 NAD_binding_10: NADH( 36.7 53 0.0012 21.0 3.2 35 4-38 60-100 (183) 274 PLN02476 O-methyltransferase 36.5 55 0.0012 23.7 3.4 32 4-35 194-228 (278) 275 cd01487 E1_ThiF_like E1_ThiF_l 36.4 42 0.00091 22.2 2.7 32 4-35 88-120 (174) 276 TIGR00274 N-acetylmuramic acid 36.2 43 0.00094 24.3 2.9 22 17-38 46-67 (291) 277 COG4122 Predicted O-methyltran 36.0 70 0.0015 22.4 3.8 33 4-36 132-167 (219) 278 KOG3674 FtsJ-like RNA methyltr 35.9 16 0.00035 29.1 0.6 29 5-33 232-272 (696) 279 TIGR03215 ac_ald_DH_ac acetald 35.6 74 0.0016 23.1 4.0 30 4-34 64-93 (285) 280 PRK08261 fabG 3-ketoacyl-(acyl 35.5 90 0.002 23.4 4.6 33 4-36 284-343 (450) 281 TIGR01470 cysG_Nterm siroheme 35.3 1.2E+02 0.0027 20.6 4.9 52 4-55 69-121 (205) 282 PRK08374 homoserine dehydrogen 35.2 61 0.0013 23.9 3.6 25 4-28 91-115 (336) 283 cd00650 LDH_MDH_like NAD-depen 35.2 1.6E+02 0.0034 20.6 6.2 34 4-37 70-121 (263) 284 PRK15068 tRNA mo(5)U34 methylt 35.1 92 0.002 22.8 4.5 32 4-35 189-226 (322) 285 PRK07502 cyclohexadienyl dehyd 34.5 88 0.0019 22.4 4.3 34 4-37 66-102 (307) 286 PRK14194 bifunctional 5,10-met 34.3 43 0.00094 24.6 2.6 33 4-38 202-234 (301) 287 PLN02396 hexaprenyldihydroxybe 34.3 84 0.0018 23.1 4.2 33 4-36 198-236 (322) 288 TIGR00377 ant_ant_sig anti-ant 34.2 68 0.0015 18.7 3.2 11 27-37 74-84 (108) 289 PLN02244 tocopherol O-methyltr 34.1 51 0.0011 24.2 3.0 34 4-37 186-225 (340) 290 PRK06718 precorrin-2 dehydroge 34.0 1.1E+02 0.0025 20.7 4.6 51 4-55 70-121 (202) 291 TIGR02356 adenyl_thiF thiazole 32.7 54 0.0012 22.2 2.8 29 4-32 111-139 (202) 292 PF13489 Methyltransf_23: Meth 32.5 34 0.00073 21.3 1.7 34 4-37 78-117 (161) 293 PF05175 MTS: Methyltransferas 32.4 36 0.00079 22.2 1.9 24 16-39 121-144 (170) 294 PF01234 NNMT_PNMT_TEMT: NNMT/ 32.3 23 0.00049 25.4 0.9 34 5-38 159-202 (256) 295 PRK14189 bifunctional 5,10-met 32.3 37 0.00079 24.8 2.0 33 4-38 201-233 (285) 296 cd06844 STAS Sulphate Transpor 32.2 56 0.0012 19.1 2.6 10 27-36 70-79 (100) 297 TIGR01318 gltD_gamma_fam gluta 32.1 7.2 0.00016 29.8 -1.7 13 4-16 226-238 (467) 298 PRK14103 trans-aconitate 2-met 32.0 61 0.0013 22.4 3.0 31 4-34 89-125 (255) 299 PRK10792 bifunctional 5,10-met 31.9 45 0.00098 24.3 2.4 33 4-38 202-234 (285) 300 cd07041 STAS_RsbR_RsbS_like Su 31.9 36 0.00078 20.2 1.7 33 6-38 43-83 (109) 301 TIGR01983 UbiG ubiquinone bios 31.9 1.1E+02 0.0023 20.4 4.2 33 4-36 112-150 (224) 302 smart00828 PKS_MT Methyltransf 31.8 65 0.0014 21.6 3.1 33 4-36 67-105 (224) 303 PRK00299 sulfur transfer prote 31.6 1.1E+02 0.0023 17.6 3.8 35 4-38 7-46 (81) 304 PRK14175 bifunctional 5,10-met 31.4 49 0.0011 24.1 2.5 33 4-38 201-233 (286) 305 PRK12570 N-acetylmuramic acid- 31.4 62 0.0013 23.5 3.0 23 16-38 46-68 (296) 306 COG0144 Sun tRNA and rRNA cyto 31.3 53 0.0011 24.4 2.7 19 17-35 270-288 (355) 307 PRK07819 3-hydroxybutyryl-CoA 31.3 80 0.0017 22.6 3.6 20 3-22 83-102 (286) 308 PRK15451 tRNA cmo(5)U34 methyl 31.0 67 0.0015 22.2 3.1 22 16-37 145-166 (247) 309 PRK14179 bifunctional 5,10-met 30.9 44 0.00095 24.3 2.2 34 3-38 200-233 (284) 310 cd05212 NAD_bind_m-THF_DH_Cycl 30.1 46 0.00099 21.5 2.0 33 4-38 71-103 (140) 311 PRK00121 trmB tRNA (guanine-N( 29.8 75 0.0016 21.3 3.1 21 15-35 136-156 (202) 312 PLN02366 spermidine synthase 29.8 1.1E+02 0.0024 22.3 4.2 21 16-36 187-207 (308) 313 COG2103 Predicted sugar phosph 29.7 73 0.0016 23.4 3.1 23 16-38 48-70 (298) 314 cd05291 HicDH_like L-2-hydroxy 29.5 1.1E+02 0.0023 22.0 4.1 34 4-37 68-119 (306) 315 PRK08644 thiamine biosynthesis 29.3 66 0.0014 22.0 2.8 31 4-34 117-148 (212) 316 cd00757 ThiF_MoeB_HesA_family 29.1 61 0.0013 22.3 2.6 25 4-28 111-135 (228) 317 COG1179 Dinucleotide-utilizing 29.0 63 0.0014 23.3 2.7 35 2-36 119-154 (263) 318 PRK06823 ornithine cyclodeamin 29.0 93 0.002 22.8 3.6 45 3-48 191-236 (315) 319 PF08468 MTS_N: Methyltransfer 28.5 51 0.0011 21.7 2.0 25 17-41 87-111 (155) 320 PRK11933 yebU rRNA (cytosine-C 28.4 62 0.0013 25.2 2.8 18 17-34 224-241 (470) 321 KOG0259 Tyrosine aminotransfer 28.3 1.4E+02 0.0031 23.1 4.5 30 5-34 126-155 (447) 322 PRK05441 murQ N-acetylmuramic 28.2 68 0.0015 23.3 2.8 23 16-38 50-72 (299) 323 PRK05786 fabG 3-ketoacyl-(acyl 28.1 1.3E+02 0.0028 19.9 4.1 35 4-38 81-138 (238) 324 PRK00536 speE spermidine synth 28.0 1E+02 0.0023 22.1 3.7 33 4-36 139-172 (262) 325 PF06080 DUF938: Protein of un 28.0 88 0.0019 21.7 3.2 24 16-39 122-145 (204) 326 cd01339 LDH-like_MDH L-lactate 28.0 94 0.002 22.2 3.5 35 3-37 65-117 (300) 327 COG0289 DapB Dihydrodipicolina 27.9 73 0.0016 23.1 2.9 34 4-38 69-102 (266) 328 PRK05690 molybdopterin biosynt 27.6 78 0.0017 22.2 3.0 31 4-34 122-152 (245) 329 PF00464 SHMT: Serine hydroxym 27.5 26 0.00056 26.7 0.5 27 12-38 94-120 (399) 330 TIGR02355 moeB molybdopterin s 27.4 73 0.0016 22.3 2.8 26 4-29 114-139 (240) 331 PRK13938 phosphoheptose isomer 27.4 74 0.0016 21.7 2.7 23 17-39 34-56 (196) 332 PF08541 ACP_syn_III_C: 3-Oxoa 27.1 51 0.0011 18.9 1.7 24 16-39 55-80 (90) 333 TIGR00091 tRNA (guanine-N(7)-) 27.1 90 0.0019 20.7 3.1 21 15-35 112-132 (194) 334 PF09363 XFP_C: XFP C-terminal 27.0 83 0.0018 21.9 2.9 56 2-57 32-104 (203) 335 PRK14185 bifunctional 5,10-met 26.9 51 0.0011 24.1 2.0 33 4-38 204-236 (293) 336 TIGR02354 thiF_fam2 thiamine b 26.6 83 0.0018 21.4 2.9 15 4-18 110-124 (200) 337 PRK13937 phosphoheptose isomer 26.4 79 0.0017 21.1 2.7 24 16-39 26-49 (188) 338 TIGR00978 asd_EA aspartate-sem 26.3 1.3E+02 0.0028 22.1 4.0 34 3-36 72-105 (341) 339 PRK10901 16S rRNA methyltransf 26.2 84 0.0018 23.8 3.1 20 16-35 353-372 (427) 340 PRK01160 hypothetical protein; 26.1 1.8E+02 0.0038 19.8 4.3 34 7-40 117-150 (178) 341 COG5016 Pyruvate/oxaloacetate 26.1 79 0.0017 24.6 2.9 36 4-39 111-148 (472) 342 PRK08328 hypothetical protein; 25.9 81 0.0018 21.8 2.8 14 4-17 118-131 (231) 343 cd01840 SGNH_hydrolase_yrhL_li 25.6 1.8E+02 0.0038 18.2 4.2 11 29-39 51-61 (150) 344 cd00755 YgdL_like Family of ac 25.6 97 0.0021 21.7 3.1 27 4-30 102-128 (231) 345 TIGR00452 methyltransferase, p 25.2 86 0.0019 23.0 2.9 31 4-34 188-224 (314) 346 TIGR00740 methyltransferase, p 25.2 92 0.002 21.3 3.0 21 16-36 142-162 (239) 347 cd00923 Cyt_c_Oxidase_Va Cytoc 24.7 42 0.0009 20.8 1.0 20 8-27 35-54 (103) 348 COG1240 ChlD Mg-chelatase subu 24.6 92 0.002 22.5 2.8 29 2-30 125-153 (261) 349 PRK01683 trans-aconitate 2-met 24.6 99 0.0021 21.3 3.0 32 4-35 93-130 (258) 350 PRK06349 homoserine dehydrogen 24.4 1.3E+02 0.0029 22.9 3.9 31 4-35 72-103 (426) 351 PF02353 CMAS: Mycolic acid cy 24.4 55 0.0012 23.4 1.8 27 9-35 137-166 (273) 352 PLN02589 caffeoyl-CoA O-methyl 24.4 1.1E+02 0.0024 21.6 3.3 31 4-34 156-189 (247) 353 PRK14180 bifunctional 5,10-met 23.9 61 0.0013 23.6 1.9 34 3-38 200-233 (282) 354 PF00056 Ldh_1_N: lactate/mala 23.9 1.5E+02 0.0033 18.8 3.6 34 4-37 69-120 (141) 355 KOG2198 tRNA cytosine-5-methyl 23.8 74 0.0016 24.2 2.3 19 17-35 278-296 (375) 356 PRK14167 bifunctional 5,10-met 23.6 62 0.0013 23.7 1.9 33 4-38 204-236 (297) 357 PRK07806 short chain dehydroge 23.4 1.8E+02 0.004 19.4 4.2 33 4-36 84-135 (248) 358 PRK00436 argC N-acetyl-gamma-g 23.2 1.5E+02 0.0034 21.8 4.0 32 4-35 68-99 (343) 359 PRK14178 bifunctional 5,10-met 23.2 74 0.0016 23.1 2.2 33 4-38 195-227 (279) 360 COG3963 Phospholipid N-methylt 23.2 2.3E+02 0.005 19.5 4.4 35 4-38 117-159 (194) 361 PTZ00146 fibrillarin; Provisio 22.7 1.4E+02 0.003 21.9 3.6 31 4-34 202-236 (293) 362 PRK15116 sulfur acceptor prote 22.7 1.3E+02 0.0029 21.6 3.4 34 4-37 121-155 (268) 363 PRK06407 ornithine cyclodeamin 22.6 1.4E+02 0.0029 21.7 3.5 43 4-47 182-225 (301) 364 PF13578 Methyltransf_24: Meth 22.6 63 0.0014 18.9 1.5 17 17-33 87-103 (106) 365 PF06859 Bin3: Bicoid-interact 22.5 56 0.0012 20.5 1.3 19 16-34 25-43 (110) 366 PRK05597 molybdopterin biosynt 22.5 92 0.002 23.1 2.7 27 4-30 118-144 (355) 367 PRK14184 bifunctional 5,10-met 22.3 60 0.0013 23.7 1.6 33 4-38 204-236 (286) 368 PRK15001 SAM-dependent 23S rib 22.2 1E+02 0.0022 23.3 2.9 23 16-38 321-343 (378) 369 PF04016 DUF364: Domain of unk 22.1 2.3E+02 0.005 18.2 5.4 49 5-57 63-114 (147) 370 TIGR01177 conserved hypothetic 22.1 1.2E+02 0.0025 22.1 3.1 20 16-35 275-294 (329) 371 PRK09485 mmuM homocysteine met 22.0 3.1E+02 0.0068 19.8 5.8 65 7-77 218-300 (304) 372 PF00891 Methyltransf_2: O-met 21.9 95 0.0021 21.2 2.5 22 16-37 178-201 (241) 373 PF05834 Lycopene_cycl: Lycope 21.8 2.1E+02 0.0045 21.1 4.4 28 6-34 1-30 (374) 374 PRK04457 spermidine synthase; 21.6 1.1E+02 0.0025 21.6 2.9 20 15-34 157-176 (262) 375 PF03269 DUF268: Caenorhabditi 21.6 91 0.002 21.2 2.2 30 9-39 85-114 (177) 376 COG0039 Mdh Malate/lactate deh 21.5 1.5E+02 0.0033 21.9 3.6 37 3-39 68-122 (313) 377 PLN00135 malate dehydrogenase 21.4 1.5E+02 0.0033 21.6 3.6 34 4-37 58-110 (309) 378 PRK11579 putative oxidoreducta 21.4 1.8E+02 0.0039 21.1 4.0 38 4-45 64-101 (346) 379 PRK10637 cysG siroheme synthas 21.2 2.6E+02 0.0056 21.5 4.9 52 4-55 72-124 (457) 380 TIGR03516 ppisom_GldI peptidyl 21.2 1.7E+02 0.0038 19.5 3.6 43 14-56 124-173 (177) 381 PF01596 Methyltransf_3: O-met 21.2 1.2E+02 0.0026 20.8 2.8 33 4-36 121-156 (205) 382 PRK14022 UDP-N-acetylmuramoyla 21.1 2.5E+02 0.0055 21.5 4.9 35 4-38 339-376 (481) 383 PRK14903 16S rRNA methyltransf 21.1 1.1E+02 0.0025 23.3 3.0 20 17-36 348-367 (431) 384 KOG1205 Predicted dehydrogenas 20.8 1.1E+02 0.0024 22.3 2.7 29 17-45 129-159 (282) 385 cd07043 STAS_anti-anti-sigma_f 20.7 1.6E+02 0.0034 16.5 3.0 7 29-35 71-77 (99) 386 PRK08268 3-hydroxy-acyl-CoA de 20.7 3.2E+02 0.0069 21.4 5.4 30 4-33 86-119 (507) 387 PF02882 THF_DHG_CYH_C: Tetrah 20.7 57 0.0012 21.6 1.1 33 4-38 79-111 (160) 388 COG4123 Predicted O-methyltran 20.7 1.4E+02 0.003 21.4 3.1 24 14-37 149-172 (248) 389 PF13580 SIS_2: SIS domain; PD 20.6 1.3E+02 0.0028 18.9 2.8 38 19-56 93-134 (138) 390 PRK09436 thrA bifunctional asp 20.6 1.4E+02 0.0031 24.9 3.6 27 5-31 548-574 (819) 391 PRK07269 cystathionine gamma-s 20.3 2.1E+02 0.0046 21.2 4.2 32 4-35 68-99 (364) 392 PLN02700 homoserine dehydrogen 20.2 1.6E+02 0.0035 22.3 3.6 27 5-31 110-136 (377) 393 PRK14176 bifunctional 5,10-met 20.2 88 0.0019 22.8 2.1 34 3-38 206-239 (287) 394 PF01951 Archease: Archease pr 20.1 73 0.0016 20.3 1.5 25 1-25 4-30 (137) 395 TIGR02371 ala_DH_arch alanine 20.0 1.3E+02 0.0028 22.0 3.0 42 4-46 192-234 (325) No 1 >PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1.1.1.1 from EC) (ADH) catalyzes the reversible oxidation of alcohols to their corresponding acetaldehyde or ketone with the concomitant reduction of NAD:alcohol + NAD = aldehyde or ketone + NADH Currently three structurally and catalytically different types of alcohol dehydrogenases are known: Zinc-containing 'long-chain' alcohol dehydrogenases. Insect-type, or 'short-chain' alcohol dehydrogenases. Iron-containing alcohol dehydrogenases. Zinc-containing ADH's [, ] are dimeric or tetrameric enzymes that bind two atoms of zinc per subunit. One of the zinc atom is essential for catalytic activity while the other is not. Both zinc atoms are coordinated by either cysteine or histidine residues; the catalytic zinc is coordinated by two cysteines and one histidine. Zinc-containing ADH's are found in bacteria, mammals, plants, and in fungi. In many species there is more than one isozyme (for example, humans have at least six isozymes, yeast have three, etc.). A number of other zinc-dependent dehydrogenases are closely related to zinc ADH [] and are included in this family. Sorbitol dehydrogenase (1.1.1.14 from EC) L-threonine 3-dehydrogenase (1.1.1.103 from EC) Glutathione-dependent formaldehyde dehydrogenase (1.1.1.284 from EC) Mannitol dehydrogenase (1.1.1.255 from EC) In addition, this family includes NADP-dependent quinone oxidoreductase (1.6.5.5 from EC), an enzyme found in bacteria (gene qor), in yeast and in mammals where, in some species such as rodents, it has been recruited as an eye lens protein and is known as zeta-crystallin []. The sequence of quinone oxidoreductase is distantly related to that other zinc-containing alcohol dehydrogenases and it lacks the zinc-ligand residues. The torpedo fish and mammalian synaptic vesicle membrane protein vat-1 is related to qor. This entry represents the cofactor-binding domain of these enzymes, which is normally found towards the C terminus. Structural studies indicate that it forms a classical Rossman fold that reversibly binds NAD(H) [, , ].; GO: 0008270 zinc ion binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3PI7_A 3COS_D 1VJ1_A 2ZB3_A 1PIW_B 1Q1N_A 1PS0_A 2EER_B 3KRT_A 1ZSY_A .... Probab=99.45 E-value=3.2e-13 Score=85.31 Aligned_cols=71 Identities=21% Similarity=0.354 Sum_probs=60.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +++|++|||+|.+.++++++++++++|+++++|... .+.+++...++.+++++.| ++.++++++ +++++++ T Consensus 57 ~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~vg~~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~la 129 (130) T PF00107_consen 57 RGVDVVIDCVGSGDTLQEAIKLLRPGGRIVVVGVYGGDPISFNLMNLMFKEITIRG------SWGGSPEDFQEALQLLA 129 (130) T ss_dssp SSEEEEEESSSSHHHHHHHHHHEEEEEEEEEESSTSTSEEEEEHHHHHHTTEEEEE------ESSGGHHHHHHHHHHHH T ss_pred ccceEEEEecCcHHHHHHHHHHhccCCEEEEEEccCCCCCCCCHHHHHhCCcEEEE------EccCCHHHHHHHHHHhc Confidence 479999999998899999999999999999999998 6778999999999999995 555555555 5566665 No 2 >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Probab=99.37 E-value=3.4e-12 Score=93.53 Aligned_cols=85 Identities=25% Similarity=0.329 Sum_probs=68.9 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCc-ccChHHHHhcCcEEEeEeeceeeee-echhhH-HHHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDM-TVPLTPAAARYLIYGFLFFFFLVLG-YSVIYF-RKMLYI 78 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~-~i~~~~l~~k~~~i~Gs~~~~g~~~-~~~~~~-~~i~~l 78 (100) |+|+|++|||+|++.++++++++++++|+++++|++.++. .++...++.|++++.| +.+ +.+.++ +++.++ T Consensus 236 g~g~D~vie~~G~~~~~~~ai~~~r~gG~v~~vGv~~~~~~~~~~~~~~~kel~l~g------s~~~~~~~~~~~~~~ll 309 (350) T COG1063 236 GRGADVVIEAVGSPPALDQALEALRPGGTVVVVGVYGGEDIPLPAGLVVSKELTLRG------SLRPSGREDFERALDLL 309 (350) T ss_pred CCCCCEEEECCCCHHHHHHHHHHhcCCCEEEEEeccCCccCccCHHHHHhcccEEEe------ccCCCCcccHHHHHHHH Confidence 4589999999999999999999999999999999998766 6888899999999996 433 334444 688899 Q ss_pred hcCC---Ccceeeeecee Q 034260 79 SGQT---PKLIQATLFDL 93 (100) Q Consensus 79 ~~~~---~~~i~~~~~~~ 93 (100) +++. .++| ++++++ T Consensus 310 ~~g~i~~~~li-t~~~~~ 326 (350) T COG1063 310 ASGKIDPEKLI-THRLPL 326 (350) T ss_pred HcCCCChhHce-EeeccH Confidence 8874 4455 566654 No 3 >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Probab=99.34 E-value=5.2e-12 Score=91.56 Aligned_cols=85 Identities=27% Similarity=0.426 Sum_probs=73.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeech-hhHHHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSV-IYFRKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~-~~~~~i~~l~~~~ 82 (100) .+|++|||+|...+++.++.+++++|+++++|+.+...++++.++..||+++. |+++|.. .|..++.++++++ T Consensus 242 ~~d~~~dCsG~~~~~~aai~a~r~gGt~vlvg~g~~~~~fpi~~v~~kE~~~~------g~fry~~~~y~~ai~li~sGk 315 (354) T KOG0024|consen 242 QPDVTFDCSGAEVTIRAAIKATRSGGTVVLVGMGAEEIQFPIIDVALKEVDLR------GSFRYCNGDYPTAIELVSSGK 315 (354) T ss_pred CCCeEEEccCchHHHHHHHHHhccCCEEEEeccCCCccccChhhhhhheeeee------eeeeeccccHHHHHHHHHcCC Confidence 49999999999999999999999999999999999999999999999999999 5777866 4457788999884 Q ss_pred --Ccceeeeeceee Q 034260 83 --PKLIQATLFDLF 94 (100) Q Consensus 83 --~~~i~~~~~~~~ 94 (100) .|...|.+++++ T Consensus 316 i~~k~lIT~r~~~~ 329 (354) T KOG0024|consen 316 IDVKPLITHRYKFD 329 (354) T ss_pred cCchhheecccccc Confidence 666666666653 No 4 >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase. Probab=99.30 E-value=1.1e-11 Score=88.79 Aligned_cols=87 Identities=10% Similarity=0.069 Sum_probs=67.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +.++|++|||+|.+.++++++++++++|+++++|....+.++++..++.|++++.| +..+.++++ +.+.++.+ T Consensus 198 ~~g~Dvvid~~G~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~i~~------~~~~~~~~~~~~~~l~~~ 271 (308) T TIGR01202 198 RRDYRAIYDASGDPSLIDTLVRRLAKGGEIVLAGFYTEPVNFDFVPAFMKEARLRI------AAEWQPGDLHAVRELIES 271 (308) T ss_pred CCCCCEEEECCCCHHHHHHHHHhhhcCcEEEEEeecCCCcccccchhhhcceEEEE------ecccchhHHHHHHHHHHc Confidence 35799999999998899999999999999999998776667777788899999985 444444555 66778877 Q ss_pred CCC--cceeeeeceee Q 034260 81 QTP--KLIQATLFDLF 94 (100) Q Consensus 81 ~~~--~~i~~~~~~~~ 94 (100) +.. +.+.++.+||+ T Consensus 272 g~i~~~~~it~~~~l~ 287 (308) T TIGR01202 272 GALSLDGLITHQRPAS 287 (308) T ss_pred CCCChhhccceeecHH Confidence 753 22344566765 No 5 >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds. Probab=99.25 E-value=3.4e-11 Score=85.18 Aligned_cols=88 Identities=17% Similarity=0.283 Sum_probs=67.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC--CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH--HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~--~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) ++++|+++||+|.+.++++++++++++|+++.+|... .+.++++..++.|++++.| ++.+++.++ +++.++ T Consensus 185 ~~g~d~vid~~G~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~i~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~l 258 (280) T TIGR03366 185 GRGVDVALEFSGATAAVRACLESLDVGGTAVLAGSVFPGGPVALDPEQVVRRWLTIRG------VHNYEPRHLDQAVRFL 258 (280) T ss_pred CCCCCEEEECCCChHHHHHHHHHhcCCCEEEEeccCCCCCceeeCHHHHHhCCcEEEe------cCCCCHHHHHHHHHHH Confidence 3579999999999899999999999999999999754 3567888889999999995 545544544 667788 Q ss_pred hcC--C--Ccceeeeeceeee Q 034260 79 SGQ--T--PKLIQATLFDLFF 95 (100) Q Consensus 79 ~~~--~--~~~i~~~~~~~~~ 95 (100) .++ . .+.+.++.|||+. T Consensus 259 ~~~~~~~~~~~~it~~~~l~~ 279 (280) T TIGR03366 259 AANGQRFPFEELVGKPFPLAD 279 (280) T ss_pred HhhCCCCCHHHHhhccccccc Confidence 753 2 3234457778763 No 6 >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase. NAD-linked ribitol-5-phosphate dehydrogenase, a member of the MDR/zinc-dependent alcohol dehydrogenase-like family, oxidizes the phosphate ester of ribitol-5-phosphate to xylulose-5-phosphate of the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase ( Probab=99.19 E-value=9e-11 Score=85.19 Aligned_cols=85 Identities=15% Similarity=0.244 Sum_probs=64.2 Q ss_pred cccEEEEccC---hHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 4 GIDVSFDCAG---LNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 4 G~D~vie~~G---~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) |+|++|||+| .+.++++++++++++|+++++|....+.++++..++.|++++.| +..++.+++ +.+.+++ T Consensus 222 g~d~viD~~G~~~~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~k~~~i~g------~~~~~~~~~~~~~~~~~ 295 (341) T cd08237 222 AVDHAFECVGGRGSQSAINQIIDYIRPQGTIGLMGVSEYPVPINTRMVLEKGLTLVG------SSRSTREDFERAVELLS 295 (341) T ss_pred CCcEEEECCCCCccHHHHHHHHHhCcCCcEEEEEeecCCCcccCHHHHhhCceEEEE------ecccCHHHHHHHHHHHH Confidence 6899999999 56789999999999999999998766667888888899999996 433434444 6677777 Q ss_pred cC-----CCcceeeeeceee Q 034260 80 GQ-----TPKLIQATLFDLF 94 (100) Q Consensus 80 ~~-----~~~~i~~~~~~~~ 94 (100) ++ ..+.+.+..++++ T Consensus 296 ~~~~~~~~l~~~i~~~~~l~ 315 (341) T cd08237 296 RNPEVAEYLRKLVGGVFPVR 315 (341) T ss_pred hCCcccCChHHHhccccccc Confidence 66 2333333556653 No 7 >PRK09880 L-idonate 5-dehydrogenase; Provisional Probab=99.17 E-value=2.3e-10 Score=82.87 Aligned_cols=85 Identities=18% Similarity=0.272 Sum_probs=66.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQTP 83 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~~~ 83 (100) ++|++|||+|.+.++++++++++++|+++.+|......++++..++.|++++.| +..+..++.+.+.++.++.. T Consensus 235 ~~D~vid~~G~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~k~~~i~g------~~~~~~~~~~~~~l~~~g~i 308 (343) T PRK09880 235 YFDVSFEVSGHPSSINTCLEVTRAKGVMVQVGMGGAPPEFPMMTLIVKEISLKG------SFRFTEEFNTAVSWLANGVI 308 (343) T ss_pred CCCEEEECCCCHHHHHHHHHHhhcCCEEEEEccCCCCCccCHHHHHhCCcEEEE------EeeccccHHHHHHHHHcCCC Confidence 589999999998899999999999999999998766667888888899999996 43343344466778887753 Q ss_pred --cceeeeeceee Q 034260 84 --KLIQATLFDLF 94 (100) Q Consensus 84 --~~i~~~~~~~~ 94 (100) +.+.++.++|+ T Consensus 309 ~~~~~i~~~~~l~ 321 (343) T PRK09880 309 NPLPLLSAEYPFT 321 (343) T ss_pred CchhheEEEEEHH Confidence 23444666764 No 8 >PLN02827 Alcohol dehydrogenase-like Probab=99.13 E-value=3.2e-10 Score=83.52 Aligned_cols=90 Identities=13% Similarity=0.045 Sum_probs=65.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCCCcccCh-HHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHHDMTVPL-TPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~~~~i~~-~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +|+|+++||+|.+.++..++++++++ |+++++|....+.+++. ..++.+++++.|++. +.+. +..++ +.+.++. T Consensus 262 ~g~d~vid~~G~~~~~~~~l~~l~~g~G~iv~~G~~~~~~~~~~~~~~~~~~~~i~g~~~--~~~~-~~~~~~~~~~~~~ 338 (378) T PLN02827 262 GGADYSFECVGDTGIATTALQSCSDGWGLTVTLGVPKAKPEVSAHYGLFLSGRTLKGSLF--GGWK-PKSDLPSLVDKYM 338 (378) T ss_pred CCCCEEEECCCChHHHHHHHHhhccCCCEEEEECCcCCCccccccHHHHhcCceEEeeec--CCCc-hhhhHHHHHHHHH Confidence 37999999999988899999999999 99999998765445544 457789999997553 2221 12334 5567777 Q ss_pred cCCCcc--eeeeeceeee Q 034260 80 GQTPKL--IQATLFDLFF 95 (100) Q Consensus 80 ~~~~~~--i~~~~~~~~~ 95 (100) ++..+. +.++.|+|+. T Consensus 339 ~g~i~~~~~i~~~~~le~ 356 (378) T PLN02827 339 NKEIMIDEFITHNLSFDE 356 (378) T ss_pred cCCCChHHheEEEecHHH Confidence 775444 4456677753 No 9 >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione. Probab=99.12 E-value=5.5e-10 Score=81.33 Aligned_cols=89 Identities=19% Similarity=0.119 Sum_probs=65.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC--cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD--MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~--~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +++|+++||+|.+.++++++++++++|+++++|..... .++++..++.+++++.+++. +. ..+.+++ +.+.+++ T Consensus 244 ~g~d~vid~~g~~~~~~~~~~~~~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~~~~~--~~-~~~~~~~~~~~~l~~ 320 (358) T TIGR03451 244 FGADVVIDAVGRPETYKQAFYARDLAGTVVLVGVPTPDMTLELPLLDVFGRGGALKSSWY--GD-CLPERDFPMLVDLYL 320 (358) T ss_pred CCCCEEEECCCCHHHHHHHHHHhccCCEEEEECCCCCCceeeccHHHHhhcCCEEEEeec--CC-CCcHHHHHHHHHHHH Confidence 47999999999888999999999999999999987543 46777778899999997542 21 1223445 4567888 Q ss_pred cCCC--cceeeeeceee Q 034260 80 GQTP--KLIQATLFDLF 94 (100) Q Consensus 80 ~~~~--~~i~~~~~~~~ 94 (100) ++.. +.+.++.+|++ T Consensus 321 ~g~l~~~~~i~~~~~l~ 337 (358) T TIGR03451 321 QGRLPLDAFVTERIGLD 337 (358) T ss_pred cCCCCchheEEEEecHH Confidence 7753 32334566765 No 10 >PLN02178 cinnamyl-alcohol dehydrogenase Probab=99.10 E-value=6.2e-10 Score=82.10 Aligned_cols=84 Identities=10% Similarity=0.114 Sum_probs=66.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|+++||+|.+.++++++++++++|+++.+|....+.++++..++.+++++.| ++.++..++ +.+.+++++. T Consensus 242 ~~D~vid~~G~~~~~~~~~~~l~~~G~iv~vG~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~l~~~g~ 315 (375) T PLN02178 242 TMDFIIDTVSAEHALLPLFSLLKVSGKLVALGLPEKPLDLPIFPLVLGRKMVGG------SQIGGMKETQEMLEFCAKHK 315 (375) T ss_pred CCcEEEECCCcHHHHHHHHHhhcCCCEEEEEccCCCCCccCHHHHHhCCeEEEE------eCccCHHHHHHHHHHHHhCC Confidence 689999999998889999999999999999998766667888888899999996 443334444 6678888886 Q ss_pred Ccceeeeeceee Q 034260 83 PKLIQATLFDLF 94 (100) Q Consensus 83 ~~~i~~~~~~~~ 94 (100) .+... +.+||+ T Consensus 316 i~~~i-~~~~l~ 326 (375) T PLN02178 316 IVSDI-ELIKMS 326 (375) T ss_pred CcccE-EEEeHH Confidence 55444 347765 No 11 >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also know as glutathione-dependent formaldehyde dehyd Probab=99.09 E-value=7.1e-10 Score=81.18 Aligned_cols=90 Identities=17% Similarity=0.134 Sum_probs=66.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) +++|++|||+|.+.+++.++++++++|+++.+|.... ..+++...++.|++++.|++. +++....+..+.+.++++ T Consensus 258 ~g~d~vid~~G~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~--~~~~~~~~~~~~~~l~~~ 335 (371) T cd08281 258 GGVDYAFEMAGSVPALETAYEITRRGGTTVTAGLPDPEARLSVPALSLVAEERTLKGSYM--GSCVPRRDIPRYLALYLS 335 (371) T ss_pred CCCCEEEECCCChHHHHHHHHHHhcCCEEEEEccCCCCceeeecHHHHhhcCCEEEEEec--CCCChHHHHHHHHHHHHc Confidence 3799999999998899999999999999999998753 356777888999999997653 222112233366778887 Q ss_pred CCC--cceeeeeceee Q 034260 81 QTP--KLIQATLFDLF 94 (100) Q Consensus 81 ~~~--~~i~~~~~~~~ 94 (100) +.. +.+.+..++|+ T Consensus 336 g~i~~~~~i~~~~~l~ 351 (371) T cd08281 336 GRLPVDKLLTHRLPLD 351 (371) T ss_pred CCCCchhheeeeecHH Confidence 753 33445667765 No 12 >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Probab=99.09 E-value=3.4e-10 Score=82.71 Aligned_cols=88 Identities=17% Similarity=0.187 Sum_probs=65.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC--cccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD--MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~--~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) +|+|++|||+|...++++++++++++|+.+++|++... +++++..++.. ++++||++ |+.....+.++-+.+--+ T Consensus 253 gG~d~~~e~~G~~~~~~~al~~~~~~G~~v~iGv~~~~~~i~~~~~~lv~g-r~~~Gs~~--G~~~p~~diP~lv~~y~~ 329 (366) T COG1062 253 GGADYAFECVGNVEVMRQALEATHRGGTSVIIGVAGAGQEISTRPFQLVTG-RVWKGSAF--GGARPRSDIPRLVDLYMA 329 (366) T ss_pred CCCCEEEEccCCHHHHHHHHHHHhcCCeEEEEecCCCCceeecChHHeecc-ceEEEEee--cCCccccchhHHHHHHHc Confidence 48999999999999999999999999999999999864 44566666555 99999997 877664333344444333 Q ss_pred C---CCcceeeeeceee Q 034260 81 Q---TPKLIQATLFDLF 94 (100) Q Consensus 81 ~---~~~~i~~~~~~~~ 94 (100) + ..++|+ ++++|+ T Consensus 330 Gkl~~d~lvt-~~~~Le 345 (366) T COG1062 330 GKLPLDRLVT-HTIPLE 345 (366) T ss_pred CCCchhHHhh-ccccHH Confidence 3 266666 445543 No 13 >cd08230 glucose_DH Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contai Probab=99.06 E-value=7.9e-10 Score=80.35 Aligned_cols=86 Identities=12% Similarity=0.024 Sum_probs=62.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccC----hHHHHhcCcEEEeEeeceeeeeechhhH-HHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVP----LTPAAARYLIYGFLFFFFLVLGYSVIYF-RKM 75 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~----~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i 75 (100) .++|++|||+|.+.++++++++++++|+++++|...+ +.+++ ...++.|++++.| ++..+++++ +++ T Consensus 237 ~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~G~~~~~~~~~~~~~~~~~~~~~k~~~i~g------~~~~~~~~~~~~~ 310 (355) T cd08230 237 GEFDLIIEATGVPPLAFEALPALAPNGVVILFGVPGGGREFEVDGGELNRDLVLGNKALVG------SVNANKRHFEQAV 310 (355) T ss_pred CCCCEEEECcCCHHHHHHHHHHccCCcEEEEEecCCCCCccccChhhhhhhHhhcCcEEEE------ecCCchhhHHHHH Confidence 4689999999998899999999999999999998765 34555 3567889999995 444434444 556 Q ss_pred HHHhcCC------Ccceeeeeceee Q 034260 76 LYISGQT------PKLIQATLFDLF 94 (100) Q Consensus 76 ~~l~~~~------~~~i~~~~~~~~ 94 (100) .++.++. .+.+.++.|+|+ T Consensus 311 ~~l~~~~~~~~~~~~~~i~~~~~l~ 335 (355) T cd08230 311 EDLAQWKYRWPGVLERLITRRVPLE 335 (355) T ss_pred HHHHhcccccccchHHheeeeecHH Confidence 6766543 233344666654 No 14 >PLN02514 cinnamyl-alcohol dehydrogenase Probab=99.06 E-value=1.4e-09 Score=79.47 Aligned_cols=85 Identities=8% Similarity=0.029 Sum_probs=66.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|+++||+|.+.++++++++++++|+++.+|....+.+++...++.+++++.| ++..+..++ +.+.+++++. T Consensus 244 ~~D~vid~~g~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~~~~g~ 317 (357) T PLN02514 244 SLDYIIDTVPVFHPLEPYLSLLKLDGKLILMGVINTPLQFVTPMLMLGRKVITG------SFIGSMKETEEMLEFCKEKG 317 (357) T ss_pred CCcEEEECCCchHHHHHHHHHhccCCEEEEECCCCCCCcccHHHHhhCCcEEEE------EecCCHHHHHHHHHHHHhCC Confidence 689999999988899999999999999999998766667888888899999996 444444444 6677788776 Q ss_pred Ccceeeeeceeee Q 034260 83 PKLIQATLFDLFF 95 (100) Q Consensus 83 ~~~i~~~~~~~~~ 95 (100) .+.+.+ .|+|+. T Consensus 318 l~~~i~-~~~l~~ 329 (357) T PLN02514 318 LTSMIE-VVKMDY 329 (357) T ss_pred CcCcEE-EEcHHH Confidence 555554 577753 No 15 >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA. Probab=99.04 E-value=1.9e-09 Score=78.29 Aligned_cols=85 Identities=14% Similarity=0.073 Sum_probs=64.5 Q ss_pred Cccc----EEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHH Q 034260 3 AGID----VSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLY 77 (100) Q Consensus 3 ~G~D----~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~ 77 (100) +|+| +++||+|.+.++++++++++++|+++++|....+.++++..++.+++++.| ++.++.+++ +.+.+ T Consensus 236 ~g~d~~~d~v~d~~g~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~g------~~~~~~~~~~~~~~~ 309 (349) T TIGR03201 236 RGLRSTGWKIFECSGSKPGQESALSLLSHGGTLVVVGYTMAKTEYRLSNLMAFHARALG------NWGCPPDRYPAALDL 309 (349) T ss_pred CCCCCCcCEEEECCCChHHHHHHHHHHhcCCeEEEECcCCCCcccCHHHHhhcccEEEE------EecCCHHHHHHHHHH Confidence 4565 899999998899999999999999999998876667777788888999985 444444445 56778 Q ss_pred HhcCCC--cceeeeeceee Q 034260 78 ISGQTP--KLIQATLFDLF 94 (100) Q Consensus 78 l~~~~~--~~i~~~~~~~~ 94 (100) ++++.. +.+.+ .++|+ T Consensus 310 i~~g~i~~~~~i~-~~~l~ 327 (349) T TIGR03201 310 VLDGKIQLGPFVE-RRPLD 327 (349) T ss_pred HHcCCCCcccceE-EecHH Confidence 887743 32334 46775 No 16 >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Probab=99.04 E-value=1.5e-09 Score=79.52 Aligned_cols=82 Identities=18% Similarity=0.120 Sum_probs=64.4 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CC-cccChHHHHhcCcEEEeEeeceeeeeechhhHHH-HHHHhcC Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRK-MLYISGQ 81 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~-i~~l~~~ 81 (100) +|+++||++ +.++++++++++++|+++++|.+. .+ .+++...++.++++|.| |...++.+.++ +++.+++ T Consensus 230 ~d~ii~tv~-~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~G------S~~g~~~d~~e~l~f~~~g 302 (339) T COG1064 230 ADAIIDTVG-PATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVG------SLVGTRADLEEALDFAAEG 302 (339) T ss_pred CcEEEECCC-hhhHHHHHHHHhcCCEEEEECCCCCcccCCCCHHHhhhcCeEEEE------EecCCHHHHHHHHHHHHhC Confidence 899999999 899999999999999999999995 44 55888899999999995 55555677755 5666677 Q ss_pred CCcceeeeecee Q 034260 82 TPKLIQATLFDL 93 (100) Q Consensus 82 ~~~~i~~~~~~~ 93 (100) .-|......+++ T Consensus 303 ~Ikp~i~e~~~l 314 (339) T COG1064 303 KIKPEILETIPL 314 (339) T ss_pred CceeeEEeeECH Confidence 655544334443 No 17 >PLN02586 probable cinnamyl alcohol dehydrogenase Probab=99.03 E-value=2e-09 Score=78.80 Aligned_cols=84 Identities=11% Similarity=0.103 Sum_probs=65.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|++|||+|.+.++++++++++++|+++.+|....+.++++..++.+++++.| ++.++..++ +.+.+++++. T Consensus 247 ~~D~vid~~g~~~~~~~~~~~l~~~G~iv~vG~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~li~~g~ 320 (360) T PLN02586 247 TMDYIIDTVSAVHALGPLLGLLKVNGKLITLGLPEKPLELPIFPLVLGRKLVGG------SDIGGIKETQEMLDFCAKHN 320 (360) T ss_pred CCCEEEECCCCHHHHHHHHHHhcCCcEEEEeCCCCCCCccCHHHHHhCCeEEEE------cCcCCHHHHHHHHHHHHhCC Confidence 589999999988899999999999999999998766667888888889999885 433334444 6677888876 Q ss_pred Ccceeeeeceee Q 034260 83 PKLIQATLFDLF 94 (100) Q Consensus 83 ~~~i~~~~~~~~ 94 (100) .+... +.++|+ T Consensus 321 i~~~~-~~~~l~ 331 (360) T PLN02586 321 ITADI-ELIRMD 331 (360) T ss_pred CCCcE-EEEeHH Confidence 44433 357765 No 18 >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Probab=98.99 E-value=3.8e-09 Score=76.43 Aligned_cols=89 Identities=15% Similarity=0.166 Sum_probs=63.0 Q ss_pred Cccc-EEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccC---hHHHHhcCcEEEeEeeceeeee-echhhH-HHHH Q 034260 3 AGID-VSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVP---LTPAAARYLIYGFLFFFFLVLG-YSVIYF-RKML 76 (100) Q Consensus 3 ~G~D-~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~---~~~l~~k~~~i~Gs~~~~g~~~-~~~~~~-~~i~ 76 (100) +++| ++|||+|.+.++++++++++++|+++++|....+.+++ +..++.|++++.|+++ +... ++++++ +.+. T Consensus 227 ~~~d~~v~d~~G~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~~i~g~~~--~~~~~~~~~~~~~~~~ 304 (347) T PRK10309 227 LRFDQLILETAGVPQTVELAIEIAGPRAQLALVGTLHHDLHLTSATFGKILRKELTVIGSWM--NYSSPWPGQEWETASR 304 (347) T ss_pred CCCCeEEEECCCCHHHHHHHHHHhhcCCEEEEEccCCCCcccChhhhhHHhhcCcEEEEEec--cccCCcchhHHHHHHH Confidence 4677 99999999889999999999999999999876544443 3467889999997653 2111 123444 5567 Q ss_pred HHhcCCC---cceeeeeceee Q 034260 77 YISGQTP---KLIQATLFDLF 94 (100) Q Consensus 77 ~l~~~~~---~~i~~~~~~~~ 94 (100) ++.++.. ++|+ +.++|+ T Consensus 305 ~~~~g~i~~~~~i~-~~~~l~ 324 (347) T PRK10309 305 LLTERKLSLEPLIA-HRGSFE 324 (347) T ss_pred HHHcCCCCchhheE-EEeeHH Confidence 7777642 4454 666765 No 19 >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent. Members of this family represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols, a family that also includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this protein family have a tightly bound NAD that can act as a true cofactor, rather than a cosubstrate in dehydrogenase reactions, in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent. Probab=98.98 E-value=2.1e-09 Score=79.82 Aligned_cols=87 Identities=17% Similarity=0.237 Sum_probs=61.8 Q ss_pred CcccEEEEccChH--------------HHHHHHHHhccCCCEEEEecCCC-C-Cc-----------ccChHHHHhcCcEE Q 034260 3 AGIDVSFDCAGLN--------------KTMSTVLDATRAGDKVCLVGMGH-H-DM-----------TVPLTPAAARYLIY 55 (100) Q Consensus 3 ~G~D~vie~~G~~--------------~~~~~al~~l~~gGrvv~vG~~~-~-~~-----------~i~~~~l~~k~~~i 55 (100) +++|++|||+|.+ .++++++++++++|+++++|++. . +. ++....++.+++++ T Consensus 253 ~g~Dvvid~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~i~~~G~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~i 332 (393) T TIGR02819 253 PEVDCAVDCVGFEARGHGHDGKKEAPATVLNSLMEVTRVGGAIGIPGLYVTEDPGAVDAAAKTGSLSIRFGLGWAKSHSF 332 (393) T ss_pred CCCcEEEECCCCccccccccccccchHHHHHHHHHHhhCCCEEEEeeecCCcccccccccccccccccchHHhhccCceE Confidence 5799999999986 48999999999999999999973 2 21 23344556777787 Q ss_pred EeEeeceeeeeechhhH-HHHHHHhcCCC---cceeeeeceeee Q 034260 56 GFLFFFFLVLGYSVIYF-RKMLYISGQTP---KLIQATLFDLFF 95 (100) Q Consensus 56 ~Gs~~~~g~~~~~~~~~-~~i~~l~~~~~---~~i~~~~~~~~~ 95 (100) .| +.....+++ +.+.+++++.. ++|+|+.|||+. T Consensus 333 ~g------~~~~~~~~~~~~~~~~~~g~i~~~~~i~~~~~~l~~ 370 (393) T TIGR02819 333 HT------GQTPVMKYNRNLMQAILHDRVQIAKAVNVTVISLDD 370 (393) T ss_pred Ee------ccCChhhhHHHHHHHHHcCCCCHHHceecceecHHH Confidence 74 322222343 56778887752 567778888763 No 20 >PLN02740 Alcohol dehydrogenase-like Probab=98.96 E-value=4.1e-09 Score=77.54 Aligned_cols=89 Identities=13% Similarity=0.032 Sum_probs=61.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCCC--cccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHHD--MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~~--~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) ++|+++||+|.+.++++++++++++ |+++++|....+ ++++...+ .++++|.|+++ +++....+..+.+.++.+ T Consensus 268 g~dvvid~~G~~~~~~~a~~~~~~g~G~~v~~G~~~~~~~~~~~~~~~-~~~~~i~g~~~--~~~~~~~~~~~~~~~~~~ 344 (381) T PLN02740 268 GVDYSFECAGNVEVLREAFLSTHDGWGLTVLLGIHPTPKMLPLHPMEL-FDGRSITGSVF--GDFKGKSQLPNLAKQCMQ 344 (381) T ss_pred CCCEEEECCCChHHHHHHHHhhhcCCCEEEEEccCCCCceecccHHHH-hcCCeEEEEec--CCCCcHHHHHHHHHHHHc Confidence 7999999999988999999999997 999999987653 33443333 47899997653 333222223355677777 Q ss_pred CCC--cceeeeeceeee Q 034260 81 QTP--KLIQATLFDLFF 95 (100) Q Consensus 81 ~~~--~~i~~~~~~~~~ 95 (100) +.. +.+.++.++|+. T Consensus 345 g~i~~~~~it~~~~l~e 361 (381) T PLN02740 345 GVVNLDGFITHELPFEK 361 (381) T ss_pred CCCChHHheeEEecHHH Confidence 643 323446777753 No 21 >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate). The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the found Probab=98.95 E-value=5.6e-09 Score=77.61 Aligned_cols=87 Identities=9% Similarity=0.005 Sum_probs=64.1 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-C--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-H--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLY 77 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~ 77 (100) |+|+|+++||+|.+.++++++++++++|++++++... . +.++++..++.+++++.| ++.....++ +.+.+ T Consensus 255 g~g~D~vid~~g~~~~~~~a~~~l~~~G~~v~~~g~~~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~l 328 (410) T cd08238 255 GQGFDDVFVFVPVPELVEEADTLLAPDGCLNFFAGPVDKNFSAPLNFYNVHYNNTHYVG------TSGGNTDDMKEAIDL 328 (410) T ss_pred CCCCCEEEEcCCCHHHHHHHHHHhccCCeEEEEEccCCCCccccccHHHhhhcCcEEEE------eCCCCHHHHHHHHHH Confidence 3579999999998899999999999999988775432 2 356777888999999995 444444444 66778 Q ss_pred HhcCC--Ccceeeeeceee Q 034260 78 ISGQT--PKLIQATLFDLF 94 (100) Q Consensus 78 l~~~~--~~~i~~~~~~~~ 94 (100) ++++. ++.+.++.++|+ T Consensus 329 i~~g~i~~~~~it~~~~l~ 347 (410) T cd08238 329 MAAGKLNPARMVTHIGGLN 347 (410) T ss_pred HHcCCCchhhcEEEEecHH Confidence 88775 332444667764 No 22 >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc at Probab=98.90 E-value=1.6e-08 Score=72.83 Aligned_cols=85 Identities=21% Similarity=0.246 Sum_probs=62.0 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccCh-HHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPL-TPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~-~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|++|||+|.+..+++++++++++|+++++|..... +++. ..++.+++++.| ++.++.+++ +.++++.+ T Consensus 230 ~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~-~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~~~~ 302 (339) T cd08239 230 AGADVAIECSGNTAARRLALEAVRPWGRLVLVGEGGEL-TIEVSNDLIRKQRTLIG------SWYFSVPDMEECAEFLAR 302 (339) T ss_pred CCCCEEEECCCCHHHHHHHHHHhhcCCEEEEEcCCCCc-ccCcHHHHHhCCCEEEE------EecCCHHHHHHHHHHHHc Confidence 47999999999988889999999999999999986542 3443 457789999995 444444445 56677877 Q ss_pred CCC--cceeeeeceee Q 034260 81 QTP--KLIQATLFDLF 94 (100) Q Consensus 81 ~~~--~~i~~~~~~~~ 94 (100) +.. +.+.+..++|+ T Consensus 303 g~i~~~~~i~~~~~l~ 318 (339) T cd08239 303 HKLEVDRLVTHRFGLD 318 (339) T ss_pred CCCChhHeEEEEecHH Confidence 642 23334556664 No 23 >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Probab=98.90 E-value=1.4e-08 Score=73.48 Aligned_cols=86 Identities=21% Similarity=0.280 Sum_probs=65.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|.+.++++++++++++|+++.+|....+.++++..+..++++|.| .+.+..+++ +.+.++.++ T Consensus 240 ~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~~~~g 313 (351) T cd08233 240 GGVDVSFDCAGVQATLDTAIDALRPRGTAVNVAIWEKPISFNPNDLVLKEKTLTG------SICYTREDFEEVIDLLASG 313 (351) T ss_pred CCCCEEEECCCCHHHHHHHHHhccCCCEEEEEccCCCCCccCHHHHHhhCcEEEE------EeccCcchHHHHHHHHHcC Confidence 4699999999987899999999999999999998776677888888899999995 444433445 556677776 Q ss_pred CC--cceeeeeceee Q 034260 82 TP--KLIQATLFDLF 94 (100) Q Consensus 82 ~~--~~i~~~~~~~~ 94 (100) .. +.+.+..++++ T Consensus 314 ~l~~~~~i~~~~~l~ 328 (351) T cd08233 314 KIDAEPLITSRIPLE 328 (351) T ss_pred CCChHHheEEEecHH Confidence 53 33344556664 No 24 >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized. Probab=98.87 E-value=1.9e-08 Score=72.80 Aligned_cols=85 Identities=9% Similarity=-0.004 Sum_probs=66.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) ++|+++|++|...+++.++++++++|+++++|.... ..++++..++.+++++.| ++...+.++ +.+.+++++ T Consensus 223 ~~d~~i~~~~~~~~~~~~~~~l~~~G~~v~~G~~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~l~~~g 296 (329) T TIGR02822 223 PLDAAILFAPAGGLVPPALEALDRGGVLAVAGIHLTDTPPLNYQRHLFYERQIRS------VTSNTRADAREFLELAAQH 296 (329) T ss_pred cceEEEECCCcHHHHHHHHHhhCCCcEEEEEeccCccCCCCCHHHHhhCCcEEEE------eecCCHHHHHHHHHHHHhC Confidence 579999999998999999999999999999998643 345777778889999995 444444444 556788888 Q ss_pred CCcceeeeeceeee Q 034260 82 TPKLIQATLFDLFF 95 (100) Q Consensus 82 ~~~~i~~~~~~~~~ 95 (100) ..++++ +.|+|+. T Consensus 297 ~i~~i~-~~~~l~~ 309 (329) T TIGR02822 297 GVRVTT-HTYPLSE 309 (329) T ss_pred CCeeEE-EEEeHHH Confidence 877775 5678753 No 25 >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Probab=98.77 E-value=3.2e-08 Score=72.05 Aligned_cols=88 Identities=17% Similarity=0.206 Sum_probs=64.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCCC--cccChHHHHhcCcEEEeEeeceeeeeechhhHHH-HHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHHD--MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRK-MLY 77 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~~--~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~-i~~ 77 (100) +.|+|+.+||+|+..++++|+++++.| |+-|++|+.... ++++++.+ .++++++|+.+ |.+.. +++.+. +.. T Consensus 260 dgGvDysfEc~G~~~~m~~al~s~h~GwG~sv~iGv~~~~~~i~~~p~~l-~~GR~~~Gs~F--GG~K~-~~~iP~lV~~ 335 (375) T KOG0022|consen 260 DGGVDYSFECIGNVSTMRAALESCHKGWGKSVVIGVAAAGQEISTRPFQL-VTGRTWKGSAF--GGFKS-KSDIPKLVKD 335 (375) T ss_pred cCCceEEEEecCCHHHHHHHHHHhhcCCCeEEEEEecCCCcccccchhhh-ccccEEEEEec--ccccc-hhhhhHHHHH Confidence 468999999999999999999999999 999999998764 45566655 45889999876 77665 444444 443 Q ss_pred -HhcC--CCcceeeeeceee Q 034260 78 -ISGQ--TPKLIQATLFDLF 94 (100) Q Consensus 78 -l~~~--~~~~i~~~~~~~~ 94 (100) +... ..++|. +.+||+ T Consensus 336 y~~~~l~ld~~IT-h~l~f~ 354 (375) T KOG0022|consen 336 YMKKKLNLDEFIT-HELPFE 354 (375) T ss_pred HHhCccchhhhhh-cccCHH Confidence 4443 366666 444543 No 26 >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the Probab=98.77 E-value=5e-08 Score=71.27 Aligned_cols=88 Identities=14% Similarity=0.141 Sum_probs=60.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) +++|+++||+|.+.++.+++++++++ |+++++|.... ++++++..+ .++++++|++. +++. .+.++ +.++++ T Consensus 256 ~~~d~vid~~G~~~~~~~~~~~~~~~~g~~v~~g~~~~~~~~~~~~~~~-~~~~~i~g~~~--~~~~-~~~~~~~~~~~~ 331 (369) T cd08301 256 GGVDYSFECTGNIDAMISAFECVHDGWGVTVLLGVPHKDAVFSTHPMNL-LNGRTLKGTLF--GGYK-PKTDLPNLVEKY 331 (369) T ss_pred CCCCEEEECCCChHHHHHHHHHhhcCCCEEEEECcCCCCcccccCHHHH-hcCCeEEEEec--CCCC-hHHHHHHHHHHH Confidence 37999999999988999999999996 99999998764 344554444 47899997553 2222 22334 556677 Q ss_pred hcCCCc--ceeeeeceee Q 034260 79 SGQTPK--LIQATLFDLF 94 (100) Q Consensus 79 ~~~~~~--~i~~~~~~~~ 94 (100) .++..+ .+.++.++|+ T Consensus 332 ~~g~~~~~~~i~~~~~l~ 349 (369) T cd08301 332 MKKELELEKFITHELPFS 349 (369) T ss_pred HcCCCCcHHheeeeecHH Confidence 776433 2334566764 No 27 >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ i Probab=98.72 E-value=1e-07 Score=69.62 Aligned_cols=88 Identities=18% Similarity=0.236 Sum_probs=60.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) +++|+++||+|.+.++++++++++++ |+++++|...+ ..++++..++. +++++|++. +.+....+..+.+.++++ T Consensus 253 ~g~d~vid~~g~~~~~~~~~~~l~~~~G~~v~~g~~~~~~~~~~~~~~~~-~~~i~g~~~--~~~~~~~~~~~~~~~~~~ 329 (365) T cd08277 253 GGVDYSFECTGNADLMNEALESTKLGWGVSVVVGVPPGAELSIRPFQLIL-GRTWKGSFF--GGFKSRSDVPKLVSKYMN 329 (365) T ss_pred CCCCEEEECCCChHHHHHHHHhcccCCCEEEEEcCCCccccccCHhHHhh-CCEEEeeec--CCCChHHHHHHHHHHHHC Confidence 47999999999888999999999985 99999998753 45666666654 899997553 322211223355667776 Q ss_pred CC--C-cceeeeeceee Q 034260 81 QT--P-KLIQATLFDLF 94 (100) Q Consensus 81 ~~--~-~~i~~~~~~~~ 94 (100) +. . ++++ +.++++ T Consensus 330 ~~~~~~~~i~-~~~~l~ 345 (365) T cd08277 330 KKFDLDELIT-HVLPFE 345 (365) T ss_pred CCcChhHhee-eEEchh Confidence 53 3 3444 556765 No 28 >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols. Probab=98.70 E-value=1.2e-07 Score=69.53 Aligned_cols=89 Identities=13% Similarity=0.104 Sum_probs=59.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) |+|+++||+|.+.++++++++++++ |+++++|.... +.+++...++. +..+.|+.+ ++.....++.+.+.++++ T Consensus 255 g~d~vid~~G~~~~~~~~~~~~~~~~G~~v~~g~~~~~~~~~~~~~~~~~-~~~~~g~~~--~~~~~~~~~~~~~~~~~~ 331 (368) T TIGR02818 255 GVDYSFECIGNVNVMRAALECCHKGWGESIIIGVAGAGQEISTRPFQLVT-GRVWRGSAF--GGVKGRTELPGIVEQYMK 331 (368) T ss_pred CCCEEEECCCCHHHHHHHHHHhhcCCCeEEEEeccCCCCcccccHHHHhc-cceEEEeec--cCCCcHHHHHHHHHHHHC Confidence 7999999999988999999999996 99999998643 34455554443 456776432 221111233466778877 Q ss_pred CC--Ccceeeeeceeee Q 034260 81 QT--PKLIQATLFDLFF 95 (100) Q Consensus 81 ~~--~~~i~~~~~~~~~ 95 (100) +. ++.+.++.++|+. T Consensus 332 g~i~~~~~it~~~~l~~ 348 (368) T TIGR02818 332 GEIALDDFVTHTMPLED 348 (368) T ss_pred CCCCchhheeEEecHHH Confidence 64 3344456777753 No 29 >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dim Probab=98.70 E-value=1.6e-07 Score=68.78 Aligned_cols=88 Identities=16% Similarity=0.163 Sum_probs=59.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCC-CEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) +|+|+++||+|.+.++++++++++++ |+++.+|.... +++++...+. +..++.|+.+ +.+.. ++++ +.+.++ T Consensus 255 ~g~d~vid~~g~~~~~~~a~~~l~~~~G~~v~~g~~~~~~~~~~~~~~~~-~~~~~~g~~~--~~~~~-~~~~~~~~~~~ 330 (368) T cd08300 255 GGVDYTFECIGNVKVMRAALEACHKGWGTSVIIGVAAAGQEISTRPFQLV-TGRVWKGTAF--GGWKS-RSQVPKLVEDY 330 (368) T ss_pred CCCcEEEECCCChHHHHHHHHhhccCCCeEEEEccCCCCCccccCHHHHh-hcCeEEEEEe--cccCc-HHHHHHHHHHH Confidence 37999999999888999999999997 99999998742 3444444443 3457776442 33322 3344 556777 Q ss_pred hcCCCc--ceeeeeceee Q 034260 79 SGQTPK--LIQATLFDLF 94 (100) Q Consensus 79 ~~~~~~--~i~~~~~~~~ 94 (100) .++..+ .+.++.++|+ T Consensus 331 ~~g~l~~~~~i~~~~~le 348 (368) T cd08300 331 MKGKIKVDEFITHTMPLD 348 (368) T ss_pred HcCCCChhhceeeeEcHH Confidence 776433 3445667765 No 30 >PLN03154 putative allyl alcohol dehydrogenase; Provisional Probab=98.69 E-value=1.1e-07 Score=69.44 Aligned_cols=90 Identities=14% Similarity=0.094 Sum_probs=63.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-Cc-----ccChHHHHhcCcEEEeEeeceeeeee-chhhH-H Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DM-----TVPLTPAAARYLIYGFLFFFFLVLGY-SVIYF-R 73 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~-----~i~~~~l~~k~~~i~Gs~~~~g~~~~-~~~~~-~ 73 (100) ++|+|+++||+|. .++++++++++++|+++++|.... +. .++...++.|++++.|++. +.+.. ..+++ + T Consensus 226 ~~gvD~v~d~vG~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~k~~~i~g~~~--~~~~~~~~~~~~~ 302 (348) T PLN03154 226 PEGIDIYFDNVGG-DMLDAALLNMKIHGRIAVCGMVSLNSLSASQGIHNLYNLISKRIRMQGFLQ--SDYLHLFPQFLEN 302 (348) T ss_pred CCCcEEEEECCCH-HHHHHHHHHhccCCEEEEECccccCCCCCCCCcccHHHHhhccceEEEEEH--HHHHHHHHHHHHH Confidence 3479999999997 589999999999999999997653 22 1356678889999996442 11100 12333 4 Q ss_pred HHHHHhcCCCcceeeeeceee Q 034260 74 KMLYISGQTPKLIQATLFDLF 94 (100) Q Consensus 74 ~i~~l~~~~~~~i~~~~~~~~ 94 (100) .+.+++++..+.+.+..++|+ T Consensus 303 ~~~l~~~G~l~~~~~~~~~L~ 323 (348) T PLN03154 303 VSRYYKQGKIVYIEDMSEGLE 323 (348) T ss_pred HHHHHHCCCccCceecccCHH Confidence 456788887776666667764 No 31 >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous Probab=98.64 E-value=3.1e-07 Score=65.63 Aligned_cols=72 Identities=15% Similarity=0.246 Sum_probs=57.2 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeeechhhHH-HHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFR-KMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~-~i~~l~~ 80 (100) +++|+++||+|....++++++.++++|+++.+|... .+..+++..++.|++++.| ++.+++++.+ .+++++. T Consensus 232 ~~vd~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~i~g------~~~~~~~~~~~~~~~~~~ 305 (306) T cd08258 232 DGADVVIECSGAVPALEQALELLRKGGRIVQVGIFGPLAASIDVERIIQKELSVIG------SRSSTPASWETALRLLAS 305 (306) T ss_pred CCCCEEEECCCChHHHHHHHHHhhcCCEEEEEcccCCCCcccCHHHHhhcCcEEEE------EecCchHhHHHHHHHHhc Confidence 579999999987788999999999999999999876 3466788888899999996 4445456664 4555554 No 32 >PRK10083 putative oxidoreductase; Provisional Probab=98.53 E-value=8.1e-07 Score=63.78 Aligned_cols=84 Identities=10% Similarity=0.053 Sum_probs=58.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQTP 83 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~~~ 83 (100) ++|+++||+|.+.++.+++++++++|+++.+|....+.+++...+..+++++.+ +........+.+.++.++.. T Consensus 228 ~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~g~l 301 (339) T PRK10083 228 KPTLIIDAACHPSILEEAVTLASPAARIVLMGFSSEPSEIVQQGITGKELSIFS------SRLNANKFPVVIDWLSKGLI 301 (339) T ss_pred CCCEEEECCCCHHHHHHHHHHhhcCCEEEEEccCCCCceecHHHHhhcceEEEE------EecChhhHHHHHHHHHcCCC Confidence 467999999987899999999999999999998765445555566678888875 32222233356677777654 Q ss_pred cc--eeeeecee Q 034260 84 KL--IQATLFDL 93 (100) Q Consensus 84 ~~--i~~~~~~~ 93 (100) +. +.+..+++ T Consensus 302 ~~~~~~~~~~~l 313 (339) T PRK10083 302 DPEKLITHTFDF 313 (339) T ss_pred ChHHheeeeecH Confidence 43 23355554 No 33 >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases, AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homooligomers of 45-50kDa subunits, each binding one molecule of NAD+. Probab=98.51 E-value=3.3e-07 Score=68.98 Aligned_cols=71 Identities=11% Similarity=0.143 Sum_probs=58.2 Q ss_pred cccEEEEccChHHHHHHH-HHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechh--hH--HHHHHH Q 034260 4 GIDVSFDCAGLNKTMSTV-LDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVI--YF--RKMLYI 78 (100) Q Consensus 4 G~D~vie~~G~~~~~~~a-l~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~--~~--~~i~~l 78 (100) ++|+++||+|.+.+++++ ++++++||+++.+|.. +.++++..+..+++++.| ++.+..+ +. +++.++ T Consensus 257 ~aDVVI~atG~~~~i~~~~l~~mk~GgilvnvG~~--~~eId~~~L~~~el~i~g------~~~~~~~~~~~~g~aI~LL 328 (413) T cd00401 257 EGDIFVTTTGNKDIITGEHFEQMKDGAIVCNIGHF--DVEIDVKGLKENAVEVVN------IKPQVDRYELPDGRRIILL 328 (413) T ss_pred CCCEEEECCCCHHHHHHHHHhcCCCCcEEEEeCCC--CCccCHHHHHhhccEEEE------ccCCcceEEcCCcchhhhh Confidence 589999999999999887 9999999999999965 567899999999999995 5554332 22 578888 Q ss_pred hcCC Q 034260 79 SGQT 82 (100) Q Consensus 79 ~~~~ 82 (100) +++. T Consensus 329 a~Gr 332 (413) T cd00401 329 AEGR 332 (413) T ss_pred hCcC Confidence 8874 No 34 >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Probab=98.49 E-value=1.4e-06 Score=63.54 Aligned_cols=90 Identities=18% Similarity=0.200 Sum_probs=65.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeee--eechhhHH-HHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVL--GYSVIYFR-KML 76 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~--~~~~~~~~-~i~ 76 (100) |+|+|+|+|++|. .++..+++.++++|+++.+|...+ +.+++...+..+.+++.|+.. +.. ....+.+. ... T Consensus 209 g~gvDvv~D~vG~-~~~~~~l~~l~~~G~lv~ig~~~g~~~~~~~~~~~~~~~~~~~g~~~--~~~~~~~~~~~~~~l~~ 285 (326) T COG0604 209 GKGVDVVLDTVGG-DTFAASLAALAPGGRLVSIGALSGGPPVPLNLLPLLGKRLTLRGVTL--GSRDPEALAEALAELFD 285 (326) T ss_pred CCCceEEEECCCH-HHHHHHHHHhccCCEEEEEecCCCCCccccCHHHHhhccEEEEEecc--eecchHHHHHHHHHHHH Confidence 4589999999997 588899999999999999998873 456777777888899887542 211 01123333 345 Q ss_pred HHhcCCCcceeeeeceee Q 034260 77 YISGQTPKLIQATLFDLF 94 (100) Q Consensus 77 ~l~~~~~~~i~~~~~~~~ 94 (100) ++.++..+.+.+..+||. T Consensus 286 ~~~~g~l~~~i~~~~~l~ 303 (326) T COG0604 286 LLASGKLKPVIDRVYPLA 303 (326) T ss_pred HHHcCCCcceeccEechh Confidence 778888777777777764 No 35 >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin Probab=98.49 E-value=9.6e-07 Score=63.25 Aligned_cols=89 Identities=12% Similarity=0.045 Sum_probs=59.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-Cc-ccChHHHHhcCcEEEeEeeceeeee--echhhHHHH-H Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DM-TVPLTPAAARYLIYGFLFFFFLVLG--YSVIYFRKM-L 76 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~-~i~~~~l~~k~~~i~Gs~~~~g~~~--~~~~~~~~i-~ 76 (100) |+++|+++||+|.. ...+++++++++|+++.+|.... +. .++...++.+++++.|++. ..+. ...++.+.+ . T Consensus 210 ~~~~d~vid~~g~~-~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 286 (324) T cd08291 210 KLNATIFFDAVGGG-LTGQILLAMPYGSTLYVYGYLSGKLDEPIDPVDLIFKNKSIEGFWL--TTWLQKLGPEVVKKLKK 286 (324) T ss_pred CCCCcEEEECCCcH-HHHHHHHhhCCCCEEEEEEecCCCCcccCCHHHHhhcCcEEEEEEH--HHhhcccCHHHHHHHHH Confidence 35799999999985 56788999999999999997543 23 3667778889999997553 1111 112334333 4 Q ss_pred HHhcCCCcceeeeeceee Q 034260 77 YISGQTPKLIQATLFDLF 94 (100) Q Consensus 77 ~l~~~~~~~i~~~~~~~~ 94 (100) ++. +..+.+.+++++|+ T Consensus 287 ~~~-~~~~~~i~~~~~l~ 303 (324) T cd08291 287 LVK-TELKTTFASRYPLA 303 (324) T ss_pred HHh-CccccceeeEEcHH Confidence 445 54444444667764 No 36 >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal Probab=98.46 E-value=1.9e-06 Score=62.01 Aligned_cols=84 Identities=11% Similarity=0.040 Sum_probs=62.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|+++||+|....++.++++++++|+++.+|......+++...++.+++++.| .......+. +.+.++..+. T Consensus 228 ~~d~vi~~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~~------~~~~~~~~~~~~~~~~~~~~ 301 (333) T cd08296 228 GAKLILATAPNAKAISALVGGLAPRGKLLILGAAGEPVAVSPLQLIMGRKSIHG------WPSGTALDSEDTLKFSALHG 301 (333) T ss_pred CCCEEEECCCchHHHHHHHHHcccCCEEEEEecCCCCCCcCHHHHhhcccEEEE------eCcCCHHHHHHHHHHHHhCC Confidence 689999999877899999999999999999998776667777778899999995 333333444 4455665555 Q ss_pred Ccceeeeeceee Q 034260 83 PKLIQATLFDLF 94 (100) Q Consensus 83 ~~~i~~~~~~~~ 94 (100) .+.+. +.++++ T Consensus 302 l~~~v-~~~~~~ 312 (333) T cd08296 302 VRPMV-ETFPLE 312 (333) T ss_pred CCceE-EEEEHH Confidence 44443 346654 No 37 >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima, proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quino Probab=98.46 E-value=1.3e-06 Score=63.45 Aligned_cols=74 Identities=20% Similarity=0.262 Sum_probs=55.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) ++++|+++||+|....++.++++++++|+++.+|.... ..+++...++.+++++.| .+.+.+++. +.+.++ T Consensus 247 ~~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~ 320 (361) T cd08231 247 GRGADVVIEASGHPAAVPEGLELLRRGGTYVLVGSVAPAGTVPLDPERIVRKNLTIIG------VHNYDPSHLYRAVRFL 320 (361) T ss_pred CCCCcEEEECCCChHHHHHHHHHhccCCEEEEEcCCCCCCccccCHHHHhhcccEEEE------cccCCchhHHHHHHHH Confidence 35799999999987789999999999999999997653 344565567889999985 433334444 555666 Q ss_pred hcC Q 034260 79 SGQ 81 (100) Q Consensus 79 ~~~ 81 (100) .+. T Consensus 321 ~~~ 323 (361) T cd08231 321 ERT 323 (361) T ss_pred Hhc Confidence 554 No 38 >PLN02702 L-idonate 5-dehydrogenase Probab=98.43 E-value=2.8e-06 Score=61.89 Aligned_cols=75 Identities=59% Similarity=0.880 Sum_probs=56.0 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQ 81 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~ 81 (100) ++++|+++||+|...++++++++++++|+++.+|.......+++..+..+++++.+ .+.+.....+.+.++..+ T Consensus 252 ~~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~~------~~~~~~~~~~~~~~~~~~ 325 (364) T PLN02702 252 GGGIDVSFDCVGFNKTMSTALEATRAGGKVCLVGMGHNEMTVPLTPAAAREVDVVG------VFRYRNTWPLCLEFLRSG 325 (364) T ss_pred CCCCCEEEECCCCHHHHHHHHHHHhcCCEEEEEccCCCCCcccHHHHHhCccEEEE------eccChHHHHHHHHHHHcC Confidence 34799999999987899999999999999999997544445566778889999985 333322333556666665 Q ss_pred C Q 034260 82 T 82 (100) Q Consensus 82 ~ 82 (100) . T Consensus 326 ~ 326 (364) T PLN02702 326 K 326 (364) T ss_pred C Confidence 4 No 39 >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall Probab=98.40 E-value=2.2e-06 Score=62.72 Aligned_cols=77 Identities=19% Similarity=0.191 Sum_probs=56.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhcc-CCCEEEEecCCC--CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATR-AGDKVCLVGMGH--HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLY 77 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~-~gGrvv~vG~~~--~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~ 77 (100) ++++|+++||+|...+++.++++++ ++|+++.+|... ....++...+ .++.+++|++. +++.. .+.+ +.+.+ T Consensus 251 ~~~~d~vid~~g~~~~~~~~~~~l~~~~G~~v~~g~~~~~~~~~~~~~~~-~~~~~l~g~~~--~~~~~-~~~~~~~~~l 326 (365) T cd05279 251 DGGVDYAFEVIGSADTLKQALDATRLGGGTSVVVGVPPSGTEATLDPNDL-LTGRTIKGTVF--GGWKS-KDSVPKLVAL 326 (365) T ss_pred CCCCcEEEECCCCHHHHHHHHHHhccCCCEEEEEecCCCCCceeeCHHHH-hcCCeEEEEec--cCCch-HhHHHHHHHH Confidence 4579999999998789999999999 999999999764 3566777677 78889986542 22222 3334 55566 Q ss_pred HhcCC Q 034260 78 ISGQT 82 (100) Q Consensus 78 l~~~~ 82 (100) +..+. T Consensus 327 ~~~~~ 331 (365) T cd05279 327 YRQKK 331 (365) T ss_pred HHcCC Confidence 76664 No 40 >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Probab=98.39 E-value=2e-06 Score=62.27 Aligned_cols=87 Identities=16% Similarity=0.145 Sum_probs=60.1 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC--cccCh--HHHHhcCcEEEeEeeceeeeee-chhhH-HHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD--MTVPL--TPAAARYLIYGFLFFFFLVLGY-SVIYF-RKM 75 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~--~~i~~--~~l~~k~~~i~Gs~~~~g~~~~-~~~~~-~~i 75 (100) |+++|+++||+|.+..+.+++++++++|+++.+|..... ..++. .....+.+++.+ .... .++++ +.+ T Consensus 233 ~~~~d~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~i~~------~~~~~~~~~~~~~~ 306 (351) T cd08285 233 GKGVDAVIIAGGGQDTFEQALKVLKPGGTISNVNYYGEDDYLPIPREEWGVGMGHKTING------GLCPGGRLRMERLA 306 (351) T ss_pred CCCCcEEEECCCCHHHHHHHHHHhhcCCEEEEecccCCCceeecChhhhhhhccccEEEE------eecCCccccHHHHH Confidence 357999999999888899999999999999999987643 23332 223456777774 3222 23445 567 Q ss_pred HHHhcCCCcc---eeeeeceee Q 034260 76 LYISGQTPKL---IQATLFDLF 94 (100) Q Consensus 76 ~~l~~~~~~~---i~~~~~~~~ 94 (100) .+++++..+. +.+..++++ T Consensus 307 ~~~~~g~i~~~~~~~~~~~~l~ 328 (351) T cd08285 307 SLIEYGRVDPSKLLTHHFFGFD 328 (351) T ss_pred HHHHcCCCChhhceeccccCHH Confidence 7888876444 665556654 No 41 >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzy Probab=98.38 E-value=3.4e-06 Score=60.91 Aligned_cols=84 Identities=25% Similarity=0.188 Sum_probs=60.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|+++||+|.+.+++.++++++++|+++.+|.......++...+..+++++.+ ......++. +.+.++.++. T Consensus 243 ~~d~vid~~g~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~i~~------~~~~~~~~~~~~~~ll~~~~ 316 (350) T cd08240 243 GVDAVIDFVNNSATASLAFDILAKGGKLVLVGLFGGEATLPLPLLPLRALTIQG------SYVGSLEELRELVALAKAGK 316 (350) T ss_pred CCcEEEECCCCHHHHHHHHHHhhcCCeEEEECCCCCCCcccHHHHhhcCcEEEE------cccCCHHHHHHHHHHHHcCC Confidence 799999999987899999999999999999998765444555556678999984 443334444 5566777775 Q ss_pred Ccceeeeecee Q 034260 83 PKLIQATLFDL 93 (100) Q Consensus 83 ~~~i~~~~~~~ 93 (100) .+.+....+++ T Consensus 317 i~~~~~~~~~~ 327 (350) T cd08240 317 LKPIPLTERPL 327 (350) T ss_pred CccceeeEEcH Confidence 44444344544 No 42 >cd08246 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA production for straight-chain fatty acid biosynthesis. Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossma Probab=98.37 E-value=3e-06 Score=62.41 Aligned_cols=84 Identities=13% Similarity=-0.060 Sum_probs=60.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) ++|+++||+|. ..+++++++++++|+++.+|.... ..+++...+..++.++.| ++.+..++. +.+.++.++ T Consensus 285 g~d~vid~~g~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~l~~~~~~i~g------~~~~~~~~~~~~~~~~~~~ 357 (393) T cd08246 285 DPDIVFEHPGR-ATFPTSVFVCDRGGMVVICAGTTGYNHTYDNRYLWMRQKRIQG------SHFANDREAAEANRLVMKG 357 (393) T ss_pred CCeEEEECCch-HhHHHHHHHhccCCEEEEEcccCCCCCCCcHHHHhhheeEEEe------cccCcHHHHHHHHHHHHcC Confidence 79999999997 679999999999999999997543 345677777788999985 434434444 555667666 Q ss_pred CCcceeeeeceee Q 034260 82 TPKLIQATLFDLF 94 (100) Q Consensus 82 ~~~~i~~~~~~~~ 94 (100) ..+.+.+..+++. T Consensus 358 ~l~~~~~~~~~l~ 370 (393) T cd08246 358 RIDPCLSKVFSLD 370 (393) T ss_pred CceeeeeEEEeHH Confidence 5433344455543 No 43 >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers ( Probab=98.33 E-value=7.1e-06 Score=59.08 Aligned_cols=73 Identities=15% Similarity=0.170 Sum_probs=55.2 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|....++.+++.++++|+++.+|......++++..++.+++++.+ .... .+.. +.++++.++ T Consensus 234 ~~~d~vld~~g~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~-~~~~~~~~~~~~~~ 306 (345) T cd08286 234 RGVDVVIEAVGIPATFELCQELVAPGGHIANVGVHGKPVDLHLEKLWIKNITITT------GLVD-TNTTPMLLKLVSSG 306 (345) T ss_pred CCCCEEEECCCCHHHHHHHHHhccCCcEEEEecccCCCCCcCHHHHhhcCcEEEe------ecCc-hhhHHHHHHHHHcC Confidence 4799999999988889999999999999999997665566777777789999984 2211 1233 445666666 Q ss_pred C Q 034260 82 T 82 (100) Q Consensus 82 ~ 82 (100) . T Consensus 307 ~ 307 (345) T cd08286 307 K 307 (345) T ss_pred C Confidence 4 No 44 >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, Probab=98.33 E-value=4.8e-06 Score=60.24 Aligned_cols=85 Identities=15% Similarity=0.037 Sum_probs=58.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHH-HhcCcEEEeEeeceeeeeechhhHHHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPA-AARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l-~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~ 81 (100) +++|+++||+|...++.+++++++++|+++.+|......+++...+ ..+++++.|+. .......+.+.++.++ T Consensus 242 ~~vdvvld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~i~~~~------~~~~~~~~~~~~~~~g 315 (350) T cd08256 242 YGCDIYIEATGHPSAVEQGLNMIRKLGRFVEFSVFGDPVTVDWSIIGDRKELDVLGSH------LGPYCYPIAIDLIASG 315 (350) T ss_pred CCCCEEEECCCChHHHHHHHHHhhcCCEEEEEccCCCCCccChhHhhcccccEEEEec------cCchhHHHHHHHHHcC Confidence 4799999999977789999999999999999997665555555444 35788888532 2222333556677776 Q ss_pred CCcc--eeeeecee Q 034260 82 TPKL--IQATLFDL 93 (100) Q Consensus 82 ~~~~--i~~~~~~~ 93 (100) ..+. +....+++ T Consensus 316 ~l~~~~~~~~~~~l 329 (350) T cd08256 316 RLPTDGIVTHQFPL 329 (350) T ss_pred CCChhHheEEEeEH Confidence 5443 24455554 No 45 >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Probab=98.32 E-value=1.6e-06 Score=66.86 Aligned_cols=74 Identities=9% Similarity=0.049 Sum_probs=55.9 Q ss_pred CcccEEEEccChH-----HHH-HHHHHhccCCCEEEEecCC-CCC--cccChHHHHh-cCcEEEeEeeceeeeeechhhH Q 034260 3 AGIDVSFDCAGLN-----KTM-STVLDATRAGDKVCLVGMG-HHD--MTVPLTPAAA-RYLIYGFLFFFFLVLGYSVIYF 72 (100) Q Consensus 3 ~G~D~vie~~G~~-----~~~-~~al~~l~~gGrvv~vG~~-~~~--~~i~~~~l~~-k~~~i~Gs~~~~g~~~~~~~~~ 72 (100) +++|++|||+|.+ ..+ +++++.+++||+++.+|.. ++. .+++...++. +++++.| ..+++.+++ T Consensus 247 ~gaDVVIetag~pg~~aP~lit~~~v~~mkpGgvIVdvg~~~GG~~e~t~~~~~v~~~~gVti~G------v~n~P~~~p 320 (509) T PRK09424 247 KEVDIIITTALIPGKPAPKLITAEMVASMKPGSVIVDLAAENGGNCELTVPGEVVVTDNGVTIIG------YTDLPSRLP 320 (509) T ss_pred CCCCEEEECCCCCcccCcchHHHHHHHhcCCCCEEEEEccCCCCCcccccCccceEeECCEEEEE------eCCCchhHH Confidence 4799999999974 364 9999999999999999985 343 4555566665 8999994 666655555 Q ss_pred -HHHHHHhcCC Q 034260 73 -RKMLYISGQT 82 (100) Q Consensus 73 -~~i~~l~~~~ 82 (100) ++..+++++. T Consensus 321 ~~As~lla~~~ 331 (509) T PRK09424 321 TQSSQLYGTNL 331 (509) T ss_pred HHHHHHHHhCC Confidence 4677777663 No 46 >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentatio Probab=98.32 E-value=6.9e-06 Score=58.52 Aligned_cols=77 Identities=27% Similarity=0.375 Sum_probs=58.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) ++++|+++||+|....+++++++++++|+++.+|.......++...+..++.++.| ++....+.. ..+.++.+ T Consensus 230 ~~~~D~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~ll~~ 303 (338) T cd08254 230 GGGFDVIFDFVGTQPTFEDAQKAVKPGGRIVVVGLGRDKLTVDLSDLIARELRIIG------SFGGTPEDLPEVLDLIAK 303 (338) T ss_pred CCCceEEEECCCCHHHHHHHHHHhhcCCEEEEECCCCCCCccCHHHHhhCccEEEE------eccCCHHHHHHHHHHHHc Confidence 35799999999988899999999999999999998765556677778888999985 333334444 44566666 Q ss_pred CCCc Q 034260 81 QTPK 84 (100) Q Consensus 81 ~~~~ 84 (100) +..+ T Consensus 304 ~~l~ 307 (338) T cd08254 304 GKLD 307 (338) T ss_pred CCCc Confidence 6433 No 47 >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reducta Probab=98.32 E-value=5.3e-06 Score=59.08 Aligned_cols=85 Identities=15% Similarity=0.119 Sum_probs=61.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQ 81 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~ 81 (100) ++++|+++||+|...+++.++++++++|+++..|.......++...+..++.++.| ++.. ...+.+.++.++ T Consensus 212 ~~~~d~vid~~g~~~~~~~~~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~i~~------~~~~--~~~~~~~~~~~~ 283 (319) T cd08242 212 GGGFDVVVEATGSPSGLELALRLVRPRGTVVLKSTYAGPASFDLTKAVVNEITLVG------SRCG--PFAPALRLLRKG 283 (319) T ss_pred CCCCCEEEECCCChHHHHHHHHHhhcCCEEEEEcccCCCCccCHHHheecceEEEE------Eecc--cHHHHHHHHHcC Confidence 35799999999987889999999999999999887665666777777888999985 3322 233556667666 Q ss_pred CC--cceeeeeceee Q 034260 82 TP--KLIQATLFDLF 94 (100) Q Consensus 82 ~~--~~i~~~~~~~~ 94 (100) .. ..+....++++ T Consensus 284 ~l~~~~~~~~~~~l~ 298 (319) T cd08242 284 LVDVDPLITAVYPLE 298 (319) T ss_pred CCChhhceEEEEeHH Confidence 43 23344566654 No 48 >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic Probab=98.31 E-value=5.6e-06 Score=59.67 Aligned_cols=85 Identities=14% Similarity=0.119 Sum_probs=61.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) ++++|+++||+|...++++++++++++|+++.+|......++++..++.+++++.|+ .....+++ +.+.++.+ T Consensus 230 ~~~~d~v~~~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~~~------~~~~~~~~~~~~~~~~~ 303 (337) T cd05283 230 AGSLDLIIDTVSASHDLDPYLSLLKPGGTLVLVGAPEEPLPVPPFPLIFGRKSVAGS------LIGGRKETQEMLDFAAE 303 (337) T ss_pred cCCceEEEECCCCcchHHHHHHHhcCCCEEEEEeccCCCCccCHHHHhcCceEEEEe------cccCHHHHHHHHHHHHh Confidence 457999999999876799999999999999999987655567777778899999963 33334445 44556666 Q ss_pred CCCcceeeeecee Q 034260 81 QTPKLIQATLFDL 93 (100) Q Consensus 81 ~~~~~i~~~~~~~ 93 (100) +..+.+. +.+++ T Consensus 304 ~~l~~~~-~~~~~ 315 (337) T cd05283 304 HGIKPWV-EVIPM 315 (337) T ss_pred CCCccce-EEEEH Confidence 6443333 34443 No 49 >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family. The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Probab=98.28 E-value=8.4e-06 Score=58.65 Aligned_cols=76 Identities=17% Similarity=0.243 Sum_probs=57.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|.+..++.+++.++++|+++.+|....+.++++...+.+++++.+ +.....+.. +.+.++.++ T Consensus 236 ~~~d~il~~~g~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~ 309 (345) T cd08287 236 VGADAVLECVGTQESMEQAIAIARPGGRVGYVGVPHGGVELDVRELFFRNVGLAG------GPAPVRRYLPELLDDVLAG 309 (345) T ss_pred CCCCEEEECCCCHHHHHHHHHhhccCCEEEEecccCCCCccCHHHHHhcceEEEE------ecCCcHHHHHHHHHHHHcC Confidence 4799999999988899999999999999999998765556676566789999985 333323444 556677776 Q ss_pred CCc Q 034260 82 TPK 84 (100) Q Consensus 82 ~~~ 84 (100) ..+ T Consensus 310 ~l~ 312 (345) T cd08287 310 RIN 312 (345) T ss_pred CCC Confidence 544 No 50 >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=98.26 E-value=8.7e-06 Score=58.51 Aligned_cols=84 Identities=20% Similarity=0.154 Sum_probs=59.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) ++++|+++||+|. ..++.++++++++|+++.+|..... .++++..++.+++++.|+ .....+.+ +.+.++. T Consensus 241 ~~~~d~vi~~~g~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~l~~ 313 (350) T cd08274 241 GEPVDVVADVVGG-PLFPDLLRLLRPGGRYVTAGAIAGPVVELDLRTLYLKDLTLFGS------TLGTREVFRRLVRYIE 313 (350) T ss_pred CCCCcEEEecCCH-HHHHHHHHHhccCCEEEEecccCCccccCCHHHhhhcceEEEEe------ecCCHHHHHHHHHHHH Confidence 3579999999997 5799999999999999999976443 567777778899999853 33334444 5566776 Q ss_pred cCCCcceeeeece Q 034260 80 GQTPKLIQATLFD 92 (100) Q Consensus 80 ~~~~~~i~~~~~~ 92 (100) ++..+.+....++ T Consensus 314 ~~~l~~~~~~~~~ 326 (350) T cd08274 314 EGEIRPVVAKTFP 326 (350) T ss_pred CCCcccccccccC Confidence 6643322334444 No 51 >PRK05396 tdh L-threonine 3-dehydrogenase; Validated Probab=98.25 E-value=9.2e-06 Score=58.51 Aligned_cols=56 Identities=20% Similarity=0.366 Sum_probs=47.9 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~G 57 (100) ++++|+++||+|...++++++++++++|+++.+|......+++...+..+++++.+ T Consensus 230 ~~~~d~v~d~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~l~~ 285 (341) T PRK05396 230 TEGFDVGLEMSGAPSAFRQMLDNMNHGGRIAMLGIPPGDMAIDWNKVIFKGLTIKG 285 (341) T ss_pred CCCCCEEEECCCCHHHHHHHHHHHhcCCEEEEEecCCCCCcccHHHHhhcceEEEE Confidence 45799999999988899999999999999999998765555666677888899885 No 52 >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Probab=98.22 E-value=4.1e-06 Score=61.27 Aligned_cols=73 Identities=12% Similarity=0.080 Sum_probs=57.2 Q ss_pred cEEEEccC--hHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 6 DVSFDCAG--LNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 6 D~vie~~G--~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) |..++|+- +...++.+++++|++|++|++|++..+..++...+..+.++|.||. -.++.+. +++++.+++. T Consensus 248 dg~~~~v~~~a~~~~~~~~~~lk~~Gt~V~vg~p~~~~~~~~~~lil~~~~I~GS~------vG~~ket~E~Ldf~a~~~ 321 (360) T KOG0023|consen 248 DGGIDTVSNLAEHALEPLLGLLKVNGTLVLVGLPEKPLKLDTFPLILGRKSIKGSI------VGSRKETQEALDFVARGL 321 (360) T ss_pred cCcceeeeeccccchHHHHHHhhcCCEEEEEeCcCCcccccchhhhcccEEEEeec------cccHHHHHHHHHHHHcCC Confidence 45555555 5668999999999999999999999988999999999999999654 3335555 5566777765 Q ss_pred Cc Q 034260 83 PK 84 (100) Q Consensus 83 ~~ 84 (100) -| T Consensus 322 ik 323 (360) T KOG0023|consen 322 IK 323 (360) T ss_pred Cc Confidence 33 No 53 >cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Probab=98.20 E-value=1.9e-05 Score=56.94 Aligned_cols=75 Identities=33% Similarity=0.553 Sum_probs=55.6 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQ 81 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~ 81 (100) |+++|+++||+|....++.++++++++|+++.+|.......+++..+..+.+++.+ .........+.+.++..+ T Consensus 232 ~~~~d~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~~ 305 (343) T cd05285 232 GKGPDVVIECTGAESCIQTAIYATRPGGTVVLVGMGKPEVTLPLSAASLREIDIRG------VFRYANTYPTAIELLASG 305 (343) T ss_pred CCCCCEEEECCCCHHHHHHHHHHhhcCCEEEEEccCCCCCccCHHHHhhCCcEEEE------eccChHHHHHHHHHHHcC Confidence 35699999999987789999999999999999997655455666677788888884 333322333555667666 Q ss_pred C Q 034260 82 T 82 (100) Q Consensus 82 ~ 82 (100) . T Consensus 306 ~ 306 (343) T cd05285 306 K 306 (343) T ss_pred C Confidence 4 No 54 >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononu Probab=98.20 E-value=1.1e-05 Score=59.05 Aligned_cols=79 Identities=15% Similarity=0.167 Sum_probs=56.9 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC--CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH--HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~--~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) ++++|+++||+|.+..+.+++++++++|+++.+|... ....+++..+..+++++.++.. +. ..+.+.. +.+.++ T Consensus 252 ~~~~d~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~-~~~~~~~~~~~~~l 328 (365) T cd08278 252 GGGVDYALDTTGVPAVIEQAVDALAPRGTLALVGAPPPGAEVTLDVNDLLVSGKTIRGVIE--GD-SVPQEFIPRLIELY 328 (365) T ss_pred CCCCcEEEECCCCcHHHHHHHHHhccCCEEEEeCcCCCCCccccCHHHHhhcCceEEEeec--CC-cChHHHHHHHHHHH Confidence 4579999999998788999999999999999999763 3456777777788999986431 11 1122333 445566 Q ss_pred hcCCC Q 034260 79 SGQTP 83 (100) Q Consensus 79 ~~~~~ 83 (100) .++.. T Consensus 329 ~~g~l 333 (365) T cd08278 329 RQGKF 333 (365) T ss_pred HcCCC Confidence 66643 No 55 >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase. Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase. Probab=98.20 E-value=1.3e-05 Score=57.45 Aligned_cols=89 Identities=11% Similarity=0.058 Sum_probs=55.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-----Ccc--cChHHHHhcCcEEEeEeeceeeeee--chhhH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-----DMT--VPLTPAAARYLIYGFLFFFFLVLGY--SVIYF 72 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-----~~~--i~~~~l~~k~~~i~Gs~~~~g~~~~--~~~~~ 72 (100) ++|+|+++||+|.+ .+++++++++++|+++.+|.... +.+ .....+..+++++.|+.. ..+.. ..+.+ T Consensus 205 ~~gvdvv~d~~G~~-~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~--~~~~~~~~~~~~ 281 (325) T TIGR02825 205 PDGYDCYFDNVGGE-FSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEGFIV--NRWQGEVRQKAL 281 (325) T ss_pred CCCeEEEEECCCHH-HHHHHHHHhCcCcEEEEecchhhcccCCCCCCCcchHHHhhhcceEeEEEe--hhhhhhhhHHHH Confidence 35799999999975 67999999999999999997532 122 123456778999986331 11111 01223 Q ss_pred -HHHHHHhcCCCcceeeeecee Q 034260 73 -RKMLYISGQTPKLIQATLFDL 93 (100) Q Consensus 73 -~~i~~l~~~~~~~i~~~~~~~ 93 (100) +.+.++.++..+......+++ T Consensus 282 ~~~~~l~~~g~l~~~~~~~~~l 303 (325) T TIGR02825 282 KELLKWVLEGKIQYKEYVIEGF 303 (325) T ss_pred HHHHHHHHCCCcccceeccccH Confidence 445567677544433344454 No 56 >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanedi Probab=98.17 E-value=1.8e-05 Score=58.26 Aligned_cols=79 Identities=14% Similarity=0.111 Sum_probs=55.8 Q ss_pred CCcccEEEEccChH-HHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhHHHHHHHhc Q 034260 2 GAGIDVSFDCAGLN-KTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISG 80 (100) Q Consensus 2 G~G~D~vie~~G~~-~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~ 80 (100) |+++|+++||+|.+ ..+++++++++++||++.+|......++++..+..+..++.|+. +. .......+.+.++.. T Consensus 273 g~gvDvvld~~g~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~l~~~~---~~-~~~~~~~~~~~ll~~ 348 (384) T cd08265 273 GWGADIQVEAAGAPPATIPQMEKSIAINGKIVYIGRAATTVPLHLEVLQVRRAQIVGAQ---GH-SGHGIFPSVIKLMAS 348 (384) T ss_pred CCCCCEEEECCCCcHHHHHHHHHHHHcCCEEEEECCCCCCCcccHHHHhhCceEEEEee---cc-CCcchHHHHHHHHHc Confidence 45799999999973 57899999999999999999765555566666777888888532 11 111123355667776 Q ss_pred CCCc Q 034260 81 QTPK 84 (100) Q Consensus 81 ~~~~ 84 (100) +..+ T Consensus 349 g~l~ 352 (384) T cd08265 349 GKID 352 (384) T ss_pred CCCC Confidence 6533 No 57 >TIGR01751 crot-CoA-red crotonyl-CoA reductase. The enzyme modelled by this alignment is responsible for the conversion of crotonyl-CoA reductase to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate. In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae and coronatine from Pseudomonas syringae. Probab=98.15 E-value=1.9e-05 Score=58.43 Aligned_cols=84 Identities=13% Similarity=0.036 Sum_probs=58.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeeechh-hHHHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGYSVI-YFRKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~-~~~~i~~l~~ 80 (100) +++|+++||+|. ..+.+++++++++|+++.+|.... +.+++...+..+++++.| +...... ..+.+.++.+ T Consensus 279 ~g~d~vld~~g~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~l~~ 351 (398) T TIGR01751 279 EDPDIVFEHPGR-ATFPTSVFVCRRGGMVVICGGTTGYNHDYDNRYLWMRQKRIQG------SHFANLREAWEANRLVAK 351 (398) T ss_pred CCceEEEECCcH-HHHHHHHHhhccCCEEEEEccccCCCCCcCHHHHhhcccEEEc------cccCcHHHHHHHHHHHHC Confidence 579999999996 679999999999999999998654 356667777788888885 3322223 3355566666 Q ss_pred CCCcceeeeecee Q 034260 81 QTPKLIQATLFDL 93 (100) Q Consensus 81 ~~~~~i~~~~~~~ 93 (100) +..+...+..+++ T Consensus 352 ~~l~~~~~~~~~l 364 (398) T TIGR01751 352 GRIDPTLSKVYPL 364 (398) T ss_pred CCcccceeeEEcH Confidence 5433323344444 No 58 >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism. Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in Probab=98.15 E-value=1.8e-05 Score=57.11 Aligned_cols=56 Identities=21% Similarity=0.221 Sum_probs=44.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-c-----ccChHHHHhcCcEEEeE Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-M-----TVPLTPAAARYLIYGFL 58 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~-----~i~~~~l~~k~~~i~Gs 58 (100) ++|+|+++||+|. ..++.++++++++|+++.+|..... . ..+...+..+++++.|+ T Consensus 219 ~~gvd~v~d~~g~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~~~~~i~g~ 280 (338) T cd08295 219 PNGIDIYFDNVGG-KMLDAVLLNMNLHGRIAACGMISQYNLEWPEGVRNLLNIIYKRVKIQGF 280 (338) T ss_pred CCCcEEEEECCCH-HHHHHHHHHhccCcEEEEecccccCCCCCCCCccCHHHHhhccceeeEE Confidence 3579999999997 6899999999999999999975431 1 13456677888999863 No 59 >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typical Probab=98.14 E-value=2.9e-05 Score=55.78 Aligned_cols=77 Identities=19% Similarity=0.272 Sum_probs=56.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) ++++|+++||+|....++.++++++++|+++.+|... .....+....+.+++++.+ ......+.+ +.+.++. T Consensus 233 ~~~~dvvid~~~~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~ 306 (344) T cd08284 233 GRGADVVLEAVGGAAALDLAFDLVRPGGVISSVGVHTAEEFPFPGLDAYNKNLTLRF------GRCPVRSLFPELLPLLE 306 (344) T ss_pred CCCCCEEEECCCCHHHHHHHHHhcccCCEEEEECcCCCCCccccHHHHhhcCcEEEE------ecCCcchhHHHHHHHHH Confidence 3579999999998789999999999999999999776 3444555667788899874 222233444 5556666 Q ss_pred cCCCc Q 034260 80 GQTPK 84 (100) Q Consensus 80 ~~~~~ 84 (100) .+..+ T Consensus 307 ~~~i~ 311 (344) T cd08284 307 SGRLD 311 (344) T ss_pred cCCCC Confidence 66433 No 60 >cd05284 arabinose_DH_like D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol d Probab=98.14 E-value=3.5e-05 Score=55.22 Aligned_cols=77 Identities=16% Similarity=0.154 Sum_probs=55.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|.....++++++++++|+++.+|.... ..++....+.+++++.++. ....+.+ +.+.++.++ T Consensus 234 ~~~dvvld~~g~~~~~~~~~~~l~~~g~~i~~g~~~~-~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~l~~g 306 (340) T cd05284 234 RGADAVIDFVGSDETLALAAKLLAKGGRYVIVGYGGH-GRLPTSDLVPTEISVIGSL------WGTRAELVEVVALAESG 306 (340) T ss_pred CCCCEEEEcCCCHHHHHHHHHHhhcCCEEEEEcCCCC-CccCHHHhhhcceEEEEEe------cccHHHHHHHHHHHHhC Confidence 4799999999987789999999999999999997654 4455555567899998532 2223334 556667666 Q ss_pred CCcce Q 034260 82 TPKLI 86 (100) Q Consensus 82 ~~~~i 86 (100) ..+.+ T Consensus 307 ~l~~~ 311 (340) T cd05284 307 KVKVE 311 (340) T ss_pred CCCcc Confidence 54443 No 61 >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i Probab=98.11 E-value=3.1e-05 Score=55.63 Aligned_cols=74 Identities=19% Similarity=0.361 Sum_probs=52.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|....+..+++.++++|+++.+|.......+.......+++++.+ +..+..+.. +.+.++.++ T Consensus 232 ~~~d~vid~~g~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~~g 305 (341) T cd08262 232 PKPAVIFECVGAPGLIQQIIEGAPPGGRIVVVGVCMESDNIEPALAIRKELTLQF------SLGYTPEEFADALDALAEG 305 (341) T ss_pred CCCCEEEECCCCHHHHHHHHHHhccCCEEEEECCCCCCCccCHHHHhhcceEEEE------EecccHHHHHHHHHHHHcC Confidence 4699999999986688999999999999999997754333343334567888874 333434444 455677666 Q ss_pred C Q 034260 82 T 82 (100) Q Consensus 82 ~ 82 (100) . T Consensus 306 ~ 306 (341) T cd08262 306 K 306 (341) T ss_pred C Confidence 4 No 62 >TIGR00692 tdh L-threonine 3-dehydrogenase. E. coli His-90 modulates substrate specificity and is believed part of the active site. Probab=98.10 E-value=3.2e-05 Score=55.71 Aligned_cols=87 Identities=20% Similarity=0.230 Sum_probs=57.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChH-HHHhcCcEEEeEeeceeeeeechhhHHHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLT-PAAARYLIYGFLFFFFLVLGYSVIYFRKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~-~l~~k~~~i~Gs~~~~g~~~~~~~~~~~i~~l~~~ 81 (100) +++|+++||+|...++..++++++++|+++.+|......+++.. .+..+++++.+.. + ..+.....+.+.++.++ T Consensus 229 ~~~d~vld~~g~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~~~~~~~~~l~~~ 304 (340) T TIGR00692 229 EGVDVFLEMSGAPKALEQGLQAVTPGGRVSLLGLPPGKVTIDFTNKVIFKGLTIYGIT---G-RHMFETWYTVSRLIQSG 304 (340) T ss_pred CCCCEEEECCCCHHHHHHHHHhhcCCCEEEEEccCCCCcccchhhhhhhcceEEEEEe---c-CCchhhHHHHHHHHHcC Confidence 57999999999878899999999999999999986544444444 5677888887422 1 11111222445667666 Q ss_pred CCc--ceeeeecee Q 034260 82 TPK--LIQATLFDL 93 (100) Q Consensus 82 ~~~--~i~~~~~~~ 93 (100) ..+ .+....+++ T Consensus 305 ~l~~~~~~~~~~~l 318 (340) T TIGR00692 305 KLDLDPIITHKFKF 318 (340) T ss_pred CCChHHheeeeeeH Confidence 533 233455554 No 63 >PRK13771 putative alcohol dehydrogenase; Provisional Probab=98.07 E-value=3.9e-05 Score=54.85 Aligned_cols=83 Identities=13% Similarity=0.116 Sum_probs=57.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCc--ccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDM--TVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~--~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) ++|+++||+|. ....+++++++++|+++.+|...... .++......+++++.+ .....++++ +.++++.+ T Consensus 225 ~~d~~ld~~g~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~ 297 (334) T PRK13771 225 GADIVIETVGT-PTLEESLRSLNMGGKIIQIGNVDPSPTYSLRLGYIILKDIEIIG------HISATKRDVEEALKLVAE 297 (334) T ss_pred CCcEEEEcCCh-HHHHHHHHHHhcCCEEEEEeccCCCCCcccCHHHHHhcccEEEE------ecCCCHHHHHHHHHHHHc Confidence 58999999998 47899999999999999999864321 2444445678899985 333334555 55667767 Q ss_pred CCCcceeeeecee Q 034260 81 QTPKLIQATLFDL 93 (100) Q Consensus 81 ~~~~~i~~~~~~~ 93 (100) +..+.+....+++ T Consensus 298 ~~l~~~~~~~~~~ 310 (334) T PRK13771 298 GKIKPVIGAEVSL 310 (334) T ss_pred CCCcceEeeeEcH Confidence 6554444445544 No 64 >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. T Probab=98.04 E-value=5e-05 Score=56.03 Aligned_cols=74 Identities=22% Similarity=0.315 Sum_probs=53.3 Q ss_pred CcccEEEEccCh---------------------HHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEee Q 034260 3 AGIDVSFDCAGL---------------------NKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFF 60 (100) Q Consensus 3 ~G~D~vie~~G~---------------------~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~ 60 (100) +++|+++||+|. ...+++++++++++|+++.+|.... ...++...++.+++++.+ T Consensus 253 ~~~D~vld~vg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~iv~~g~~~~~~~~~~~~~~~~~~~~i~~--- 329 (386) T cd08283 253 RGPDVCIDAVGMEAHGSPLHKAEQALLKLETDRPDALREAIQAVRKGGTVSIIGVYGGTVNKFPIGAAMNKGLTLRM--- 329 (386) T ss_pred CCCCEEEECCCCcccccccccccccccccccCchHHHHHHHHHhccCCEEEEEcCCCCCcCccCHHHHHhCCcEEEe--- Confidence 479999999984 3478999999999999999997654 344566567788999985 Q ss_pred ceeeeeechhhH-HHHHHHhcCC Q 034260 61 FFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 61 ~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) +.....+.+ +.+.++..+. T Consensus 330 ---~~~~~~~~~~~~~~~l~~g~ 349 (386) T cd08283 330 ---GQTHVQRYLPRLLELIESGE 349 (386) T ss_pred ---ccCCchHHHHHHHHHHHcCC Confidence 322223334 4556666654 No 65 >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol. ADH is a me Probab=98.04 E-value=5.6e-05 Score=55.14 Aligned_cols=89 Identities=21% Similarity=0.272 Sum_probs=60.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC--CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH--HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~--~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) ++++|+++||+|....++.+++.++++|+++.+|... ....++...+..++.++.++++ +... ..... +.+.++ T Consensus 249 ~~~vd~vld~~~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~-~~~~~~~~~~l~ 325 (363) T cd08279 249 GRGADYAFEAVGRAATIRQALAMTRKGGTAVVVGMGPPGETVSLPALELFLSEKRLQGSLY--GSAN-PRRDIPRLLDLY 325 (363) T ss_pred CCCCCEEEEcCCChHHHHHHHHHhhcCCeEEEEecCCCCcccccCHHHHhhcCcEEEEEEe--cCcC-cHHHHHHHHHHH Confidence 3579999999997778999999999999999998765 3456677777778888886442 2212 23334 455667 Q ss_pred hcCCCcc--eeeeecee Q 034260 79 SGQTPKL--IQATLFDL 93 (100) Q Consensus 79 ~~~~~~~--i~~~~~~~ 93 (100) .++..+. +.+..+++ T Consensus 326 ~~g~l~~~~~~~~~~~~ 342 (363) T cd08279 326 RAGRLKLDELVTRRYSL 342 (363) T ss_pred HcCCCCcceeEEEEEcH Confidence 6664332 23344554 No 66 >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the clo Probab=98.03 E-value=6e-05 Score=53.73 Aligned_cols=70 Identities=11% Similarity=0.044 Sum_probs=53.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +++|+++||+|. ..+++++++++++|+++.+|... ....+++..+..++.++.| +..+.+++. +.+.++. T Consensus 222 ~~~d~vl~~~g~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~ 293 (325) T cd08264 222 KMADVVINSLGS-SFWDLSLSVLGRGGRLVTFGTLTGGEVKLDLSDLYSKQISIIG------STGGTRKELLELVKIAK 293 (325) T ss_pred CCCCEEEECCCH-HHHHHHHHhhccCCEEEEEecCCCCCCccCHHHHhhcCcEEEE------ccCCCHHHHHHHHHHHH Confidence 468999999997 68999999999999999999753 2456777778888899984 444445555 4555664 No 67 >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (ty Probab=98.01 E-value=5.7e-05 Score=54.38 Aligned_cols=74 Identities=20% Similarity=0.266 Sum_probs=55.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC---cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD---MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~---~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) ++|+++||+|...++..++++++++|+++.+|..... ..+++..+..+++++.| ......+.+ +.+.+++ T Consensus 233 ~~d~vi~~~g~~~~~~~~~~~l~~~g~~i~~g~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~ 306 (345) T cd08260 233 GAHVSVDALGIPETCRNSVASLRKRGRHVQVGLTLGEEAGVALPMDRVVARELEIVG------SHGMPAHRYDAMLALIA 306 (345) T ss_pred CCCEEEEcCCCHHHHHHHHHHhhcCCEEEEeCCcCCCCCccccCHHHHhhcccEEEe------CCcCCHHHHHHHHHHHH Confidence 6999999999777899999999999999999986532 35566667788999985 333334444 4556676 Q ss_pred cCCC Q 034260 80 GQTP 83 (100) Q Consensus 80 ~~~~ 83 (100) ++.. T Consensus 307 ~~~i 310 (345) T cd08260 307 SGKL 310 (345) T ss_pred cCCC Confidence 6643 No 68 >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short cha Probab=98.01 E-value=9.7e-05 Score=53.05 Aligned_cols=77 Identities=16% Similarity=0.087 Sum_probs=57.0 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) ++++|+++||.+....+++++++++++|+++.+|..... .+++...++.+++++.+ ......++. +.+.++. T Consensus 232 ~~~vd~vl~~~~~~~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~ 305 (341) T cd08297 232 GGGAHAVVVTAVSAAAYEQALDYLRPGGTLVCVGLPPGGFIPLDPFDLVLRGITIVG------SLVGTRQDLQEALEFAA 305 (341) T ss_pred CCCCCEEEEcCCchHHHHHHHHHhhcCCEEEEecCCCCCCCCCCHHHHHhcccEEEE------eccCCHHHHHHHHHHHH Confidence 457999999988888999999999999999999976543 35666667789999984 332223444 5556776 Q ss_pred cCCCc Q 034260 80 GQTPK 84 (100) Q Consensus 80 ~~~~~ 84 (100) ++..+ T Consensus 306 ~~~l~ 310 (341) T cd08297 306 RGKVK 310 (341) T ss_pred cCCCc Confidence 66543 No 69 >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydro Probab=97.98 E-value=8.4e-05 Score=50.94 Aligned_cols=56 Identities=25% Similarity=0.297 Sum_probs=45.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCccc-ChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTV-PLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i-~~~~l~~k~~~i~G 57 (100) ++++|+++||+|.....+.+++.++++|+++.+|........ .....+.+++++.| T Consensus 199 ~~~~d~vi~~~~~~~~~~~~~~~l~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~ 255 (271) T cd05188 199 GGGADVVIDAVGGPETLAQALRLLRPGGRIVVVGGTSGGPPLDDLRRLLFKELTIIG 255 (271) T ss_pred CCCCCEEEECCCCHHHHHHHHHhcccCCEEEEEccCCCCCCcccHHHHHhcceEEEE Confidence 357999999999867899999999999999999987653322 24556789999995 No 70 >cd08232 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domai Probab=97.97 E-value=7.4e-05 Score=53.60 Aligned_cols=72 Identities=22% Similarity=0.325 Sum_probs=52.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|+++||+|....++++++.++++|+++.+|....+.++++..+..+++++.+ .... .+.. +.+.++..+. T Consensus 231 ~vd~vld~~g~~~~~~~~~~~L~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~-~~~~~~~~~~~~~~~ 303 (339) T cd08232 231 DFDVVFEASGAPAALASALRVVRPGGTVVQVGMLGGPVPLPLNALVAKELDLRG------SFRF-DDEFAEAVRLLAAGR 303 (339) T ss_pred CccEEEECCCCHHHHHHHHHHHhcCCEEEEEecCCCCccCcHHHHhhcceEEEE------EecC-HHHHHHHHHHHHcCC Confidence 599999999977789999999999999999986654455566666778888874 3333 2334 4455666654 No 71 >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina Probab=97.95 E-value=8.9e-05 Score=52.59 Aligned_cols=57 Identities=18% Similarity=0.180 Sum_probs=46.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) |+++|+++||+|.. ..++++++++++|+++.+|.... ..++++..+..++.++.++. T Consensus 206 ~~~~d~v~d~~g~~-~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 263 (324) T cd08292 206 GAPISVALDSVGGK-LAGELLSLLGEGGTLVSFGSMSGEPMQISSGDLIFKQATVRGFW 263 (324) T ss_pred CCCCcEEEECCCCh-hHHHHHHhhcCCcEEEEEecCCCCCCcCCHHHHhhCCCEEEEEE Confidence 45899999999984 78999999999999999997643 45566666778999998643 No 72 >PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A. Probab=97.94 E-value=2.8e-06 Score=53.16 Aligned_cols=86 Identities=15% Similarity=0.165 Sum_probs=46.8 Q ss_pred CCcccEEEEccC--hHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeee---chhhHHH-H Q 034260 2 GAGIDVSFDCAG--LNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGY---SVIYFRK-M 75 (100) Q Consensus 2 G~G~D~vie~~G--~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~---~~~~~~~-i 75 (100) ++++|+||||+| .+..+..+.+++ ++|+++.+|. .+.......+...+.+.++ .+... ..+..+. + T Consensus 17 ~~~~D~ViD~~g~~~~~~~~~~~~~l-~~G~~v~i~~-----~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~l~~l~ 88 (127) T PF13602_consen 17 PGGVDVVIDTVGQTGESLLDASRKLL-PGGRVVSIGG-----DLPSFARRLKGRSIRYSFL--FSVDPNAIRAEALEELA 88 (127) T ss_dssp TS-EEEEEESS-CCHHHCGGGCCCTE-EEEEEEEE-S-----HHHHHHHHHHCHHCEEECC--C-H--HHHHHHHHHHHH T ss_pred CCCceEEEECCCCccHHHHHHHHHHC-CCCEEEEECC-----cccchhhhhcccceEEEEE--EecCCCchHHHHHHHHH Confidence 358999999999 655557777888 9999999983 2111222122333332211 11111 1233444 5 Q ss_pred HHHhcCCCcceeeeeceeee Q 034260 76 LYISGQTPKLIQATLFDLFF 95 (100) Q Consensus 76 ~~l~~~~~~~i~~~~~~~~~ 95 (100) .+++++..+......|||+- T Consensus 89 ~l~~~G~l~~~i~~~f~l~~ 108 (127) T PF13602_consen 89 ELVAEGKLKPPIDRVFPLEE 108 (127) T ss_dssp HHHHTTSS---EEEEEEGGG T ss_pred HHHHCCCeEEeeccEECHHH Confidence 67888888887778898863 No 73 >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, Probab=97.91 E-value=0.00016 Score=51.88 Aligned_cols=76 Identities=20% Similarity=0.217 Sum_probs=55.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|....+..+++.++++|+++.+|.......++...+..+++++.+ +.....+.. +.+.++.++ T Consensus 226 ~~vd~vld~~g~~~~~~~~~~~l~~~G~~i~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~~~ 299 (337) T cd08261 226 EGADVVIDATGNPASMEEAVELVAHGGRVVLVGLSKGPVTFPDPEFHKKELTILG------SRNATREDFPDVIDLLESG 299 (337) T ss_pred CCCCEEEECCCCHHHHHHHHHHHhcCCEEEEEcCCCCCCccCHHHHHhCCCEEEE------eccCChhhHHHHHHHHHcC Confidence 4689999999987889999999999999999987765555666666778888874 322223334 445566666 Q ss_pred CCc Q 034260 82 TPK 84 (100) Q Consensus 82 ~~~ 84 (100) ..+ T Consensus 300 ~i~ 302 (337) T cd08261 300 KVD 302 (337) T ss_pred CCC Confidence 543 No 74 >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=97.91 E-value=0.00014 Score=51.57 Aligned_cols=83 Identities=18% Similarity=0.172 Sum_probs=57.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|+++||+|. ..+..++++++++|+++.+|..... ..++...++.+++++.++. ....+.+ +.+.++.+ T Consensus 228 ~~~d~~i~~~~~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~l~~~ 300 (336) T cd08276 228 RGVDHVVEVGGP-GTLAQSIKAVAPGGVISLIGFLSGFEAPVLLLPLLTKGATLRGIA------VGSRAQFEAMNRAIEA 300 (336) T ss_pred CCCcEEEECCCh-HHHHHHHHhhcCCCEEEEEccCCCCccCcCHHHHhhcceEEEEEe------cCcHHHHHHHHHHHHc Confidence 579999999995 6789999999999999999976542 3455566778999999633 2223334 55666666 Q ss_pred CCCcceeeeece Q 034260 81 QTPKLIQATLFD 92 (100) Q Consensus 81 ~~~~~i~~~~~~ 92 (100) +..+.+....++ T Consensus 301 ~~l~~~~~~~~~ 312 (336) T cd08276 301 HRIRPVIDRVFP 312 (336) T ss_pred CCcccccCcEEe Confidence 554433334443 No 75 >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i Probab=97.90 E-value=0.00017 Score=50.83 Aligned_cols=81 Identities=12% Similarity=0.069 Sum_probs=55.6 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) ++++|+++||+|....++.++++++++|+++.+|... .+.++++..+..+++++.+... .......+.. +.+.++. T Consensus 196 ~~~vd~vld~~g~~~~~~~~~~~l~~~g~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~ 273 (312) T cd08269 196 GAGADVVIEAVGHQWPLDLAGELVAERGRLVIFGYHQDGPRPVPFQTWNWKGIDLINAVE--RDPRIGLEGMREAVKLIA 273 (312) T ss_pred CCCCCEEEECCCCHHHHHHHHHHhccCCEEEEEccCCCCCcccCHHHHhhcCCEEEEecc--cCccchhhHHHHHHHHHH Confidence 3579999999998788999999999999999999764 2345666677788888875221 1111112334 4455666 Q ss_pred cCCCc Q 034260 80 GQTPK 84 (100) Q Consensus 80 ~~~~~ 84 (100) ++..+ T Consensus 274 ~~~l~ 278 (312) T cd08269 274 DGRLD 278 (312) T ss_pred cCCCC Confidence 66433 No 76 >cd05281 TDH Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Probab=97.90 E-value=0.00011 Score=52.94 Aligned_cols=75 Identities=16% Similarity=0.208 Sum_probs=52.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChH-HHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLT-PAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~-~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|+++||+|....+++++++++++|+++.+|.......+++. .+..+++++.++. .... .+.+ +.+.++.+ T Consensus 230 ~~vd~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~-~~~~~~~~~~l~~ 304 (341) T cd05281 230 TGVDVVLEMSGNPKAIEQGLKALTPGGRVSILGLPPGPVDIDLNNLVIFKGLTVQGIT----GRKM-FETWYQVSALLKS 304 (341) T ss_pred CCCCEEEECCCCHHHHHHHHHHhccCCEEEEEccCCCCcccccchhhhccceEEEEEe----cCCc-chhHHHHHHHHHc Confidence 57999999999888899999999999999999876544444432 3667888887522 1111 2233 44566766 Q ss_pred CC Q 034260 81 QT 82 (100) Q Consensus 81 ~~ 82 (100) +. T Consensus 305 ~~ 306 (341) T cd05281 305 GK 306 (341) T ss_pred CC Confidence 64 No 77 >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup. L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, i Probab=97.89 E-value=0.00017 Score=51.77 Aligned_cols=74 Identities=15% Similarity=0.155 Sum_probs=54.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +++|+++||+|....+..++++++++|+++.+|.... ...+++..+..+++++.+ +....++.. +.+.++. T Consensus 233 ~~vd~vld~~~~~~~~~~~~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~l~~------~~~~~~~~~~~~~~l~~ 306 (343) T cd08235 233 RGADVVIVATGSPEAQAQALELVRKGGRILFFGGLPKGSTVNIDPNLIHYREITITG------SYAASPEDYKEALELIA 306 (343) T ss_pred cCCCEEEECCCChHHHHHHHHHhhcCCEEEEEeccCCCCCcccCHHHHhhCceEEEE------EecCChhhHHHHHHHHH Confidence 4699999999987789999999999999999987543 245666667788888874 333334444 4456666 Q ss_pred cCC Q 034260 80 GQT 82 (100) Q Consensus 80 ~~~ 82 (100) .+. T Consensus 307 ~~~ 309 (343) T cd08235 307 SGK 309 (343) T ss_pred cCC Confidence 664 No 78 >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of ac Probab=97.89 E-value=8.4e-05 Score=52.89 Aligned_cols=56 Identities=23% Similarity=0.141 Sum_probs=43.0 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC---C----cccChHHHHhcCcEEEeE Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH---D----MTVPLTPAAARYLIYGFL 58 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~---~----~~i~~~~l~~k~~~i~Gs 58 (100) ++|+|+++||+|. ..++.++++++++|+++.+|.... + .+.....+..+++++.|+ T Consensus 209 ~~gvd~vld~~g~-~~~~~~~~~l~~~G~iv~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ 271 (329) T cd08294 209 PDGIDCYFDNVGG-EFSSTVLSHMNDFGRVAVCGSISTYNDKEPKKGPYVQETIIFKQLKMEGF 271 (329) T ss_pred CCCcEEEEECCCH-HHHHHHHHhhccCCEEEEEcchhccCCCCCCcCcccHHHHhhhcceEEEE Confidence 3579999999998 688999999999999999986421 1 122334577889999863 No 79 >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically Probab=97.89 E-value=8.7e-05 Score=54.61 Aligned_cols=87 Identities=14% Similarity=0.098 Sum_probs=54.4 Q ss_pred CcccEEEEccChHHHHHHHHHhcc-CCCEEEEecCCCCC--cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATR-AGDKVCLVGMGHHD--MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~-~gGrvv~vG~~~~~--~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) +++|+++||+|.+.++.+++..++ ++|+++.+|..... .+++... +.++++++|++. +.+. .+.+. +.+..+ T Consensus 259 ~~~d~vld~~g~~~~~~~~~~~~~~~~G~~v~~g~~~~~~~~~~~~~~-~~~~~~i~~~~~--~~~~-~~~~~~~~~~~~ 334 (373) T cd08299 259 GGVDFSFEVIGRLDTMKAALASCHEGYGVSVIVGVPPSSQNLSINPML-LLTGRTWKGAVF--GGWK-SKDSVPKLVADY 334 (373) T ss_pred CCCeEEEECCCCcHHHHHHHHhhccCCCEEEEEccCCCCceeecCHHH-HhcCCeEEEEEe--cCCc-cHHHHHHHHHHH Confidence 469999999998888999888775 79999999987543 3444432 356789986542 2222 12333 444555 Q ss_pred hcC--CCcceeeeecee Q 034260 79 SGQ--TPKLIQATLFDL 93 (100) Q Consensus 79 ~~~--~~~~i~~~~~~~ 93 (100) .++ +.+.+..+.+++ T Consensus 335 ~~~~~~~~~~~~~~~~l 351 (373) T cd08299 335 MAKKFNLDPLITHTLPF 351 (373) T ss_pred HcCCCCchhheeeeecH Confidence 544 233234455554 No 80 >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fo Probab=97.88 E-value=0.0001 Score=54.06 Aligned_cols=85 Identities=20% Similarity=0.310 Sum_probs=57.6 Q ss_pred CcccEEEEccChHH-----------HHHHHHHhccCCCEEEEecCCCC-------------CcccChHHHHhcCcEEEeE Q 034260 3 AGIDVSFDCAGLNK-----------TMSTVLDATRAGDKVCLVGMGHH-------------DMTVPLTPAAARYLIYGFL 58 (100) Q Consensus 3 ~G~D~vie~~G~~~-----------~~~~al~~l~~gGrvv~vG~~~~-------------~~~i~~~~l~~k~~~i~Gs 58 (100) +++|+++||+|... ++++++++++++|+++.+|.... ...++...+..++.++.+ T Consensus 242 ~~~d~v~d~~g~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~- 320 (375) T cd08282 242 GGVDRAVDCVGYEARDRGGEAQPNLVLNQLIRVTRPGGGIGIVGVYVAEDPGAGDAAAKQGELSFDFGLLWAKGLSFGT- 320 (375) T ss_pred CCCCEEEECCCCcccccccccchHHHHHHHHHHhhcCcEEEEEeccCCcccccccccccCccccccHHHHHhcCcEEEE- Confidence 46899999999763 68999999999999999987532 123566667788888874 Q ss_pred eeceeeeeechhhH-HHHHHHhcCCCcc--eeeeecee Q 034260 59 FFFFLVLGYSVIYF-RKMLYISGQTPKL--IQATLFDL 93 (100) Q Consensus 59 ~~~~g~~~~~~~~~-~~i~~l~~~~~~~--i~~~~~~~ 93 (100) +.....+.. +.+.++.++..+. +....+++ T Consensus 321 -----~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~l 353 (375) T cd08282 321 -----GQAPVKKYNRQLRDLILAGRAKPSFVVSHVISL 353 (375) T ss_pred -----ecCCchhhHHHHHHHHHcCCCChHHcEEEEeeH Confidence 333333444 4456676665443 23455554 No 81 >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Probab=97.85 E-value=0.00019 Score=51.40 Aligned_cols=75 Identities=16% Similarity=0.116 Sum_probs=54.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQT 82 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~~ 82 (100) ++|.++++++....+++++++++++|+++.+|......+++...+..++.++.| +....++++ +.+.++.++. T Consensus 230 ~~d~vi~~~~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~~g~ 303 (338) T PRK09422 230 GAHAAVVTAVAKAAFNQAVDAVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVG------SLVGTRQDLEEAFQFGAEGK 303 (338) T ss_pred CCcEEEEeCCCHHHHHHHHHhccCCCEEEEEeeCCCCceecHHHHhhcCcEEEE------ecCCCHHHHHHHHHHHHhCC Confidence 578666666677899999999999999999997765556677777788999885 333334444 4556776664 Q ss_pred Cc Q 034260 83 PK 84 (100) Q Consensus 83 ~~ 84 (100) .+ T Consensus 304 l~ 305 (338) T PRK09422 304 VV 305 (338) T ss_pred CC Confidence 33 No 82 >cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydr Probab=97.82 E-value=0.00025 Score=50.18 Aligned_cols=56 Identities=18% Similarity=0.113 Sum_probs=45.2 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|.. ..+.++++++++|+++.+|.... ..+++....+.+++++.++. T Consensus 210 ~~~d~vl~~~g~~-~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 266 (324) T cd08244 210 GGVTVVLDGVGGA-IGRAALALLAPGGRFLTYGWASGEWTALDEDDARRRGVTVVGLL 266 (324) T ss_pred CCceEEEECCChH-hHHHHHHHhccCcEEEEEecCCCCCCccCHHHHhhCCcEEEEee Confidence 5799999999986 56999999999999999997653 33566566678899998643 No 83 >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subu Probab=97.81 E-value=0.0002 Score=52.23 Aligned_cols=77 Identities=21% Similarity=0.277 Sum_probs=54.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeec-hhhH-HHHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYS-VIYF-RKMLY 77 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~-~~~~-~~i~~ 77 (100) ++++|+++||+|....++.++++++++|+++.+|.... ...++...++.+++++.+ +.... .+.. +.+.+ T Consensus 254 ~~~~d~vld~vg~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~l 327 (367) T cd08263 254 GRGVDVVVEALGKPETFKLALDVVRDGGRAVVVGLAPGGATAEIPITRLVRRGIKIIG------SYGARPRQDLPELVGL 327 (367) T ss_pred CCCCCEEEEeCCCHHHHHHHHHHHhcCCEEEEEccCCCCCccccCHHHHhhCCeEEEe------cCCCCcHHHHHHHHHH Confidence 35799999999986589999999999999999987653 345666666678888885 32222 2334 44566 Q ss_pred HhcCCCc Q 034260 78 ISGQTPK 84 (100) Q Consensus 78 l~~~~~~ 84 (100) +.++..+ T Consensus 328 l~~~~l~ 334 (367) T cd08263 328 AASGKLD 334 (367) T ss_pred HHcCCCC Confidence 7666533 No 84 >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast Probab=97.79 E-value=0.00032 Score=50.39 Aligned_cols=57 Identities=28% Similarity=0.366 Sum_probs=45.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcc---cChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMT---VPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~---i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|....+..++++++++|+++.+|....... .+...+..++.++.|+. T Consensus 226 ~~~d~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~ 285 (343) T cd08236 226 RGADLVIEAAGSPATIEQALALARPGGKVVLVGIPYGDVTLSEEAFEKILRKELTIQGSW 285 (343) T ss_pred CCCCEEEECCCCHHHHHHHHHHhhcCCEEEEEcccCCCcccccCCHHHHHhcCcEEEEEe Confidence 4699999999987789999999999999999997654422 23445668899998644 No 85 >cd08234 threonine_DH_like L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Probab=97.77 E-value=0.00034 Score=49.95 Aligned_cols=74 Identities=18% Similarity=0.221 Sum_probs=52.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHh Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYIS 79 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~ 79 (100) +++|+++||+|....+..+++.++++|+++.+|.... ..+++...+..+++++.+ .... .... +.+.++. T Consensus 225 ~~vd~v~~~~~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~------~~~~-~~~~~~~~~~~~ 297 (334) T cd08234 225 YGFDVVIEATGVPKTLEQAIEYARRGGTVLVFGVYAPDARVSISPFEIFQKELTIIG------SFIN-PYTFPRAIALLE 297 (334) T ss_pred CCCcEEEECCCChHHHHHHHHHHhcCCEEEEEecCCCCCCcccCHHHHHhCCcEEEE------eccC-HHHHHHHHHHHH Confidence 5799999999987889999999999999999997653 344555555567888874 3222 2334 4455666 Q ss_pred cCCC Q 034260 80 GQTP 83 (100) Q Consensus 80 ~~~~ 83 (100) ++.. T Consensus 298 ~~~l 301 (334) T cd08234 298 SGKI 301 (334) T ss_pred cCCC Confidence 6543 No 86 >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MD Probab=97.75 E-value=0.00031 Score=48.95 Aligned_cols=57 Identities=21% Similarity=0.137 Sum_probs=43.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|....++.++++++++|+++.+|............+..++.++.+.. T Consensus 158 ~~~d~vl~~~~~~~~~~~~~~~l~~~g~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~ 214 (277) T cd08255 158 RGADVVIEASGSPSALETALRLLRDRGRVVLVGWYGLKPLLLGEEFHFKRLPIRSSQ 214 (277) T ss_pred CCCCEEEEccCChHHHHHHHHHhcCCcEEEEEeccCCCccccHHHHHhccCeEEeec Confidence 579999999998888999999999999999999875441112234556777777543 No 87 >cd05282 ETR_like 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossman Probab=97.73 E-value=0.00031 Score=49.73 Aligned_cols=57 Identities=16% Similarity=0.260 Sum_probs=45.2 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) |+++|+++||+|.. ....++++++++|+++.+|.... +..+++..+..++.++.+.. T Consensus 205 ~~~~d~vl~~~g~~-~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 262 (323) T cd05282 205 GAGARLALDAVGGE-SATRLARSLRPGGTLVNYGLLSGEPVPFPRSVFIFKDITVRGFW 262 (323) T ss_pred CCCceEEEECCCCH-HHHHHHHhhCCCCEEEEEccCCCCCCCCCHHHHhhcCceEEEEE Confidence 45799999999985 56788999999999999987654 34566666666899998644 No 88 >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone Probab=97.72 E-value=0.00047 Score=48.76 Aligned_cols=84 Identities=17% Similarity=0.147 Sum_probs=57.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|++++++|. ..+++++++++++|+++.+|.... ...++....+.+++++.+ .......++ +.+.++.+ T Consensus 234 ~~~d~~i~~~g~-~~~~~~~~~l~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~l~~ 306 (342) T cd08266 234 RGVDVVVEHVGA-ATWEKSLKSLARGGRLVTCGATTGYEAPIDLRHVFWRQLSILG------STMGTKAELDEALRLVFR 306 (342) T ss_pred CCCcEEEECCcH-HHHHHHHHHhhcCCEEEEEecCCCCCCCcCHHHHhhcceEEEE------EecCCHHHHHHHHHHHHc Confidence 478999999997 578999999999999999987654 334555556678888885 333333444 55667766 Q ss_pred CCCcceeeeecee Q 034260 81 QTPKLIQATLFDL 93 (100) Q Consensus 81 ~~~~~i~~~~~~~ 93 (100) +..+.+....+++ T Consensus 307 ~~l~~~~~~~~~~ 319 (342) T cd08266 307 GKLKPVIDSVFPL 319 (342) T ss_pred CCcccceeeeEcH Confidence 6544334444443 No 89 >KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Probab=97.71 E-value=7.6e-05 Score=53.53 Aligned_cols=88 Identities=20% Similarity=0.296 Sum_probs=60.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEeeceeeeee--chhhH-HH--- Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLFFFFLVLGY--SVIYF-RK--- 74 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~~~~g~~~~--~~~~~-~~--- 74 (100) |+|+|+++|.+|. +++..++++++++|++|.+|.... ..+++.+.+.-|.+.+.-.. .++| .+.++ .. T Consensus 213 gKGVd~vyDsvG~-dt~~~sl~~Lk~~G~mVSfG~asgl~~p~~l~~ls~k~l~lvrps----l~gYi~g~~el~~~v~r 287 (336) T KOG1197|consen 213 GKGVDAVYDSVGK-DTFAKSLAALKPMGKMVSFGNASGLIDPIPLNQLSPKALQLVRPS----LLGYIDGEVELVSYVAR 287 (336) T ss_pred CCCceeeeccccc-hhhHHHHHHhccCceEEEeccccCCCCCeehhhcChhhhhhccHh----hhcccCCHHHHHHHHHH Confidence 7899999999997 699999999999999999998875 34566666666666665321 1222 23322 11 Q ss_pred -HHHHhcCCCcceeeeeceee Q 034260 75 -MLYISGQTPKLIQATLFDLF 94 (100) Q Consensus 75 -i~~l~~~~~~~i~~~~~~~~ 94 (100) ..+..++..|.-.+..+||+ T Consensus 288 l~alvnsg~lk~~I~~~ypls 308 (336) T KOG1197|consen 288 LFALVNSGHLKIHIDHVYPLS 308 (336) T ss_pred HHHHhhcCccceeeeeecchH Confidence 23444566676666777764 No 90 >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family. This model represents a subfamily of pfam00107 as defined by Pfam, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This subfamily includes proteins studied crystallographically for insight into function: YhdH from Escherichia coli and YhfP from Bacillus subtilis. Members bind NADPH or NAD, but not zinc. Probab=97.69 E-value=0.00039 Score=49.39 Aligned_cols=55 Identities=20% Similarity=0.199 Sum_probs=44.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) ++|+++||+|.. .+++++++++++|+++.+|.... ..+++...++.+++++.++. T Consensus 211 ~~d~vld~~g~~-~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 266 (323) T TIGR02823 211 RWAGAVDTVGGH-TLANVLAQLKYGGAVAACGLAGGPDLPTTVLPFILRGVSLLGID 266 (323) T ss_pred CceEEEECccHH-HHHHHHHHhCCCCEEEEEcccCCCCccccHHHHhhcceEEEEEe Confidence 589999999975 78999999999999999998653 34445566668899998643 No 91 >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short cha Probab=97.69 E-value=0.00047 Score=49.21 Aligned_cols=83 Identities=14% Similarity=0.088 Sum_probs=55.2 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCc-ccChHHHHhcCcEEEeEeeceeeeeechhhHHH-HHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDM-TVPLTPAAARYLIYGFLFFFFLVLGYSVIYFRK-MLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~-~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~~~-i~~l~~ 80 (100) +++|++++|++....+++++++++++|+++.+|...... .++... +.++..+.+ +.....+.... +.++.+ T Consensus 224 ~~vD~vi~~~~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~-~~~~~~i~~------~~~~~~~~~~~~~~l~~~ 296 (329) T cd08298 224 EPLDAAIIFAPVGALVPAALRAVKKGGRVVLAGIHMSDIPAFDYEL-LWGEKTIRS------VANLTRQDGEEFLKLAAE 296 (329) T ss_pred CcccEEEEcCCcHHHHHHHHHHhhcCCEEEEEcCCCCCCCccchhh-hhCceEEEE------ecCCCHHHHHHHHHHHHc Confidence 478999999888889999999999999999998644222 234433 467888874 44444444444 455656 Q ss_pred CCCcceeeeecee Q 034260 81 QTPKLIQATLFDL 93 (100) Q Consensus 81 ~~~~~i~~~~~~~ 93 (100) +..+.+. ..+++ T Consensus 297 ~~l~~~~-~~~~~ 308 (329) T cd08298 297 IPIKPEV-ETYPL 308 (329) T ss_pred CCCCceE-EEEeH Confidence 5544443 44543 No 92 >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH Probab=97.68 E-value=0.00017 Score=51.25 Aligned_cols=55 Identities=18% Similarity=0.173 Sum_probs=45.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeE Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFL 58 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs 58 (100) +++|+++||+|. ..+++++++++++|+++.+|.... ..++++..++.+++++.+. T Consensus 212 ~~~d~vld~~g~-~~~~~~~~~l~~~G~~i~~g~~~~~~~~~~~~~~~~~~~~~~~~ 267 (326) T cd08289 212 QRWAGAVDPVGG-KTLAYLLSTLQYGGSVAVSGLTGGGEVETTVFPFILRGVNLLGI 267 (326) T ss_pred CCcCEEEECCcH-HHHHHHHHHhhcCCEEEEEeecCCCCCCcchhhhhhccceEEEE Confidence 469999999998 689999999999999999998643 3445566677899999964 No 93 >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=97.67 E-value=0.00047 Score=48.48 Aligned_cols=87 Identities=13% Similarity=0.003 Sum_probs=55.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHh--cCcEEEeEeeceeeeeechhhH-HHHHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAA--RYLIYGFLFFFFLVLGYSVIYF-RKMLYI 78 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~--k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l 78 (100) +++|+++||+|.. .+.+++++++++|+++.+|.... ...+++..+.. ++.++.++.. +......... ..+.++ T Consensus 191 ~~~d~vl~~~g~~-~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 267 (305) T cd08270 191 APVDLVVDSVGGP-QLARALELLAPGGTVVSVGSSSGEPAVFNPAAFVGGGGGRRLYTFFL--YDGEPLAADLARLLGLV 267 (305) T ss_pred CCceEEEECCCcH-HHHHHHHHhcCCCEEEEEeccCCCcccccHHHHhcccccceEEEEEc--cCHHHHHHHHHHHHHHH Confidence 3689999999975 78999999999999999997653 34456665555 6888886442 1100112233 334566 Q ss_pred hcCCCcceeeeece Q 034260 79 SGQTPKLIQATLFD 92 (100) Q Consensus 79 ~~~~~~~i~~~~~~ 92 (100) .++..+.+....++ T Consensus 268 ~~~~i~~~~~~~~~ 281 (305) T cd08270 268 AAGRLDPRIGWRGS 281 (305) T ss_pred HCCCccceeccEEc Confidence 66654443334444 No 94 >PTZ00354 alcohol dehydrogenase; Provisional Probab=97.66 E-value=0.00048 Score=48.85 Aligned_cols=57 Identities=18% Similarity=0.242 Sum_probs=45.4 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-Ccc-cChHHHHhcCcEEEeEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMT-VPLTPAAARYLIYGFLF 59 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~-i~~~~l~~k~~~i~Gs~ 59 (100) ++++|+++||+|. ..++.++++++++|+++.+|.... ... ++...+..+++++.++. T Consensus 208 ~~~~d~~i~~~~~-~~~~~~~~~l~~~g~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 266 (334) T PTZ00354 208 EKGVNLVLDCVGG-SYLSETAEVLAVDGKWIVYGFMGGAKVEKFNLLPLLRKRASIIFST 266 (334) T ss_pred CCCceEEEECCch-HHHHHHHHHhccCCeEEEEecCCCCcccccCHHHHHhhCCEEEeee Confidence 3579999999996 688999999999999999996543 233 66666778888998644 No 95 >cd05278 FDH_like Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde. This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typicall Probab=97.66 E-value=0.00036 Score=50.05 Aligned_cols=76 Identities=17% Similarity=0.225 Sum_probs=51.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccCh-HHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPL-TPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~-~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|+++||+|....++.+++.++++|+++.+|.......... ...+.+++++.+ +.....+.. +.+.++.+ T Consensus 235 ~~~d~vld~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~ 308 (347) T cd05278 235 RGVDCVIEAVGFEETFEQAVKVVRPGGTIANVGVYGKPDPLPLLGEWFGKNLTFKT------GLVPVRARMPELLDLIEE 308 (347) T ss_pred CCCcEEEEccCCHHHHHHHHHHhhcCCEEEEEcCCCCCcccCccchhhhceeEEEe------eccCchhHHHHHHHHHHc Confidence 5799999999986789999999999999999996654322212 223467888874 222223344 44566766 Q ss_pred CCCc Q 034260 81 QTPK 84 (100) Q Consensus 81 ~~~~ 84 (100) +..+ T Consensus 309 ~~l~ 312 (347) T cd05278 309 GKID 312 (347) T ss_pred CCCC Confidence 6443 No 96 >cd05288 PGDH Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino Probab=97.60 E-value=0.00051 Score=48.85 Aligned_cols=55 Identities=24% Similarity=0.298 Sum_probs=43.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-c-----ccChHHHHhcCcEEEeE Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-M-----TVPLTPAAARYLIYGFL 58 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~-----~i~~~~l~~k~~~i~Gs 58 (100) +++|+++||+|. ..++.++++++++|+++.+|..... . .++......++.++.++ T Consensus 213 ~~~d~vi~~~g~-~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 273 (329) T cd05288 213 DGIDVYFDNVGG-EILDAALTLLNKGGRIALCGAISQYNATEPPGPKNLGNIITKRLTMQGF 273 (329) T ss_pred CCceEEEEcchH-HHHHHHHHhcCCCceEEEEeeccCcccccccccccHHHHhhCcceEEee Confidence 479999999997 6899999999999999999865432 1 13345567889999863 No 97 >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an Probab=97.59 E-value=0.001 Score=47.45 Aligned_cols=76 Identities=14% Similarity=0.145 Sum_probs=54.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhc Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISG 80 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~ 80 (100) +++|+++||++......+++++++++|+++.+|..... ...+...++.++.++.+ +.....+.. +.+.++.+ T Consensus 224 ~~~d~vi~~~~~~~~~~~~~~~l~~~G~~i~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~ll~~ 297 (330) T cd08245 224 GGADVILVTVVSGAAAEAALGGLRRGGRIVLVGLPESPPFSPDIFPLIMKRQSIAG------STHGGRADLQEALDFAAE 297 (330) T ss_pred CCCCEEEECCCcHHHHHHHHHhcccCCEEEEECCCCCCccccchHHHHhCCCEEEE------eccCCHHHHHHHHHHHHc Confidence 36899999999878999999999999999999876432 22334557788999985 333333444 44556666 Q ss_pred CCCc Q 034260 81 QTPK 84 (100) Q Consensus 81 ~~~~ 84 (100) +..+ T Consensus 298 ~~l~ 301 (330) T cd08245 298 GKVK 301 (330) T ss_pred CCCc Confidence 6544 No 98 >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and so Probab=97.58 E-value=0.00045 Score=48.92 Aligned_cols=56 Identities=20% Similarity=0.177 Sum_probs=45.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|. ..+++++++++++|+++.+|.... +..+++..++.+++++.++. T Consensus 212 ~~~d~vi~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 268 (325) T cd05280 212 ARWAGAIDTVGG-DVLANLLKQTKYGGVVASCGNAAGPELTTTVLPFILRGVSLLGID 268 (325) T ss_pred CCccEEEECCch-HHHHHHHHhhcCCCEEEEEecCCCCccccccchheeeeeEEEEEE Confidence 468999999998 589999999999999999997653 33555555667899998644 No 99 >cd08241 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic Probab=97.50 E-value=0.0014 Score=45.83 Aligned_cols=56 Identities=16% Similarity=0.341 Sum_probs=44.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcc-cChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMT-VPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~-i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|. ..++.++++++++|+++.+|....... ++......+++++.++. T Consensus 207 ~~~d~v~~~~g~-~~~~~~~~~~~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 263 (323) T cd08241 207 RGVDVVYDPVGG-DVFEASLRSLAWGGRLLVIGFASGEIPQIPANLLLLKNISVVGVY 263 (323) T ss_pred CCcEEEEECccH-HHHHHHHHhhccCCEEEEEccCCCCcCcCCHHHHhhcCcEEEEEe Confidence 479999999997 678999999999999999997654332 45555677899998643 No 100 >cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acid Probab=97.48 E-value=0.0012 Score=47.44 Aligned_cols=35 Identities=29% Similarity=0.413 Sum_probs=30.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) ++|+|+++||+|.. .+++++++++++|+++.+|.. T Consensus 222 ~~gvd~vid~~g~~-~~~~~~~~l~~~G~iv~~G~~ 256 (345) T cd08293 222 PEGVDVYFDNVGGE-ISDTVISQMNENSHIILCGQI 256 (345) T ss_pred CCCceEEEECCCcH-HHHHHHHHhccCCEEEEEeee Confidence 35799999999985 579999999999999999853 No 101 >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. Probab=97.43 E-value=0.0021 Score=45.55 Aligned_cols=83 Identities=14% Similarity=0.140 Sum_probs=55.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) ++|++++|+|.. ...+++++++++|+++.+|..... ..++......++.++.+ +..+...+. +.+.++.++ T Consensus 226 ~~d~v~~~~g~~-~~~~~~~~~~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~ 298 (332) T cd08259 226 GADVVIELVGSP-TIEESLRSLNKGGRLVLIGNVTPDPAPLRPGLLILKEIRIIG------SISATKADVEEALKLVKEG 298 (332) T ss_pred CCCEEEECCChH-HHHHHHHHhhcCCEEEEEcCCCCCCcCCCHHHHHhCCcEEEE------ecCCCHHHHHHHHHHHHcC Confidence 589999999975 588999999999999999876532 22344445567888874 333334444 455667666 Q ss_pred CCcceeeeecee Q 034260 82 TPKLIQATLFDL 93 (100) Q Consensus 82 ~~~~i~~~~~~~ 93 (100) ..+.+.+..+++ T Consensus 299 ~l~~~~~~~~~~ 310 (332) T cd08259 299 KIKPVIDRVVSL 310 (332) T ss_pred CCccceeEEEcH Confidence 544444445443 No 102 >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Probab=97.41 E-value=0.0011 Score=46.54 Aligned_cols=55 Identities=22% Similarity=0.264 Sum_probs=40.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcc---cChHHHH--hcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMT---VPLTPAA--ARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~---i~~~~l~--~k~~~i~G 57 (100) ++++|+++||+|. ..++.++++++++|+++.+|....+.+ ....... .+++++.+ T Consensus 206 ~~~~d~vl~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~ 265 (320) T cd08243 206 PGGFDKVLELVGT-ATLKDSLRHLRPGGIVCMTGLLGGQWTLEDFNPMDDIPSGVNLTLTG 265 (320) T ss_pred CCCceEEEECCCh-HHHHHHHHHhccCCEEEEEccCCCCcccCCcchhhhhhhccceEEEe Confidence 4579999999997 689999999999999999997543221 2222222 56777764 No 103 >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding Probab=97.38 E-value=0.0023 Score=44.63 Aligned_cols=56 Identities=21% Similarity=0.284 Sum_probs=44.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|.. .+..++++++++|+++.+|.... ...+++..++.+++++.++. T Consensus 207 ~~~d~vi~~~g~~-~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 263 (323) T cd05276 207 RGVDVILDMVGGD-YLARNLRALAPDGRLVLIGLLGGAKAELDLAPLLRKRLTLTGST 263 (323) T ss_pred CCeEEEEECCchH-HHHHHHHhhccCCEEEEEecCCCCCCCCchHHHHHhCCeEEEee Confidence 5799999999975 48889999999999999997643 34556666667899999754 No 104 >cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone Probab=97.34 E-value=0.0024 Score=44.43 Aligned_cols=55 Identities=24% Similarity=0.300 Sum_probs=43.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l~~k~~~i~G 57 (100) ++++|++++|+|. ...+.++++++++|+++.+|..... ..+++..+..+++++.+ T Consensus 203 ~~~~d~vl~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~ 258 (320) T cd05286 203 GRGVDVVYDGVGK-DTFEGSLDSLRPRGTLVSFGNASGPVPPFDLLRLSKGSLFLTR 258 (320) T ss_pred CCCeeEEEECCCc-HhHHHHHHhhccCcEEEEEecCCCCCCccCHHHHHhcCcEEEE Confidence 3579999999997 5889999999999999999976543 23455555578888874 No 105 >cd08290 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann f Probab=97.32 E-value=0.0018 Score=46.38 Aligned_cols=55 Identities=13% Similarity=0.197 Sum_probs=44.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) ++|+++||+|.. ....++++++++|+++.+|.... +..+++..++.++.++.++. T Consensus 221 ~~d~vld~~g~~-~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 276 (341) T cd08290 221 RPKLALNCVGGK-SATELARLLSPGGTMVTYGGMSGQPVTVPTSLLIFKDITLRGFW 276 (341) T ss_pred CceEEEECcCcH-hHHHHHHHhCCCCEEEEEeccCCCCcccCHHHHhhCCceEEEEe Confidence 689999999985 67789999999999999986543 34566666778999998644 No 106 >cd08252 AL_MDR Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, whil Probab=97.28 E-value=0.0012 Score=47.13 Aligned_cols=55 Identities=13% Similarity=0.260 Sum_probs=44.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|....+..++++++++|+++.+|... ..++...+..+++++.++. T Consensus 216 ~~~d~vl~~~~~~~~~~~~~~~l~~~g~~v~~g~~~--~~~~~~~~~~~~~~~~~~~ 270 (336) T cd08252 216 EPVDYIFCLTDTDQHWDAMAELIAPQGHICLIVDPQ--EPLDLGPLKSKSASFHWEF 270 (336) T ss_pred CCCCEEEEccCcHHHHHHHHHHhcCCCEEEEecCCC--CcccchhhhcccceEEEEE Confidence 479999999998789999999999999999998653 3455555557888988644 No 107 >KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Probab=97.25 E-value=0.0016 Score=47.51 Aligned_cols=88 Identities=13% Similarity=0.037 Sum_probs=62.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC-CCcccChHHHHhcCcEEEeEeeceeeeee---chhhH-HH---H Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH-HDMTVPLTPAAARYLIYGFLFFFFLVLGY---SVIYF-RK---M 75 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~-~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~---~~~~~-~~---i 75 (100) ++-+.++|+|..+ -.+..+.+..||+.+..|... +|++++...+++|++.++|-|+ +.|.- .++.+ +. + T Consensus 233 ~prLalNcVGGks-a~~iar~L~~GgtmvTYGGMSkqPv~~~ts~lIFKdl~~rGfWv--t~W~~~~~~pe~~~~~i~~~ 309 (354) T KOG0025|consen 233 RPRLALNCVGGKS-ATEIARYLERGGTMVTYGGMSKQPVTVPTSLLIFKDLKLRGFWV--TRWKKEHKSPEERKEMIDEL 309 (354) T ss_pred CceEEEeccCchh-HHHHHHHHhcCceEEEecCccCCCcccccchheeccceeeeeee--eehhhccCCcHHHHHHHHHH Confidence 4778999999864 556678899999999998665 5889999999999999998775 55532 12222 22 2 Q ss_pred -HHHhcCCCcceeeeeceee Q 034260 76 -LYISGQTPKLIQATLFDLF 94 (100) Q Consensus 76 -~~l~~~~~~~i~~~~~~~~ 94 (100) .++..+..+.+.+..-+|+ T Consensus 310 ~~l~~~G~i~~~~~e~v~L~ 329 (354) T KOG0025|consen 310 CDLYRRGKLKAPNCEKVPLA 329 (354) T ss_pred HHHHHcCeeccccceeeech Confidence 3445566665555555554 No 108 >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family. Members of this family are putative quinone oxidoreductases that belong to the broader superfamily (modeled by Pfam pfam00107) of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxiooreductases. The alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, and members are likely to be quinone oxidoreductases instead. A member of this family in Homo sapiens, PIG3, is induced by p53 but is otherwise uncharacterized. Probab=97.21 E-value=0.004 Score=43.60 Aligned_cols=56 Identities=20% Similarity=0.250 Sum_probs=45.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|++++|+|. .....++++++++|+++.+|.... ...+++..++.+++++.++. T Consensus 207 ~~~d~~i~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~ 263 (325) T TIGR02824 207 KGVDVILDIVGG-SYLNRNIKALALDGRIVQIGFQGGRKAELDLGPLLAKRLTITGST 263 (325) T ss_pred CCeEEEEECCch-HHHHHHHHhhccCcEEEEEecCCCCcCCCChHHHHhcCCEEEEEe Confidence 479999999997 478899999999999999997642 23566666668999999644 No 109 >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=97.18 E-value=0.0045 Score=43.44 Aligned_cols=53 Identities=28% Similarity=0.385 Sum_probs=40.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|. ...+.++++++++|+++.+|... . .++.....+++++.+.. T Consensus 210 ~~~d~v~~~~~~-~~~~~~~~~l~~~g~~v~~~~~~-~--~~~~~~~~~~~~~~~~~ 262 (326) T cd08272 210 RGFDVVFDTVGG-ETLDASFEAVALYGRVVSILGGA-T--HDLAPLSFRNATYSGVF 262 (326) T ss_pred CCCcEEEECCCh-HHHHHHHHHhccCCEEEEEecCC-c--cchhhHhhhcceEEEEE Confidence 479999999998 46888999999999999998764 2 23333347788887543 No 110 >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts et Probab=97.03 E-value=0.0062 Score=42.32 Aligned_cols=80 Identities=16% Similarity=0.239 Sum_probs=50.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEeEeeceeeeeechhhH-HHHHHHhcC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGFLFFFFLVLGYSVIYF-RKMLYISGQ 81 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~Gs~~~~g~~~~~~~~~-~~i~~l~~~ 81 (100) +++|+++||+|.. ..+.++++++++|+++.+|....... ....++.++.... .....+.+ +.+.++.++ T Consensus 207 ~~~d~v~~~~~~~-~~~~~~~~l~~~g~~v~~g~~~~~~~----~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~ 276 (309) T cd05289 207 GGVDAVLDTVGGE-TLARSLALVKPGGRLVSIAGPPPAEQ----AAKRRGVRAGFVF-----VEPDGEQLAELAELVEAG 276 (309) T ss_pred CCceEEEECCchH-HHHHHHHHHhcCcEEEEEcCCCcchh----hhhhccceEEEEE-----ecccHHHHHHHHHHHHCC Confidence 4689999999986 78999999999999999997654211 3345566666321 11112334 445566555 Q ss_pred CCcceeeeece Q 034260 82 TPKLIQATLFD 92 (100) Q Consensus 82 ~~~~i~~~~~~ 92 (100) ..+.+.+..++ T Consensus 277 ~~~~~~~~~~~ 287 (309) T cd05289 277 KLRPVVDRVFP 287 (309) T ss_pred CEEEeeccEEc Confidence 43333334444 No 111 >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Probab=97.03 E-value=0.003 Score=46.25 Aligned_cols=57 Identities=21% Similarity=0.205 Sum_probs=44.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC---C-ccc---ChHHHHhcCcEEEeEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH---D-MTV---PLTPAAARYLIYGFLF 59 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~---~-~~i---~~~~l~~k~~~i~Gs~ 59 (100) ++|+|+.||++|. ..++..+..++..+|+.++|.-.. + .+. .+..++.++++++|-+ T Consensus 217 P~GIDvyfeNVGg-~v~DAv~~~ln~~aRi~~CG~IS~YN~~~~~~gp~~l~~l~~kr~~v~Gfi 280 (340) T COG2130 217 PKGIDVYFENVGG-EVLDAVLPLLNLFARIPVCGAISQYNAPELPPGPRRLPLLMAKRLRVQGFI 280 (340) T ss_pred CCCeEEEEEcCCc-hHHHHHHHhhccccceeeeeehhhcCCCCCCCCcchhhHHHhhhheeEEEE Confidence 4689999999998 599999999999999999997432 1 221 2345778899999744 No 112 >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts Probab=96.96 E-value=0.0063 Score=42.52 Aligned_cols=54 Identities=22% Similarity=0.341 Sum_probs=43.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGF 57 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~G 57 (100) +++|++++|+|.. ..+.++++++++|+++.+|.......+++..++.+..++.+ T Consensus 212 ~~~d~vi~~~~~~-~~~~~~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~ 265 (325) T cd08253 212 QGVDVIIEVLANV-NLAKDLDVLAPGGRIVVYGSGGLRGTIPINPLMAKEASIRG 265 (325) T ss_pred CceEEEEECCchH-HHHHHHHhhCCCCEEEEEeecCCcCCCChhHHHhcCceEEe Confidence 4799999999985 67888999999999999997654445666666677888874 No 113 >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=96.95 E-value=0.01 Score=41.95 Aligned_cols=56 Identities=13% Similarity=0.080 Sum_probs=42.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-----------------cccChHHHHhcCcEEEeEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-----------------MTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-----------------~~i~~~~l~~k~~~i~Gs~ 59 (100) +++|+++||+|.. ..+.++++++++|+++.+|..... .++++..+..++++++++. T Consensus 205 ~~~d~v~~~~g~~-~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 277 (337) T cd08275 205 EGVDIVLDALGGE-DTRKSYDLLKPMGRLVVYGAANLVTGEKRSWFKLAKKWWNRPKVDPMKLISENKSVLGFN 277 (337) T ss_pred CCceEEEECCcHH-HHHHHHHhhccCcEEEEEeecCCcCcccccccccccccccccccCHHHHhhcCceEEEee Confidence 4689999999974 688999999999999999876421 1223345678889988643 No 114 >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model. Probab=96.94 E-value=0.0087 Score=42.71 Aligned_cols=52 Identities=6% Similarity=0.217 Sum_probs=40.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGF 57 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~G 57 (100) +++|+++||+|....+..++++++++|+++.++.. ..+++..+..+++++.+ T Consensus 215 ~~vd~vl~~~~~~~~~~~~~~~l~~~G~~v~~~~~---~~~~~~~~~~~~~~~~~ 266 (336) T TIGR02817 215 EAVSYVFSLTHTDQHFKEIVELLAPQGRFALIDDP---AELDISPFKRKSISLHW 266 (336) T ss_pred CCCCEEEEcCCcHHHHHHHHHHhccCCEEEEEccc---ccccchhhhhcceEEEE Confidence 47999999997777899999999999999988532 34555556667777764 No 115 >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=96.68 E-value=0.02 Score=40.17 Aligned_cols=38 Identities=29% Similarity=0.362 Sum_probs=28.8 Q ss_pred CCcccEEEEccCh-HHHHHHHHHhccCCCEEEEecCCCC Q 034260 2 GAGIDVSFDCAGL-NKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 2 G~G~D~vie~~G~-~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) ++++|+++||+|. ......+...++++|+++.+|.... T Consensus 206 ~~~~d~vi~~~~~~~~~~~~~~~~l~~~g~~i~~g~~~~ 244 (319) T cd08267 206 GEKYDVIFDAVGNSPFSLYRASLALKPGGRYVSVGGGPS 244 (319) T ss_pred CCCCcEEEECCCchHHHHHHhhhccCCCCEEEEeccccc Confidence 3579999999994 3344455555999999999997654 No 116 >KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Probab=96.39 E-value=0.012 Score=43.21 Aligned_cols=55 Identities=20% Similarity=0.248 Sum_probs=44.6 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-----Cccc-ChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-----DMTV-PLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-----~~~i-~~~~l~~k~~~i~G 57 (100) ..|+|+-||.+|. ..++..+..++..||++++|+-.. +..+ +...++.|+++|+| T Consensus 221 P~GIDiYfeNVGG-~~lDavl~nM~~~gri~~CG~ISqYN~~~~~~~~~l~~ii~Kr~~iqg 281 (343) T KOG1196|consen 221 PEGIDIYFENVGG-KMLDAVLLNMNLHGRIAVCGMISQYNLENPEGLHNLSTIIYKRIRIQG 281 (343) T ss_pred CCcceEEEeccCc-HHHHHHHHhhhhccceEeeeeehhccccCCccccchhhheeeeEEeee Confidence 3589999999998 589999999999999999997542 2222 44567899999997 No 117 >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Probab=96.35 E-value=0.009 Score=44.24 Aligned_cols=92 Identities=20% Similarity=0.275 Sum_probs=52.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChH-------HHHhcCcEEEeEeeceeeeeechhhHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLT-------PAAARYLIYGFLFFFFLVLGYSVIYFR 73 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~-------~l~~k~~~i~Gs~~~~g~~~~~~~~~~ 73 (100) +.++|+|+||+|.. +...++..+..+|+...++..... ...+.. .+......+.+-.+..+....+.+..+ T Consensus 223 ~~~~DvVlD~vg~~-~~~~~~~~l~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 301 (347) T KOG1198|consen 223 GKGVDVVLDCVGGS-TLTKSLSCLLKGGGGAYIGLVGDELANYKLDDLWQSANGIKLYSLGLKGVNYRWLYFVPSAEYLK 301 (347) T ss_pred CCCccEEEECCCCC-ccccchhhhccCCceEEEEeccccccccccccchhhhhhhhheeeeeeccceeeeeecCCHHHHH Confidence 46899999999985 788888889988887777766542 111111 111122222222221122233344444 Q ss_pred HH-HHHhcCCCcceeeeeceee Q 034260 74 KM-LYISGQTPKLIQATLFDLF 94 (100) Q Consensus 74 ~i-~~l~~~~~~~i~~~~~~~~ 94 (100) .+ .++..+..+......+|++ T Consensus 302 ~l~~~ie~gkikp~i~~~~p~~ 323 (347) T KOG1198|consen 302 ALVELIEKGKIKPVIDSVYPFS 323 (347) T ss_pred HHHHHHHcCcccCCcceeeeHH Confidence 43 5677777666666666654 No 118 >cd08249 enoyl_reductase_like enoyl_reductase_like. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol de Probab=96.32 E-value=0.0063 Score=43.90 Aligned_cols=38 Identities=16% Similarity=0.235 Sum_probs=33.6 Q ss_pred CCcccEEEEccChHHHHHHHHHhccC--CCEEEEecCCCC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRA--GDKVCLVGMGHH 39 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~--gGrvv~vG~~~~ 39 (100) ++++|+++|++|.+..++++++++++ +|+++.+|.... T Consensus 219 ~~~~d~vl~~~g~~~~~~~~~~~l~~~~~g~~v~~g~~~~ 258 (339) T cd08249 219 GGKLRYALDCISTPESAQLCAEALGRSGGGKLVSLLPVPE 258 (339) T ss_pred CCCeeEEEEeeccchHHHHHHHHHhccCCCEEEEecCCCc Confidence 45799999999987789999999999 999999987654 No 119 >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catal Probab=96.27 E-value=0.052 Score=38.43 Aligned_cols=55 Identities=24% Similarity=0.242 Sum_probs=42.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFLF 59 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs~ 59 (100) ++|.++||+|. ..+..++..++.+|+++.+|.... +.++++..++.++.++.|+. T Consensus 212 ~~~~~~d~~~~-~~~~~~~~~~~~~g~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~ 267 (324) T cd08288 212 RWAGAVDTVGG-HTLANVLAQTRYGGAVAACGLAGGADLPTTVMPFILRGVTLLGID 267 (324) T ss_pred cccEEEECCcH-HHHHHHHHHhcCCCEEEEEEecCCCCCCcchhhhhccccEEEEEE Confidence 57889999997 468889999999999999997642 33455555668899999643 No 120 >smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases. Probab=96.25 E-value=0.021 Score=39.09 Aligned_cols=53 Identities=17% Similarity=0.307 Sum_probs=40.2 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--CcccChHHHHhcCcEEEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--DMTVPLTPAAARYLIYGF 57 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~~~i~~~~l~~k~~~i~G 57 (100) +++|+++||+|. ..++.+++.++++|+++.+|.... ...+++.. +.++.++.+ T Consensus 174 ~~~d~vi~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~-~~~~~~~~~ 228 (288) T smart00829 174 RGVDVVLNSLAG-EFLDASLRCLAPGGRFVEIGKRDIRDNSQLGMAP-FRRNVSYHA 228 (288) T ss_pred CCcEEEEeCCCH-HHHHHHHHhccCCcEEEEEcCcCCccccccchhh-hcCCceEEE Confidence 479999999995 688999999999999999997642 23444444 456677764 No 121 >cd05195 enoyl_red enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase Probab=96.18 E-value=0.0095 Score=40.77 Aligned_cols=54 Identities=13% Similarity=0.185 Sum_probs=39.6 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC--cccChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD--MTVPLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~--~~i~~~~l~~k~~~i~G 57 (100) ++++|+++||+|.. .++.++++++++|+++.+|..... ..++... ..+..++.+ T Consensus 177 ~~~~d~vi~~~~~~-~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~-~~~~~~~~~ 232 (293) T cd05195 177 GRGVDVVLNSLSGE-LLRASWRCLAPFGRFVEIGKRDILSNSKLGMRP-FLRNVSFSS 232 (293) T ss_pred CCCceEEEeCCCch-HHHHHHHhcccCceEEEeeccccccCCccchhh-hccCCeEEE Confidence 45799999999986 899999999999999999976532 2233332 334555553 No 122 >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Probab=96.16 E-value=0.032 Score=39.68 Aligned_cols=55 Identities=18% Similarity=0.263 Sum_probs=41.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-----------cccChHHHHhcCcEEEeE Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-----------MTVPLTPAAARYLIYGFL 58 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-----------~~i~~~~l~~k~~~i~Gs 58 (100) ++++|+++||+|. ..+..+++.++++|+++.+|..... ..++ ...+.++.++.++ T Consensus 205 ~~~vd~v~~~~g~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~ 270 (329) T cd08250 205 PKGVDVVYESVGG-EMFDTCVDNLALKGRLIVIGFISGYQSGTGPSPVKGATLP-PKLLAKSASVRGF 270 (329) T ss_pred CCCCeEEEECCcH-HHHHHHHHHhccCCeEEEEecccCCcccCccccccccccc-HHHhhcCceEEEE Confidence 3579999999997 6899999999999999999876421 1222 2346788888853 No 123 >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Probab=96.16 E-value=0.011 Score=42.15 Aligned_cols=46 Identities=22% Similarity=0.252 Sum_probs=35.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC-cccChHHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD-MTVPLTPA 48 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~-~~i~~~~l 48 (100) |+++|+++||+|. ..+.+++++++++|+++.+|..... ..++...+ T Consensus 207 ~~~~d~vl~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~ 253 (327) T PRK10754 207 GKKVRVVYDSVGK-DTWEASLDCLQRRGLMVSFGNASGPVTGVNLGIL 253 (327) T ss_pred CCCeEEEEECCcH-HHHHHHHHHhccCCEEEEEccCCCCCCCcCHHHH Confidence 3579999999997 5788999999999999999976532 23444443 No 124 >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=96.10 E-value=0.029 Score=39.23 Aligned_cols=55 Identities=25% Similarity=0.362 Sum_probs=43.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHHHhcCcEEEeE Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPAAARYLIYGFL 58 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l~~k~~~i~Gs 58 (100) +++|++++|+|. .....++++++++|+++.+|.... ...++....+.++.++.+. T Consensus 212 ~~~d~vi~~~~~-~~~~~~~~~l~~~g~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~ 267 (328) T cd08268 212 KGVDVVFDPVGG-PQFAKLADALAPGGTLVVYGALSGEPTPFPLKAALKKSLTFRGY 267 (328) T ss_pred CCceEEEECCch-HhHHHHHHhhccCCEEEEEEeCCCCCCCCchHHHhhcCCEEEEE Confidence 479999999998 678899999999999999987643 2344554457888888853 No 125 >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=96.10 E-value=0.035 Score=39.37 Aligned_cols=36 Identities=25% Similarity=0.361 Sum_probs=31.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) +++|+++||+|... ++.++++++++|+++.+|.... T Consensus 202 ~~~d~vl~~~~~~~-~~~~~~~l~~~g~~v~~g~~~~ 237 (331) T cd08273 202 GGVDVVFDGVGGES-YEESYAALAPGGTLVCYGGNSS 237 (331) T ss_pred CCceEEEECCchHH-HHHHHHHhcCCCEEEEEccCCC Confidence 47999999999865 8999999999999999997754 No 126 >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Probab=95.68 E-value=0.021 Score=40.97 Aligned_cols=34 Identities=21% Similarity=0.186 Sum_probs=30.7 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) +++|+++||+|.. ..+.++++++++||++.+|.. T Consensus 226 ~~vd~vi~~~g~~-~~~~~~~~l~~~G~~v~~g~~ 259 (350) T cd08248 226 GKFDVILDTVGGD-TEKWALKLLKKGGTYVTLVSP 259 (350) T ss_pred CCCCEEEECCChH-HHHHHHHHhccCCEEEEecCC Confidence 4699999999986 899999999999999999864 No 127 >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. Probab=95.28 E-value=0.027 Score=41.41 Aligned_cols=37 Identities=27% Similarity=0.397 Sum_probs=33.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .|+|+|+||+|...+.+.+.++++.|++.|+++.+.. T Consensus 88 ~gvDiVie~tG~~~s~e~a~~~l~aGa~~V~~SaP~~ 124 (325) T TIGR01532 88 LGVDLVLDCTGVYGNREQGERHIRAGAKRVLFSHPGA 124 (325) T ss_pred cCCCEEEEccchhccHHHHHHHHHcCCeEEEecCCCc Confidence 4899999999999999999999999999999998743 No 128 >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcoh Probab=95.05 E-value=0.054 Score=38.07 Aligned_cols=36 Identities=17% Similarity=0.248 Sum_probs=30.0 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ++++|++++|+|.. ....++++++++|+++.+|... T Consensus 207 ~~~~d~vi~~~~~~-~~~~~~~~l~~~G~~v~~~~~~ 242 (325) T cd08271 207 GRGVDAVLDTVGGE-TAAALAPTLAFNGHLVCIQGRP 242 (325) T ss_pred CCCCcEEEECCCcH-hHHHHHHhhccCCEEEEEcCCC Confidence 35799999999985 4567899999999999987543 No 129 >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain. GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold. Probab=94.97 E-value=0.032 Score=36.61 Aligned_cols=38 Identities=24% Similarity=0.438 Sum_probs=31.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) .|+|+|+||+|.-.+.+.+-..++.|.+-|+++.+.++ T Consensus 86 ~gvDiVie~tG~f~~~~~~~~hl~~GakkViisap~~~ 123 (149) T smart00846 86 LGVDIVVECTGKFTTREKASAHLKAGAKKVIISAPAKD 123 (149) T ss_pred cCCeEEEeccccccchHHHHHHHHcCCCEEEeCCCCCC Confidence 37899999999877777777888888899999888654 No 130 >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-termi Probab=94.90 E-value=0.053 Score=39.16 Aligned_cols=34 Identities=12% Similarity=0.231 Sum_probs=30.3 Q ss_pred CCcccEEEEccChHHHHHHHHHhcc---CCCEEEEec Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATR---AGDKVCLVG 35 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~---~gGrvv~vG 35 (100) ++++|+++||+|...+...++++++ ++|+++.++ T Consensus 223 ~~~~d~vl~~~g~~~~~~~~~~~l~~~~~~G~~v~~~ 259 (352) T cd08247 223 QGKFDLILDCVGGYDLFPHINSILKPKSKNGHYVTIV 259 (352) T ss_pred CCCceEEEECCCCHHHHHHHHHHhCccCCCCEEEEEe Confidence 4689999999998778899999999 999999764 No 131 >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Probab=94.76 E-value=0.063 Score=40.91 Aligned_cols=40 Identities=15% Similarity=0.257 Sum_probs=33.8 Q ss_pred cccEEEEccChHHHHH-HHHHhccCCCEEEEecCCCCCccc Q 034260 4 GIDVSFDCAGLNKTMS-TVLDATRAGDKVCLVGMGHHDMTV 43 (100) Q Consensus 4 G~D~vie~~G~~~~~~-~al~~l~~gGrvv~vG~~~~~~~i 43 (100) ++|++++|+|....++ ..++.+++|+.++.+|....++.+ T Consensus 267 ~aDVVI~aTG~~~vI~~~~~~~mK~GailiNvG~~d~Eid~ 307 (425) T PRK05476 267 LGDIFVTATGNKDVITAEHMEAMKDGAILANIGHFDNEIDV 307 (425) T ss_pred CCCEEEECCCCHHHHHHHHHhcCCCCCEEEEcCCCCCccCh Confidence 6899999999988886 688999999999999988755443 No 132 >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate. The enzyme exists as a tetramer of identical subunits, each containing 2 conserved functional domains: an NAD-binding domain, and a highly conserved catalytic domain []. The enzyme has been found to bind to actin and tropomyosin, and may thus have a role in cytoskeleton assembly. Alternatively, the cytoskeleton may provide a framework for precise positioning of the glycolytic enzymes, thus permitting efficient passage of metabolites from enzyme to enzyme []. GAPDH displays diverse non-glycolytic functions as well, its role depending upon its subcellular location. For instance, the translocation of GAPDH to the nucleus acts as a signalling mechanism for programmed cell death, or apoptosis []. The accumulation of GAPDH within the nucleus is involved in the induction of apoptosis, where GAPDH functions in the activation of transcription. The presence of GAPDH is associated with the synthesis of pro-apoptotic proteins like BAX, c-JUN and GAPDH itself. GAPDH has been implicated in certain neurological diseases: GAPDH is able to bind to the gene products from neurodegenerative disorders such as Huntington's disease, Alzheimer's disease, Parkinson's disease and Machado-Joseph disease through stretches encoded by their CAG repeats. Abnormal neuronal apoptosis is associated with these diseases. Propargylamines such as deprenyl increase neuronal survival by interfering with apoptosis signalling pathways via their binding to GAPDH, which decreases the synthesis of pro-apoptotic proteins []. This entry represents the N-terminal domain which is a Rossmann NAD(P) binding fold.; GO: 0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor, 0055114 oxidation-reduction process; PDB: 2G82_Q 1CER_R 1ZNQ_Q 3GPD_G 1U8F_R 3DOC_B 2YYY_A 1GPD_G 4GPD_1 2I5P_O .... Probab=94.43 E-value=0.032 Score=36.75 Aligned_cols=37 Identities=24% Similarity=0.460 Sum_probs=32.0 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) |+|+|+||||.-.+.+.+-..++.|.+=|+++.+.++ T Consensus 88 gvDiVvEcTG~f~~~~~~~~hl~~GakkViisap~~~ 124 (151) T PF00044_consen 88 GVDIVVECTGKFRTRENAEAHLDAGAKKVIISAPSKD 124 (151) T ss_dssp TESEEEETSSSTHSHHHHTHHHHTTESEEEESSS-SS T ss_pred cccEEEeccccceecccccccccccccceeecccccc Confidence 6899999999988888888899999999999988764 No 133 >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Probab=94.24 E-value=0.15 Score=35.83 Aligned_cols=37 Identities=8% Similarity=0.231 Sum_probs=29.3 Q ss_pred CcccEEEEcc------ChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) +++|+|+... ..+..++++.+.|+|||++++.+.... T Consensus 145 ~~fD~Vi~~~v~~~~~d~~~~l~~~~r~LkpGG~l~i~~~~~~ 187 (272) T PRK11873 145 NSVDVIISNCVINLSPDKERVFKEAFRVLKPGGRFAISDVVLR 187 (272) T ss_pred CceeEEEEcCcccCCCCHHHHHHHHHHHcCCCcEEEEEEeecc Confidence 3689888543 445789999999999999999876543 No 134 >PLN02358 glyceraldehyde-3-phosphate dehydrogenase Probab=94.19 E-value=0.098 Score=38.76 Aligned_cols=38 Identities=18% Similarity=0.315 Sum_probs=33.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) .|+|+||||+|...+-+.+-..+..|.+.|++..+.++ T Consensus 94 ~gvDiVie~tG~~~s~~~a~~hl~aGak~ViiSap~~d 131 (338) T PLN02358 94 AGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKD 131 (338) T ss_pred cCCCEEEEcccchhhHHHHHHHHHCCCEEEEeCCCCCC Confidence 48999999999998889999999999999999977654 No 135 >cd08251 polyketide_synthase polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde a Probab=93.92 E-value=0.13 Score=35.56 Aligned_cols=35 Identities=17% Similarity=0.303 Sum_probs=31.0 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +++|+++||++. .....++++++++|+++.+|... T Consensus 188 ~~~d~v~~~~~~-~~~~~~~~~l~~~g~~v~~~~~~ 222 (303) T cd08251 188 RGVDVVINTLSG-EAIQKGLNCLAPGGRYVEIAMTA 222 (303) T ss_pred CCceEEEECCcH-HHHHHHHHHhccCcEEEEEeccC Confidence 579999999985 68899999999999999998764 No 136 >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Probab=93.64 E-value=0.071 Score=39.84 Aligned_cols=37 Identities=16% Similarity=0.270 Sum_probs=32.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) |+|+|+||+|.-.+.+.+...++.|.+=|++..+.++ T Consensus 104 gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d 140 (361) T PTZ00434 104 GVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASG 140 (361) T ss_pred CCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCC Confidence 7999999999988899999999999888889877643 No 137 >TIGR00936 ahcY adenosylhomocysteinase. This enzyme hydrolyzes adenosylhomocysteine as part of a cycle for the regeneration of the methyl donor S-adenosylmethionine. Species that lack this enzyme are likely to have adenosylhomocysteine nucleosidase (EC 3.2.2.9), an enzyme which also acts as 5'-methyladenosine nucleosidase (see TIGR01704). Probab=93.54 E-value=0.21 Score=37.87 Aligned_cols=43 Identities=12% Similarity=0.145 Sum_probs=34.4 Q ss_pred cccEEEEccChHHHHHH-HHHhccCCCEEEEecCCCCCcccChHHH Q 034260 4 GIDVSFDCAGLNKTMST-VLDATRAGDKVCLVGMGHHDMTVPLTPA 48 (100) Q Consensus 4 G~D~vie~~G~~~~~~~-al~~l~~gGrvv~vG~~~~~~~i~~~~l 48 (100) ++|++|+|+|....++. .++.+++|+.++.+|.... +++...+ T Consensus 250 ~aDVVItaTG~~~vI~~~~~~~mK~GailiN~G~~~~--eId~~aL 293 (406) T TIGR00936 250 IGDIFITATGNKDVIRGEHFENMKDGAIVANIGHFDV--EIDVKAL 293 (406) T ss_pred cCCEEEECCCCHHHHHHHHHhcCCCCcEEEEECCCCc--eeCHHHH Confidence 57999999999988875 8899999999999998743 3554443 No 138 >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Probab=93.42 E-value=0.17 Score=38.31 Aligned_cols=37 Identities=22% Similarity=0.250 Sum_probs=33.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .|+|+|+||+|...+-+.+-..++.|.+.|++..+.+ T Consensus 149 ~gvDiVie~TG~f~s~~~a~~hl~aGAkkV~iSap~~ 185 (395) T PLN03096 149 LGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGK 185 (395) T ss_pred cCCCEEEECcchhhhHHHHHHHHHCCCEEEEeCCCCC Confidence 4899999999998888899999999999999998754 No 139 >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Probab=93.21 E-value=0.16 Score=37.62 Aligned_cols=36 Identities=28% Similarity=0.284 Sum_probs=32.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) |+|+|+||+|...+-+.+-..++.|.+.|.+..+.+ T Consensus 89 gvDiVle~tG~f~s~~~a~~hl~aGak~V~iSap~~ 124 (331) T PRK15425 89 GVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSK 124 (331) T ss_pred CCCEEEEecchhhcHHHHHHHHHCCCEEEEeCCCCC Confidence 799999999998888888999999999999988754 No 140 >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Probab=92.95 E-value=0.24 Score=38.03 Aligned_cols=37 Identities=19% Similarity=0.242 Sum_probs=32.6 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .|+|+||||+|...+.+.+-..+..|.+.|++..+.. T Consensus 164 ~gVDiViE~TG~f~s~e~a~~hl~aGAkkV~iSAP~~ 200 (442) T PLN02237 164 LGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAK 200 (442) T ss_pred cCCCEEEEccChhhhHHHHHHHHhCCCEEEEECCCCC Confidence 4899999999998888899999999999999996643 No 141 >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. Probab=92.92 E-value=0.2 Score=36.99 Aligned_cols=36 Identities=22% Similarity=0.450 Sum_probs=32.0 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) |+|+|+||+|...+-+.+-..++.|.+.|++..+.. T Consensus 90 gvDiVle~tG~~~s~~~a~~hl~~Gak~V~iSap~~ 125 (327) T TIGR01534 90 GVDIVIECTGKFRDKEKLEGHLEAGAKKVLISAPSK 125 (327) T ss_pred CCCEEEEccchhhcHHHHHHHhhCCCEEEEeCCCCC Confidence 799999999998788888889999999999987754 No 142 >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Probab=92.87 E-value=0.24 Score=36.79 Aligned_cols=36 Identities=25% Similarity=0.327 Sum_probs=31.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) |+|+|+||+|...+.+.+-..++.|.+.|++..+.. T Consensus 90 gvDiV~e~tG~f~s~~~a~~hl~aGak~V~iSap~~ 125 (337) T PRK07403 90 GIDLIIESTGVFVTKEGASKHIQAGAKKVLITAPGK 125 (337) T ss_pred CCCEEEeccchhhhHHHHHHHhhCCcEEEEeCCCCC Confidence 799999999998888888889999999999987643 No 143 >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Probab=92.84 E-value=0.22 Score=37.06 Aligned_cols=36 Identities=19% Similarity=0.299 Sum_probs=31.4 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .|+|+|+||+|...+.+.+-..+..|.+.|.+..+. T Consensus 88 ~gvDiVle~tG~f~s~~~a~~hl~aGak~V~iSap~ 123 (343) T PRK07729 88 LGIDIVIEATGKFNSKEKAILHVEAGAKKVILTAPG 123 (343) T ss_pred cCCCEEEEccchhhhHhHHHHHHHcCCeEEEeCCCC Confidence 379999999999888888888899999999998664 No 144 >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Probab=92.79 E-value=0.22 Score=36.89 Aligned_cols=35 Identities=26% Similarity=0.276 Sum_probs=31.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) |+|+|+||+|...+.+.+-..+..|.+.|.+..+. T Consensus 88 gvDiVle~tG~~~s~~~a~~hl~aGak~V~iSap~ 122 (334) T PRK08955 88 GCDVVIEASGVMKTKALLQAYLDQGVKRVVVTAPV 122 (334) T ss_pred CCCEEEEccchhhcHHHHHHHHHCCCEEEEECCCC Confidence 79999999999888888999999999999998774 No 145 >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Probab=92.20 E-value=0.27 Score=36.41 Aligned_cols=36 Identities=28% Similarity=0.393 Sum_probs=31.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .|+|+|+||+|...+-+.+-..++.|.+.|++..+. T Consensus 90 ~gvDiVle~tG~~~s~~~a~~~l~aGAk~V~iSap~ 125 (336) T PRK13535 90 LGVDVVLDCTGVYGSREDGEAHIAAGAKKVLFSHPG 125 (336) T ss_pred cCCCEEEEccchhhhHHHHHHHHHcCCEEEEecCCc Confidence 489999999999888888889999999999998774 No 146 >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Probab=91.91 E-value=0.28 Score=36.37 Aligned_cols=37 Identities=19% Similarity=0.297 Sum_probs=32.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .|+|+|+||+|...+-+.+-..++.|.+.|.+..+.+ T Consensus 89 ~gvDiVle~tG~~~s~~~a~~~l~aGak~V~iSap~~ 125 (337) T PTZ00023 89 NGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPPK 125 (337) T ss_pred cCCCEEEEecchhcCHHHHHHHhhCCCEEEEeCCCCC Confidence 4799999999998788888889999999999987654 No 147 >PLN02494 adenosylhomocysteinase Probab=90.54 E-value=0.33 Score=37.60 Aligned_cols=37 Identities=14% Similarity=0.260 Sum_probs=32.0 Q ss_pred cccEEEEccChHHHH-HHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTM-STVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~-~~al~~l~~gGrvv~vG~~~~~ 40 (100) .+|++++|+|....+ .+.++.+++++.++.+|.+... T Consensus 309 ~ADVVI~tTGt~~vI~~e~L~~MK~GAiLiNvGr~~~e 346 (477) T PLN02494 309 EADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNE 346 (477) T ss_pred hCCEEEECCCCccchHHHHHhcCCCCCEEEEcCCCCCc Confidence 579999999987664 8899999999999999987543 No 148 >PLN02272 glyceraldehyde-3-phosphate dehydrogenase Probab=89.30 E-value=0.55 Score=35.92 Aligned_cols=37 Identities=16% Similarity=0.303 Sum_probs=30.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) |+|+|+||+|...+.+.+...++.|.+=|++..+.++ T Consensus 174 gVDiVlesTG~f~s~e~a~~hl~aGAkkVVIdap~~d 210 (421) T PLN02272 174 GAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSAD 210 (421) T ss_pred CCCEEEEcCchhccHHHHHHHhhCCCCEEEECCCCCC Confidence 7999999999987888888888888766667766543 No 149 >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see []. Homoserine dehydrogenase (1.1.1.3 from EC) catalyses the third step in the aspartate pathway; theNAD(P)-dependent reduction of aspartate beta-semialdehyde into homoserine [, ]. Homoserine is an intermediate in the biosynthesis of threonine, isoleucine, and methionine. The enzyme can be found in a monofunctional form, in some bacteria and yeast, or a bifunctional form consisting of an N-terminal aspartokinase domain and a C-terminal homoserine dehydrogenase domain, as found in bacteria such as Escherichia coli and in plants. Structural analysis of the yeast monofunctional enzyme (P31116 from SWISSPROT) indicates that the enzyme is a dimer composed of three distinct regions; an N-terminal nucleotide-binding domain, a short central dimerisation region, and a C-terminal catalytic domain []. The N-terminal domain forms a modified Rossman fold, while the catalytic domain forms a novel alpha-beta mixed sheet. This entry represents the NAD(P)-binding domain of aspartate and homoserine dehydrogenase. Asparate dehydrogenase (1.4.1.21 from EC) is strictly specific for L-aspartate as substrate and catalyses the first step in NAD biosynthesis from aspartate. The enzyme has a higher affinity for NAD+ than NADP+ []. Note that the C terminus of the protein contributes a helix to this domain that is not covered by this model.; GO: 0016491 oxidoreductase activity, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 3ING_A 3MTJ_A 3DO5_A 3JSA_A 3C8M_A 1J5P_A 1H2H_A 2EJW_E 1TVE_A 1EBU_D .... Probab=89.26 E-value=0.81 Score=28.10 Aligned_cols=30 Identities=23% Similarity=0.333 Sum_probs=20.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCL 33 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~ 33 (100) .+|+++||++.....+-..++++.|=.+|. T Consensus 59 ~~dvvVE~t~~~~~~~~~~~~L~~G~~VVt 88 (117) T PF03447_consen 59 DIDVVVECTSSEAVAEYYEKALERGKHVVT 88 (117) T ss_dssp T-SEEEE-SSCHHHHHHHHHHHHTTCEEEE T ss_pred CCCEEEECCCchHHHHHHHHHHHCCCeEEE Confidence 589999998887766667777776655553 No 150 >TIGR00438 rrmJ cell division protein FtsJ. Probab=89.15 E-value=1.1 Score=29.83 Aligned_cols=36 Identities=8% Similarity=0.183 Sum_probs=26.7 Q ss_pred CcccEEEE-c----cCh------------HHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFD-C----AGL------------NKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie-~----~G~------------~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .++|+|+. + +|. ...++.+.+.+++||++++..... T Consensus 97 ~~~D~V~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~LkpgG~lvi~~~~~ 149 (188) T TIGR00438 97 DKVDVVMSDAAPNISGYWDIDHLRSIDLVELALDIAKEVLKPKGNFVVKVFQG 149 (188) T ss_pred CCccEEEcCCCCCCCCCccccHHHHHHHHHHHHHHHHHHccCCCEEEEEEccC Confidence 36899985 3 232 457889999999999999976443 No 151 >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Probab=87.80 E-value=0.61 Score=34.72 Aligned_cols=36 Identities=25% Similarity=0.381 Sum_probs=27.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) |+|+||||+|...+.+.+...++.|.+=|++..+.+ T Consensus 92 gvDiVie~TG~f~~~~~a~~hl~~Gakkviisaps~ 127 (342) T PTZ00353 92 GVQYVVECTGLYSTRSRCWGHVTGGAKGVFVAGQSA 127 (342) T ss_pred CCCEEEEcccccccHhhhhhhhhcCCCcEEEeCCCC Confidence 799999999998778888888887655444544443 No 152 >PRK08306 dipicolinate synthase subunit A; Reviewed Probab=85.50 E-value=2.5 Score=30.52 Aligned_cols=52 Identities=13% Similarity=0.009 Sum_probs=38.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGF 57 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~G 57 (100) .+|++|+|++....-+..++.+++++.++-++...+...+ .....+++++.+ T Consensus 210 ~aDiVI~t~p~~~i~~~~l~~~~~g~vIIDla~~pggtd~--~~a~~~Gv~~~~ 261 (296) T PRK08306 210 KIDIIFNTIPALVLTKEVLSKMPPEALIIDLASKPGGTDF--EYAEKRGIKALL 261 (296) T ss_pred CCCEEEECCChhhhhHHHHHcCCCCcEEEEEccCCCCcCe--eehhhCCeEEEE Confidence 5899999998765567788899999999988887665444 344455666663 No 153 >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Probab=85.42 E-value=1.9 Score=31.74 Aligned_cols=31 Identities=23% Similarity=0.347 Sum_probs=27.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|+.+.|.....+..++.+++||++++. T Consensus 149 ~fD~Ii~~~g~~~ip~~~~~~LkpgG~Lvv~ 179 (322) T PRK13943 149 PYDVIFVTVGVDEVPETWFTQLKEGGRVIVP 179 (322) T ss_pred CccEEEECCchHHhHHHHHHhcCCCCEEEEE Confidence 4899999999877778889999999998874 No 154 >PRK13301 putative L-aspartate dehydrogenase; Provisional Probab=85.38 E-value=1.5 Score=31.66 Aligned_cols=37 Identities=16% Similarity=0.174 Sum_probs=30.8 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ...+|+|+||++....-+-+...|+.|-.++++.... T Consensus 60 ~~~~DlVVE~A~~~av~e~~~~iL~~g~dlvv~SvGA 96 (267) T PRK13301 60 AWRPDLVVEAAGQQAIAEHAEGCLTAGLDMIICSAGA 96 (267) T ss_pred hcCCCEEEECCCHHHHHHHHHHHHhcCCCEEEEChhH Confidence 3568999999999888888899999888888876543 No 155 >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Probab=85.36 E-value=2.4 Score=28.50 Aligned_cols=32 Identities=16% Similarity=0.293 Sum_probs=25.3 Q ss_pred CcccEEEEccCh---HHHHHHHHHhccCCCEEEEe Q 034260 3 AGIDVSFDCAGL---NKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 3 ~G~D~vie~~G~---~~~~~~al~~l~~gGrvv~v 34 (100) ..+|+|+...+. ...++.+.+.+++||++++. T Consensus 110 ~~~D~V~~~~~~~~~~~~l~~~~~~LkpgG~lv~~ 144 (198) T PRK00377 110 EKFDRIFIGGGSEKLKEIISASWEIIKKGGRIVID 144 (198) T ss_pred CCCCEEEECCCcccHHHHHHHHHHHcCCCcEEEEE Confidence 358999986553 45788999999999999863 No 156 >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Probab=85.26 E-value=0.95 Score=33.60 Aligned_cols=37 Identities=24% Similarity=0.435 Sum_probs=30.5 Q ss_pred cccEEEEccChHHHHHHHHHhccC-CCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRA-GDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~-gGrvv~vG~~~~~ 40 (100) |+|+|+||+|.-..-+.+-+.+.. |.+-|+++.+.++ T Consensus 89 gvdiVve~Tg~f~~~e~~~~hl~agGaKkV~isap~~~ 126 (335) T COG0057 89 GVDIVVECTGKFTGREKAEKHLKAGGAKKVLISAPGKD 126 (335) T ss_pred CccEEEECCCCccchhhHHHHHHhcCCCEEEEcCCCCC Confidence 689999999987777777778877 4888889988764 No 157 >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]. In Escherichia coli and Mycobacterium tuberculosis, dihydrodipicolinate reductase has equal specificity for NADH and NADPH, however in Thermotoga maritima there it has a greater affinity for NADPH []. In addition, the enzyme is inhibited by high concentrations of its substrate, which consequently acts as a feedback control on the lysine biosynthesis pathway. In T. maritima, the enzyme also lacks N-terminal and C-terminal loops which are present in enzyme of the former two organisms. This entry represents the N-terminal domain of dihydrodipicolinate reductase which binds the dinucleotide NAD(P)H.; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0055114 oxidation-reduction process; PDB: 3QY9_D 1VM6_C 1ARZ_A 1DIH_A 1DRW_A 1DRV_A 1DRU_A 2DAP_A 1DAP_B 3DAP_A .... Probab=83.00 E-value=1.4 Score=27.72 Aligned_cols=33 Identities=15% Similarity=0.114 Sum_probs=22.1 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +|++||++ .++.....++.+...|.-+++|..+ T Consensus 68 ~DVvIDfT-~p~~~~~~~~~~~~~g~~~ViGTTG 100 (124) T PF01113_consen 68 ADVVIDFT-NPDAVYDNLEYALKHGVPLVIGTTG 100 (124) T ss_dssp -SEEEEES--HHHHHHHHHHHHHHT-EEEEE-SS T ss_pred CCEEEEcC-ChHHhHHHHHHHHhCCCCEEEECCC Confidence 79999999 5566767777776667777777654 No 158 >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Probab=81.45 E-value=2.6 Score=28.77 Aligned_cols=31 Identities=10% Similarity=0.120 Sum_probs=24.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+++-....+...+...+.|++||++++. T Consensus 145 ~fD~I~~~~~~~~~~~~l~~~LkpgG~lvi~ 175 (212) T PRK13942 145 PYDRIYVTAAGPDIPKPLIEQLKDGGIMVIP 175 (212) T ss_pred CcCEEEECCCcccchHHHHHhhCCCcEEEEE Confidence 5799876655566677888999999998874 No 159 >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases.; PDB: 3EEY_H 3LBY_A 3MTI_A. Probab=81.40 E-value=1.3 Score=28.95 Aligned_cols=24 Identities=21% Similarity=0.385 Sum_probs=19.6 Q ss_pred HHHHHHHHhccCCCEEEEecCCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .+++++++.+++||.++++-.++. T Consensus 73 ~Al~~al~lL~~gG~i~iv~Y~GH 96 (140) T PF06962_consen 73 KALEAALELLKPGGIITIVVYPGH 96 (140) T ss_dssp HHHHHHHHHEEEEEEEEEEE--ST T ss_pred HHHHHHHHhhccCCEEEEEEeCCC Confidence 478999999999999999988764 No 160 >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL. Probab=80.51 E-value=5.2 Score=23.95 Aligned_cols=32 Identities=16% Similarity=0.220 Sum_probs=24.5 Q ss_pred cccEEEEccCh---HHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGL---NKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~---~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+++-..+. ...++.+.+.+++||++++.. T Consensus 88 ~~D~v~~~~~~~~~~~~l~~~~~~Lk~gG~li~~~ 122 (124) T TIGR02469 88 EPDRVFIGGSGGLLQEILEAIWRRLRPGGRIVLNA 122 (124) T ss_pred CCCEEEECCcchhHHHHHHHHHHHcCCCCEEEEEe Confidence 57888865432 347889999999999998754 No 161 >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit. In some species, such as Rhodospirillum rubrum, the alpha chain is replaced by two shorter chains, both with some homology to the full-length alpha chain modeled here. These score below the trusted cutoff. Probab=80.48 E-value=2.2 Score=33.45 Aligned_cols=36 Identities=17% Similarity=0.308 Sum_probs=30.1 Q ss_pred CcccEEEEcc---ChHH---HHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCA---GLNK---TMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~---G~~~---~~~~al~~l~~gGrvv~vG~~~ 38 (100) +++|++|+|+ |.+. ..++.++.+++|+.+|=++... T Consensus 246 ~~~DIVI~TalipG~~aP~Lit~emv~~MKpGsvIVDlA~d~ 287 (511) T TIGR00561 246 KEVDIIITTALIPGKPAPKLITEEMVDSMKAGSVIVDLAAEQ 287 (511) T ss_pred CCCCEEEECcccCCCCCCeeehHHHHhhCCCCCEEEEeeeCC Confidence 4699999999 7654 6788899999999999888654 No 162 >PTZ00075 Adenosylhomocysteinase; Provisional Probab=80.06 E-value=1.3 Score=34.35 Aligned_cols=35 Identities=11% Similarity=0.137 Sum_probs=31.3 Q ss_pred cccEEEEccChHHHHH-HHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMS-TVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~-~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++.|+|....++ +.++.+++++.++-+|... T Consensus 309 ~ADIVI~atGt~~iI~~e~~~~MKpGAiLINvGr~d 344 (476) T PTZ00075 309 TADIFVTATGNKDIITLEHMRRMKNNAIVGNIGHFD 344 (476) T ss_pred cCCEEEECCCcccccCHHHHhccCCCcEEEEcCCCc Confidence 5899999999887775 8999999999999999885 No 163 >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Probab=79.90 E-value=3.8 Score=36.03 Aligned_cols=76 Identities=7% Similarity=0.130 Sum_probs=52.5 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC--CCcccChHHHHhcCcEEEeEeeceeee-eechhhHHH-HHH Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH--HDMTVPLTPAAARYLIYGFLFFFFLVL-GYSVIYFRK-MLY 77 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~--~~~~i~~~~l~~k~~~i~Gs~~~~g~~-~~~~~~~~~-i~~ 77 (100) |+|+|+|+..-.. +-++.++++++.+||..-+|-.. ...++- +....|+.++.|+.- -+. ....++++. ..+ T Consensus 1623 GrGVdlVLNSLae-EkLQASiRCLa~~GRFLEIGKfDLSqNspLG-MavfLkNvsfHGiLL--Dsvmege~e~~~ev~~L 1698 (2376) T KOG1202|consen 1623 GRGVDLVLNSLAE-EKLQASIRCLALHGRFLEIGKFDLSQNSPLG-MAVFLKNVSFHGILL--DSVMEGEEEMWREVAAL 1698 (2376) T ss_pred CCCeeeehhhhhH-HHHHHHHHHHHhcCeeeeecceecccCCcch-hhhhhcccceeeeeh--hhhhcCcHHHHHHHHHH Confidence 7899999998775 67999999999999999999654 233333 345688999997653 221 223344544 455 Q ss_pred HhcC Q 034260 78 ISGQ 81 (100) Q Consensus 78 l~~~ 81 (100) ++.+ T Consensus 1699 v~eG 1702 (2376) T KOG1202|consen 1699 VAEG 1702 (2376) T ss_pred HHhh Confidence 5554 No 164 >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Probab=78.98 E-value=2.3 Score=33.10 Aligned_cols=36 Identities=17% Similarity=0.205 Sum_probs=30.4 Q ss_pred ccc--EEEEccChHHHHHHHHHhcc-CCCEEEEecCCCC Q 034260 4 GID--VSFDCAGLNKTMSTVLDATR-AGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D--~vie~~G~~~~~~~al~~l~-~gGrvv~vG~~~~ 39 (100) |+| +|+||+|.-..-+.+-+.++ .|.+=|++..+.+ T Consensus 224 Gvd~aiVID~TG~f~~~~~~~~HL~~~GakkViiSAP~k 262 (477) T PRK08289 224 GINNALVVDNTGKWRDEEGLSQHLKSKGVAKVLLTAPGK 262 (477) T ss_pred CCCeEEEEeCccccCCHHHHhhchhccCCCEEEECCCCC Confidence 789 99999999877888888888 7878888887764 No 165 >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Probab=78.65 E-value=1.6 Score=30.36 Aligned_cols=31 Identities=16% Similarity=0.225 Sum_probs=26.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+++-+++++..-+.-++.|++|||+++. T Consensus 138 PyD~I~Vtaaa~~vP~~Ll~QL~~gGrlv~P 168 (209) T COG2518 138 PYDRIIVTAAAPEVPEALLDQLKPGGRLVIP 168 (209) T ss_pred CcCEEEEeeccCCCCHHHHHhcccCCEEEEE Confidence 4799999999887768888999999999975 No 166 >PRK13303 L-aspartate dehydrogenase; Provisional Probab=77.55 E-value=4.4 Score=28.78 Aligned_cols=30 Identities=23% Similarity=0.367 Sum_probs=24.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCL 33 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~ 33 (100) .+|+|+||++.....+.+.++++.|=.+++ T Consensus 61 ~~DvVve~t~~~~~~e~~~~aL~aGk~Vvi 90 (265) T PRK13303 61 RPDLVVECAGHAALKEHVVPILKAGIDCAV 90 (265) T ss_pred CCCEEEECCCHHHHHHHHHHHHHcCCCEEE Confidence 589999999998888888888887655554 No 167 >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Probab=77.10 E-value=0.21 Score=38.91 Aligned_cols=31 Identities=16% Similarity=0.113 Sum_probs=18.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) ++|++|+|+|+.......+...+.+|.+..+ T Consensus 222 ~~D~Vi~AtG~~~~~~~~i~g~~~~gv~~~~ 252 (564) T PRK12771 222 EFDAVFVAIGAQLGKRLPIPGEDAAGVLDAV 252 (564) T ss_pred hCCEEEEeeCCCCCCcCCCCCCccCCcEEHH Confidence 5899999999875544444444444443333 No 168 >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Probab=76.88 E-value=5 Score=27.49 Aligned_cols=34 Identities=12% Similarity=0.224 Sum_probs=25.8 Q ss_pred cccEEEEccCh--HHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGL--NKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~--~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|++|---|. +..++.+++.+++|||+|.-... T Consensus 102 ~~daiFIGGg~~i~~ile~~~~~l~~ggrlV~nait 137 (187) T COG2242 102 SPDAIFIGGGGNIEEILEAAWERLKPGGRLVANAIT 137 (187) T ss_pred CCCEEEECCCCCHHHHHHHHHHHcCcCCeEEEEeec Confidence 36777764442 36789999999999999987654 No 169 >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Probab=76.79 E-value=4.5 Score=27.42 Aligned_cols=31 Identities=13% Similarity=0.158 Sum_probs=24.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+++-+.......++..+.+++||++++. T Consensus 142 ~fD~Ii~~~~~~~~~~~l~~~L~~gG~lvi~ 172 (205) T PRK13944 142 PFDAIIVTAAASTIPSALVRQLKDGGVLVIP 172 (205) T ss_pred CccEEEEccCcchhhHHHHHhcCcCcEEEEE Confidence 5788887666555667888999999999874 No 170 >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family. Members of this family are thiopurine S-methyltransferase from a branch in which at least some member proteins can perform selenium methylation as a means to detoxify selenium, or perform a related detoxification of tellurium. Note that the EC number definition does not specify a particular thiopurine, but rather represents a class of activity. Probab=76.57 E-value=5.3 Score=27.50 Aligned_cols=34 Identities=18% Similarity=0.320 Sum_probs=26.5 Q ss_pred cccEEEEccC--------hHHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAG--------LNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G--------~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|.++|++- ....++...++++|||++++++.. T Consensus 113 ~fD~i~D~~~~~~l~~~~R~~~~~~l~~lLkpgG~~ll~~~~ 154 (213) T TIGR03840 113 PVDAVYDRAALIALPEEMRQRYAAHLLALLPPGARQLLITLD 154 (213) T ss_pred CcCEEEechhhccCCHHHHHHHHHHHHHHcCCCCeEEEEEEE Confidence 4799999753 134678889999999998888764 No 171 >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Probab=75.83 E-value=9.1 Score=26.72 Aligned_cols=52 Identities=13% Similarity=0.100 Sum_probs=32.9 Q ss_pred ccEEEEccChH---HHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEE Q 034260 5 IDVSFDCAGLN---KTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYG 56 (100) Q Consensus 5 ~D~vie~~G~~---~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~ 56 (100) +|+|+-..... ..++++.+.+++||++++.|.......--...+...+.++. T Consensus 180 fD~Vvani~~~~~~~l~~~~~~~LkpgG~lilsgi~~~~~~~v~~~l~~~Gf~~~ 234 (250) T PRK00517 180 ADVIVANILANPLLELAPDLARLLKPGGRLILSGILEEQADEVLEAYEEAGFTLD 234 (250) T ss_pred cCEEEEcCcHHHHHHHHHHHHHhcCCCcEEEEEECcHhhHHHHHHHHHHCCCEEE Confidence 78887655433 35678889999999999988765432211122333445554 No 172 >PF10369 ALS_ss_C: Small subunit of acetolactate synthase; InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain). Acetolactate synthase is a tetrameric enzyme, composed of two large and two small subunits, which catalyses the first step in branched-chain amino acid biosynthesis. This reaction is sensitive to certain herbicides []. ; PDB: 2F1F_B 2FGC_A 2PC6_A. Probab=75.71 E-value=4.7 Score=23.26 Aligned_cols=28 Identities=4% Similarity=0.142 Sum_probs=23.4 Q ss_pred EEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 7 VSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 7 ~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) +++|++|.+.-++..++++++.|-+-++ T Consensus 38 ~iie~tG~~~kid~fi~~l~~~gi~Ei~ 65 (75) T PF10369_consen 38 IIIELTGTPEKIDAFIKLLKPFGILEIA 65 (75) T ss_dssp EEEEEEE-HHHHHHHHHHSTGGGEEEEE T ss_pred EEEEEcCCHHHHHHHHHHhhhcCCEEEE Confidence 5899999999999999999998866543 No 173 >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt. Probab=75.23 E-value=4.6 Score=27.47 Aligned_cols=31 Identities=16% Similarity=0.183 Sum_probs=23.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+++-....+...+...+.+++||++++. T Consensus 146 ~fD~Ii~~~~~~~~~~~~~~~L~~gG~lv~~ 176 (215) T TIGR00080 146 PYDRIYVTAAGPKIPEALIDQLKEGGILVMP 176 (215) T ss_pred CCCEEEEcCCcccccHHHHHhcCcCcEEEEE Confidence 5898876555555667788999999998874 No 174 >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Probab=74.77 E-value=3.8 Score=30.22 Aligned_cols=23 Identities=13% Similarity=0.460 Sum_probs=20.6 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++++++++++|||++++..+. T Consensus 225 ~~L~~a~~~L~~gGRl~VIsFHS 247 (314) T COG0275 225 EALEAALDLLKPGGRLAVISFHS 247 (314) T ss_pred HHHHHHHHhhCCCcEEEEEEecc Confidence 46899999999999999999875 No 175 >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Probab=74.77 E-value=7.1 Score=28.84 Aligned_cols=33 Identities=18% Similarity=0.064 Sum_probs=24.0 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) ++|+|+||+|.....+.+-.+++.|-+++.-|. T Consensus 78 ~vDVVIdaT~~~~~~e~a~~~~~aGk~VI~~~~ 110 (341) T PRK04207 78 KADIVVDATPGGVGAKNKELYEKAGVKAIFQGG 110 (341) T ss_pred cCCEEEECCCchhhHHHHHHHHHCCCEEEEcCC Confidence 589999999998777777777776644444443 No 176 >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II. All of the members of the seed are characterized. See, for instance. This model is very solid, there are no species falling between trusted and noise at this time. The closest relatives scoring in the noise are the class I GAPDH's. Probab=73.15 E-value=6.3 Score=29.28 Aligned_cols=37 Identities=16% Similarity=0.109 Sum_probs=28.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) ++|+|+||+|.......+-..++.|-+.+++|.+..+ T Consensus 75 ~vDiVve~Tp~~~~~~na~~~~~~GakaVl~~~p~~~ 111 (333) T TIGR01546 75 KVDIVVDATPGGIGAKNKPLYEKAGVKAIFQGGEKAE 111 (333) T ss_pred cCCEEEECCCCCCChhhHHHHHhCCcCEEEECCCCCC Confidence 6899999999876666666666667777888888764 No 177 >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Probab=72.84 E-value=7.7 Score=26.15 Aligned_cols=32 Identities=13% Similarity=0.087 Sum_probs=24.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-........+...+.+++||++++.- T Consensus 144 ~fD~I~~~~~~~~~~~~l~~~L~~gG~lv~~~ 175 (212) T PRK00312 144 PFDRILVTAAAPEIPRALLEQLKEGGILVAPV 175 (212) T ss_pred CcCEEEEccCchhhhHHHHHhcCCCcEEEEEE Confidence 47888776665566677889999999998753 No 178 >PF02875 Mur_ligase_C: Mur ligase family, glutamate ligase domain This Prosite entry is a subset of the Pfam family.; InterPro: IPR004101 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages: (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer. Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) [], MurD (6.3.2.9 from EC) [], MurE (6.3.2.13 from EC) [] and MurF (6.3.2.10 from EC) []. These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales []. This entry represents the C-terminal domain from all four stage 2 Mur enzymes: UDP-N-acetylmuramate-L-alanine ligase (MurC), UDP-N-acetylmuramoylalanine-D-glutamate ligase (MurD), UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (MurE), and UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase (MurF). This entry also includes the C-terminal domain of folylpolyglutamate synthase that transfers glutamate to folylpolyglutamate and cyanophycin synthetase that catalyses the biosynthesis of the cyanobacterial reserve material multi-L-arginyl-poly-L-aspartate (cyanophycin) []. The C-terminal domain is almost always associated with the cytoplasmic peptidoglycan synthetases, N-terminal domain (see IPR000713 from INTERPRO).; GO: 0005524 ATP binding, 0016874 ligase activity, 0009058 biosynthetic process; PDB: 2Y68_A 3UAG_A 4UAG_A 2UAG_A 1E0D_A 2XPC_A 2WJP_A 2VTE_A 2Y67_A 1EEH_A .... Probab=71.95 E-value=8.3 Score=22.43 Aligned_cols=34 Identities=21% Similarity=0.306 Sum_probs=23.7 Q ss_pred CcccEEEEccChHHHHHHHHHhcc---CCCEEE-EecC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATR---AGDKVC-LVGM 36 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~---~gGrvv-~vG~ 36 (100) .++.++.|.+-++..+..+++.++ +.++++ ++|. T Consensus 12 ~~~~vi~D~ahNp~s~~a~l~~l~~~~~~~~~i~V~G~ 49 (91) T PF02875_consen 12 NGPTVIDDYAHNPDSIRALLEALKELYPKGRIIAVFGA 49 (91) T ss_dssp TTEEEEEET--SHHHHHHHHHHHHHHCTTSEEEEEEEE T ss_pred CCcEEEEECCCCHHHHHHHHHHHHHhccCCcEEEEEcc Confidence 368899998888888888888884 456654 5564 No 179 >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to: Arsenite methyltransferase (2.1.1.137 from EC) which converts arsenical compounds to their methylated forms [] Biotin synthesis protein bioC, which is involved in the early stages of biotin biosyntheis [] Arginine N-methyltransferase 1, an arginine-methylating enzyme which acts on residues present in a glycine and argine-rich domain and can methylate histones [] Hexaprenyldihydroxybenzoate methyltransferase (2.1.1.114 from EC), a mitochodrial enzyme involved in ubiquinone biosynthesis [] A probable cobalt-precorrin-6Y C(15)-methyltransferase thought to be involved in adenosylcobalamin biosynthesis [] Sterol 24-C-methyltransferase (2.1.1.41 from EC), shown to participate in ergosterol biosynthesis [] 3-demethylubiquinone-9 3-methyltransferase (2.1.1.64 from EC) involved in ubiquinone biosynthesis [] Structural studies show that this domain forms the Rossman-like alpha-beta fold typical of SAM-dependent methyltransferases [, , ]. ; GO: 0008168 methyltransferase activity, 0008152 metabolic process; PDB: 3CGG_B 3CCF_B 3BKW_B 2PXX_A 3I9F_A 2YQZ_B 2YR0_A 3BUS_A 3EGE_A 3G5L_B .... Probab=71.53 E-value=3.2 Score=23.45 Aligned_cols=30 Identities=13% Similarity=0.356 Sum_probs=20.9 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEE Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCL 33 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~ 33 (100) .+|+|+-..- ....++++.+.++|||++++ T Consensus 60 sfD~v~~~~~~~~~~~~~~~l~e~~rvLk~gG~l~~ 95 (95) T PF08241_consen 60 SFDVVFSNSVLHHLEDPEAALREIYRVLKPGGRLVI 95 (95) T ss_dssp -EEEEEEESHGGGSSHHHHHHHHHHHHEEEEEEEEE T ss_pred cccccccccceeeccCHHHHHHHHHHHcCcCeEEeC Confidence 3566654322 23578999999999999985 No 180 >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2.1.1.77 from EC) (PCMT) [] (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyses the transfer of a methyl group from S-adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerisation of normal L-aspartyl and L-asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process; PDB: 3LBF_A 1DL5_B 1JG3_B 1JG2_A 1JG1_A 1JG4_A 2YXE_A 2PBF_B 1VBF_C 1R18_A .... Probab=71.46 E-value=2.5 Score=29.13 Aligned_cols=33 Identities=15% Similarity=0.298 Sum_probs=26.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEE-ecC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCL-VGM 36 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~-vG~ 36 (100) .+|.++-+.+.+..-+.-++.|++||++|+ ++. T Consensus 141 pfD~I~v~~a~~~ip~~l~~qL~~gGrLV~pi~~ 174 (209) T PF01135_consen 141 PFDRIIVTAAVPEIPEALLEQLKPGGRLVAPIGQ 174 (209) T ss_dssp SEEEEEESSBBSS--HHHHHTEEEEEEEEEEESS T ss_pred CcCEEEEeeccchHHHHHHHhcCCCcEEEEEEcc Confidence 479999999988777888899999999998 454 No 181 >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.). Probab=70.99 E-value=13 Score=20.51 Aligned_cols=31 Identities=16% Similarity=0.224 Sum_probs=22.6 Q ss_pred cccEEEEccCh-------HHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGL-------NKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~-------~~~~~~al~~l~~gGrvv~v 34 (100) ++|+++..... ...++...+.++++|.+++. T Consensus 66 ~~d~i~~~~~~~~~~~~~~~~l~~~~~~l~~~g~~~~~ 103 (107) T cd02440 66 SFDVIISDPPLHHLVEDLARFLEEARRLLKPGGVLVLT 103 (107) T ss_pred ceEEEEEccceeehhhHHHHHHHHHHHHcCCCCEEEEE Confidence 57777765443 35678888889999998865 No 182 >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Probab=70.78 E-value=12 Score=25.33 Aligned_cols=32 Identities=19% Similarity=0.229 Sum_probs=24.2 Q ss_pred cccEEEEcc--ChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA--GLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~--G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-.. ..+..++++.+.+++||+++++= T Consensus 112 ~fDlV~~~~~~~~~~~l~~~~~~LkpGG~lv~~~ 145 (187) T PRK00107 112 KFDVVTSRAVASLSDLVELCLPLLKPGGRFLALK 145 (187) T ss_pred CccEEEEccccCHHHHHHHHHHhcCCCeEEEEEe Confidence 578877532 23467888999999999999883 No 183 >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Probab=69.93 E-value=5.9 Score=27.96 Aligned_cols=32 Identities=16% Similarity=0.161 Sum_probs=28.0 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) ..|.+.--++++..-+..++.|+++||+++-= T Consensus 162 ~YDaIhvGAaa~~~pq~l~dqL~~gGrllip~ 193 (237) T KOG1661|consen 162 PYDAIHVGAAASELPQELLDQLKPGGRLLIPV 193 (237) T ss_pred CcceEEEccCccccHHHHHHhhccCCeEEEee Confidence 36888888888889999999999999999753 No 184 >TIGR00406 prmA ribosomal protein L11 methyltransferase. Ribosomal protein L11 methyltransferase is an S-adenosyl-L-methionine-dependent methyltransferase required for the modification of ribosomal protein L11. This protein is found in bacteria and (with a probable transit peptide) in Arabidopsis. Probab=69.83 E-value=11 Score=26.93 Aligned_cols=36 Identities=14% Similarity=0.078 Sum_probs=27.2 Q ss_pred cccEEEEccChH---HHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLN---KTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~---~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .+|+|+...... ..+.++.+.++|||++++.|.... T Consensus 225 ~fDlVvan~~~~~l~~ll~~~~~~LkpgG~li~sgi~~~ 263 (288) T TIGR00406 225 KADVIVANILAEVIKELYPQFSRLVKPGGWLILSGILET 263 (288) T ss_pred CceEEEEecCHHHHHHHHHHHHHHcCCCcEEEEEeCcHh Confidence 578888654433 456778899999999999887643 No 185 >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Probab=68.06 E-value=8.4 Score=27.51 Aligned_cols=36 Identities=22% Similarity=0.303 Sum_probs=29.1 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..+|+++||++..+.-+-..+.|+.|=.++++.+.. T Consensus 59 ~~~DlvVEaAS~~Av~e~~~~~L~~g~d~iV~SVGA 94 (255) T COG1712 59 AEVDLVVEAASPEAVREYVPKILKAGIDVIVMSVGA 94 (255) T ss_pred hccceeeeeCCHHHHHHHhHHHHhcCCCEEEEechh Confidence 358999999999888888889998877777766553 No 186 >TIGR00006 S-adenosyl-methyltransferase MraW. Genetics paper in 1972 links mra cluster to peptidoglycan biosynthesis in E. coli. Seems to be common in proteobacteria.wn. Probab=67.88 E-value=7.2 Score=28.63 Aligned_cols=23 Identities=4% Similarity=0.254 Sum_probs=20.2 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++++.+.|++|||++++..+. T Consensus 221 ~~L~~~~~~L~~gGrl~VISfHS 243 (305) T TIGR00006 221 EALQFAPNLLAPGGRLSIISFHS 243 (305) T ss_pred HHHHHHHHHhcCCCEEEEEecCc Confidence 36788999999999999999875 No 187 >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase.; GO: 0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0006520 cellular amino acid metabolic process, 0055114 oxidation-reduction process, 0005737 cytoplasm; PDB: 3Q0E_B 1MB4_A 3PZR_A 1MC4_A 3TZ6_A 3VOS_A 2CVO_B 2R00_C 2QZ9_A 2EP5_C .... Probab=66.24 E-value=13 Score=22.87 Aligned_cols=32 Identities=22% Similarity=0.164 Sum_probs=22.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+||.|++....-+.+-++++.|-+++=.+ T Consensus 66 ~~Dvvf~a~~~~~~~~~~~~~~~~g~~ViD~s 97 (121) T PF01118_consen 66 DVDVVFLALPHGASKELAPKLLKAGIKVIDLS 97 (121) T ss_dssp TESEEEE-SCHHHHHHHHHHHHHTTSEEEESS T ss_pred cCCEEEecCchhHHHHHHHHHhhCCcEEEeCC Confidence 58999999998766666666667776555443 No 188 >TIGR03855 NAD_NadX aspartate dehydrogenase. Members of this protein family are L-aspartate dehydrogenase, as shown for the NADP-dependent enzyme TM_1643 of Thermotoga maritima. Members lack homology to NadB, the aspartate oxidase (EC 1.4.3.16) of most mesophilic bacteria (described by TIGR00551), which this enzyme replaces in the generation of oxaloacetate from aspartate for the NAD biosynthetic pathway. All members of the seed alignment are found adjacent to other genes of NAD biosynthesis, although other uses of L-aspartate dehydrogenase may occur. Probab=64.95 E-value=16 Score=25.65 Aligned_cols=32 Identities=9% Similarity=0.234 Sum_probs=26.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) ..+|+|++|++.....+.+.++++.|=.+.+. T Consensus 36 ~~vDaVviatp~~~H~e~a~~aL~aGkhVl~~ 67 (229) T TIGR03855 36 EDVDIVVEAASQEAVKEYAEKILKNGKDLLIM 67 (229) T ss_pred CCCCEEEECCChHHHHHHHHHHHHCCCCEEEE Confidence 36899999999998889999999887555553 No 189 >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase. MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species. Probab=64.05 E-value=17 Score=24.65 Aligned_cols=34 Identities=12% Similarity=0.126 Sum_probs=23.9 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|+|+-+- -....++++.+.+++||+++++-.. T Consensus 114 ~fD~V~~~~~l~~~~~~~~~l~~~~~~Lk~gG~l~~~~~~ 153 (231) T TIGR02752 114 SFDYVTIGFGLRNVPDYMQVLREMYRVVKPGGKVVCLETS 153 (231) T ss_pred CccEEEEecccccCCCHHHHHHHHHHHcCcCeEEEEEECC Confidence 467776431 1235678899999999999986543 No 190 >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Probab=63.19 E-value=11 Score=27.47 Aligned_cols=30 Identities=7% Similarity=0.257 Sum_probs=25.0 Q ss_pred ccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 11 CAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 11 ~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) |+-.+.++++|.+.|+||||+.++=.+.-. T Consensus 190 ~th~~k~l~EAYRVLKpGGrf~cLeFskv~ 219 (296) T KOG1540|consen 190 VTHIQKALREAYRVLKPGGRFSCLEFSKVE 219 (296) T ss_pred CCCHHHHHHHHHHhcCCCcEEEEEEccccc Confidence 455667999999999999999998777643 No 191 >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []. Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity; PDB: 1VL5_C. Probab=62.50 E-value=6.1 Score=27.61 Aligned_cols=37 Identities=11% Similarity=0.310 Sum_probs=26.2 Q ss_pred cccEEEEccCh------HHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAGL------NKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G~------~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) .+|+|.-+-|- ..++++..+.|+|||+++++-...+. T Consensus 116 sfD~v~~~fglrn~~d~~~~l~E~~RVLkPGG~l~ile~~~p~ 158 (233) T PF01209_consen 116 SFDAVTCSFGLRNFPDRERALREMYRVLKPGGRLVILEFSKPR 158 (233) T ss_dssp -EEEEEEES-GGG-SSHHHHHHHHHHHEEEEEEEEEEEEEB-S T ss_pred ceeEEEHHhhHHhhCCHHHHHHHHHHHcCCCeEEEEeeccCCC Confidence 35666654442 35789999999999999998766543 No 192 >PRK11207 tellurite resistance protein TehB; Provisional Probab=60.86 E-value=25 Score=23.57 Aligned_cols=33 Identities=12% Similarity=0.181 Sum_probs=23.2 Q ss_pred CcccEEEEccC--------hHHHHHHHHHhccCCCEEEEec Q 034260 3 AGIDVSFDCAG--------LNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 3 ~G~D~vie~~G--------~~~~~~~al~~l~~gGrvv~vG 35 (100) ..+|+|+.... ....++...++++|||+++++. T Consensus 94 ~~fD~I~~~~~~~~~~~~~~~~~l~~i~~~LkpgG~~~~~~ 134 (197) T PRK11207 94 GEYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVA 134 (197) T ss_pred CCcCEEEEecchhhCCHHHHHHHHHHHHHHcCCCcEEEEEE Confidence 35788887533 1246778888999999976553 No 193 >PRK14967 putative methyltransferase; Provisional Probab=60.66 E-value=23 Score=24.15 Aligned_cols=19 Identities=16% Similarity=0.127 Sum_probs=15.8 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .++++.+.+++||+++++- T Consensus 141 ~l~~a~~~Lk~gG~l~~~~ 159 (223) T PRK14967 141 LCDAAPALLAPGGSLLLVQ 159 (223) T ss_pred HHHHHHHhcCCCcEEEEEE Confidence 4577889999999999763 No 194 >PLN02490 MPBQ/MSBQ methyltransferase Probab=60.56 E-value=20 Score=26.72 Aligned_cols=33 Identities=18% Similarity=0.340 Sum_probs=24.7 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+.+- -....++++.+.+++||++++++. T Consensus 178 sFDvVIs~~~L~~~~d~~~~L~e~~rvLkPGG~LvIi~~ 216 (340) T PLN02490 178 YADRYVSAGSIEYWPDPQRGIKEAYRVLKIGGKACLIGP 216 (340) T ss_pred ceeEEEEcChhhhCCCHHHHHHHHHHhcCCCcEEEEEEe Confidence 478777642 123578999999999999998864 No 195 >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Probab=59.92 E-value=25 Score=23.11 Aligned_cols=32 Identities=19% Similarity=0.186 Sum_probs=23.1 Q ss_pred cccEEEEccC---hHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAG---LNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G---~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+++-... ....++.+.+.+++||++++.. T Consensus 97 ~~D~v~~~~~~~~~~~~l~~~~~~Lk~gG~lv~~~ 131 (187) T PRK08287 97 KADAIFIGGSGGNLTAIIDWSLAHLHPGGRLVLTF 131 (187) T ss_pred CCCEEEECCCccCHHHHHHHHHHhcCCCeEEEEEE Confidence 5788875321 2346788899999999998754 No 196 >TIGR00036 dapB dihydrodipicolinate reductase. Probab=59.81 E-value=17 Score=25.87 Aligned_cols=34 Identities=18% Similarity=0.078 Sum_probs=22.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+|+||+......+.+..+++ .|.-+++|..+ T Consensus 68 ~~DvVIdfT~p~~~~~~~~~al~-~g~~vVigttg 101 (266) T TIGR00036 68 DPDVLIDFTTPEGVLNHLKFALE-HGVRLVVGTTG 101 (266) T ss_pred CCCEEEECCChHHHHHHHHHHHH-CCCCEEEECCC Confidence 48999999976555555555554 45666667653 No 197 >TIGR00477 tehB tellurite resistance protein TehB. Part of a tellurite-reducing operon tehA and tehB Probab=59.50 E-value=19 Score=24.09 Aligned_cols=32 Identities=19% Similarity=0.294 Sum_probs=22.4 Q ss_pred cccEEEEcc-----C---hHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA-----G---LNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~-----G---~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+.+. . .+..++++.++|+|||+++++- T Consensus 94 ~fD~I~~~~~~~~~~~~~~~~~l~~~~~~LkpgG~lli~~ 133 (195) T TIGR00477 94 DYDFIFSTVVFMFLQAGRVPEIIANMQAHTRPGGYNLIVA 133 (195) T ss_pred CCCEEEEecccccCCHHHHHHHHHHHHHHhCCCcEEEEEE Confidence 478887542 1 1357788889999999966553 No 198 >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Probab=59.34 E-value=18 Score=26.58 Aligned_cols=27 Identities=26% Similarity=0.322 Sum_probs=20.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDK 30 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGr 30 (100) ++|+||.|+|+..+.+.+-+++..|.+ T Consensus 63 ~vDvVf~A~g~g~s~~~~~~~~~~G~~ 89 (334) T PRK14874 63 GVDIALFSAGGSVSKKYAPKAAAAGAV 89 (334) T ss_pred CCCEEEECCChHHHHHHHHHHHhCCCE Confidence 689999999998776666666666553 No 199 >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A .... Probab=58.81 E-value=7.7 Score=22.90 Aligned_cols=32 Identities=9% Similarity=0.227 Sum_probs=23.6 Q ss_pred CcccEEEEcc-Ch---H------HHHHHHHHhccCCCEEEEe Q 034260 3 AGIDVSFDCA-GL---N------KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 3 ~G~D~vie~~-G~---~------~~~~~al~~l~~gGrvv~v 34 (100) ..+|+|+... .. . ..++...+.++|||++++- T Consensus 69 ~~~D~v~~~~~~~~~~~~~~~~~~~l~~~~~~L~pgG~lvi~ 110 (112) T PF12847_consen 69 EPFDLVICSGFTLHFLLPLDERRRVLERIRRLLKPGGRLVIN 110 (112) T ss_dssp SCEEEEEECSGSGGGCCHHHHHHHHHHHHHHHEEEEEEEEEE T ss_pred CCCCEEEECCCccccccchhHHHHHHHHHHHhcCCCcEEEEE Confidence 3578888766 21 1 3488899999999999873 No 200 >COG2910 Putative NADH-flavin reductase [General function prediction only] Probab=58.69 E-value=22 Score=24.74 Aligned_cols=42 Identities=14% Similarity=0.303 Sum_probs=26.6 Q ss_pred cccEEEEccChH--H-------HHHHHHHhccC--CCEEEEecCCCCCcccChH Q 034260 4 GIDVSFDCAGLN--K-------TMSTVLDATRA--GDKVCLVGMGHHDMTVPLT 46 (100) Q Consensus 4 G~D~vie~~G~~--~-------~~~~al~~l~~--gGrvv~vG~~~~~~~i~~~ 46 (100) |.|+||++.|.. . ..+..++.++. --|+.+||..+. ..+++. T Consensus 62 g~DaVIsA~~~~~~~~~~~~~k~~~~li~~l~~agv~RllVVGGAGS-L~id~g 114 (211) T COG2910 62 GHDAVISAFGAGASDNDELHSKSIEALIEALKGAGVPRLLVVGGAGS-LEIDEG 114 (211) T ss_pred CCceEEEeccCCCCChhHHHHHHHHHHHHHHhhcCCeeEEEEcCccc-eEEcCC Confidence 789999998865 1 23345566655 358888886642 344443 No 201 >PRK13304 L-aspartate dehydrogenase; Reviewed Probab=57.97 E-value=20 Score=25.40 Aligned_cols=31 Identities=23% Similarity=0.485 Sum_probs=22.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|++|++.....+.+.++++.|-.+++. T Consensus 61 ~~DvVvi~a~~~~~~~~~~~al~~Gk~Vvv~ 91 (265) T PRK13304 61 DVDLVVECASVNAVEEVVPKSLENGKDVIIM 91 (265) T ss_pred CCCEEEEcCChHHHHHHHHHHHHcCCCEEEE Confidence 5899999998877677777777765445443 No 202 >PRK08324 short chain dehydrogenase; Validated Probab=57.90 E-value=19 Score=28.88 Aligned_cols=35 Identities=17% Similarity=0.386 Sum_probs=25.7 Q ss_pred cccEEEEccCh-------------------------HHHHHHHHHhccC---CCEEEEecCCC Q 034260 4 GIDVSFDCAGL-------------------------NKTMSTVLDATRA---GDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~-------------------------~~~~~~al~~l~~---gGrvv~vG~~~ 38 (100) ++|++|.++|. ...++.++..+++ +|++++++... T Consensus 498 ~iDvvI~~AG~~~~~~~~~~~~~~~~~~~~~N~~g~~~l~~~~~~~l~~~~~~g~iV~vsS~~ 560 (681) T PRK08324 498 GVDIVVSNAGIAISGPIEETSDEDWRRSFDVNATGHFLVAREAVRIMKAQGLGGSIVFIASKN 560 (681) T ss_pred CCCEEEECCCCCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHhcCCCcEEEEECCcc Confidence 68999999992 2345666766665 68999998643 No 203 >PRK08618 ornithine cyclodeaminase; Validated Probab=57.55 E-value=20 Score=26.17 Aligned_cols=41 Identities=12% Similarity=0.144 Sum_probs=31.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChH Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLT 46 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~ 46 (100) .+|+|+-|+++...+-. +.+++|-.+..+|...+ ..+++.. T Consensus 192 ~aDiVi~aT~s~~p~i~--~~l~~G~hV~~iGs~~p~~~E~~~~ 233 (325) T PRK08618 192 EADIIVTVTNAKTPVFS--EKLKKGVHINAVGSFMPDMQELPSE 233 (325) T ss_pred cCCEEEEccCCCCcchH--HhcCCCcEEEecCCCCcccccCCHH Confidence 58999999998754443 88999999999998764 3456653 No 204 >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Probab=57.51 E-value=15 Score=26.89 Aligned_cols=23 Identities=13% Similarity=0.482 Sum_probs=20.2 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++++.+.+++|||++++.... T Consensus 217 ~~L~~~~~~L~~gGrl~visfHS 239 (296) T PRK00050 217 RALEAALDLLKPGGRLAVISFHS 239 (296) T ss_pred HHHHHHHHHhcCCCEEEEEecCc Confidence 36788999999999999999876 No 205 >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms). Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. This model represents a branch more closely related to the USG-1 protein than to the other aspartate-semialdehyde dehydrogenases represented in model TIGR00978. Probab=56.95 E-value=20 Score=26.46 Aligned_cols=28 Identities=25% Similarity=0.331 Sum_probs=21.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCE Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDK 30 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGr 30 (100) .+.|++|.|+|+..+.+.+-++++.|-+ T Consensus 60 ~~~D~v~~a~g~~~s~~~a~~~~~~G~~ 87 (339) T TIGR01296 60 EGIDIALFSAGGSVSKEFAPKAAKCGAI 87 (339) T ss_pred cCCCEEEECCCHHHHHHHHHHHHHCCCE Confidence 3689999999998777777777676654 No 206 >PRK08317 hypothetical protein; Provisional Probab=56.73 E-value=28 Score=23.14 Aligned_cols=33 Identities=12% Similarity=0.256 Sum_probs=24.1 Q ss_pred cccEEEEc------cChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDC------AGLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~------~G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+-. ......++...+++++||+++++.. T Consensus 87 ~~D~v~~~~~~~~~~~~~~~l~~~~~~L~~gG~l~~~~~ 125 (241) T PRK08317 87 SFDAVRSDRVLQHLEDPARALAEIARVLRPGGRVVVLDT 125 (241) T ss_pred CceEEEEechhhccCCHHHHHHHHHHHhcCCcEEEEEec Confidence 46766643 2234578999999999999998764 No 207 >PRK14901 16S rRNA methyltransferase B; Provisional Probab=56.05 E-value=27 Score=26.55 Aligned_cols=19 Identities=5% Similarity=0.239 Sum_probs=16.2 Q ss_pred HHHHHHHHhccCCCEEEEe Q 034260 16 KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~v 34 (100) ..++.+.+++++||++|.. T Consensus 365 ~iL~~a~~~lkpgG~lvys 383 (434) T PRK14901 365 ELLESLAPLLKPGGTLVYA 383 (434) T ss_pred HHHHHHHHhcCCCCEEEEE Confidence 4578899999999999865 No 208 >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases. Probab=55.84 E-value=27 Score=23.14 Aligned_cols=35 Identities=9% Similarity=0.268 Sum_probs=25.4 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-.- .....++.+.+.+++||+++++.... T Consensus 106 ~~D~i~~~~~~~~~~~~~~~l~~~~~~L~~gG~l~~~~~~~ 146 (223) T TIGR01934 106 SFDAVTIAFGLRNVTDIQKALREMYRVLKPGGRLVILEFSK 146 (223) T ss_pred cEEEEEEeeeeCCcccHHHHHHHHHHHcCCCcEEEEEEecC Confidence 467766432 22356888999999999999987654 No 209 >PRK13255 thiopurine S-methyltransferase; Reviewed Probab=55.56 E-value=20 Score=24.73 Aligned_cols=33 Identities=21% Similarity=0.289 Sum_probs=24.1 Q ss_pred cccEEEEccC--------hHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAG--------LNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G--------~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|.++|.+- ....++...++|+|||++.+++. T Consensus 116 ~fd~v~D~~~~~~l~~~~R~~~~~~l~~lL~pgG~~~l~~~ 156 (218) T PRK13255 116 DVDAVYDRAALIALPEEMRERYVQQLAALLPAGCRGLLVTL 156 (218) T ss_pred CeeEEEehHhHhhCCHHHHHHHHHHHHHHcCCCCeEEEEEE Confidence 4688998663 23457888899999998776544 No 210 >PF08351 DUF1726: Domain of unknown function (DUF1726); InterPro: IPR013562 This entry represents a protein of unknown function and is found towards the N terminus of putative ATPases (IPR007807 from INTERPRO). ; PDB: 2ZPA_B. Probab=54.87 E-value=29 Score=20.79 Aligned_cols=36 Identities=19% Similarity=0.325 Sum_probs=22.0 Q ss_pred CCCccc-EEEEccC--hHHHHHHHHHhccCCCEEEEecC Q 034260 1 MGAGID-VSFDCAG--LNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 1 ~G~G~D-~vie~~G--~~~~~~~al~~l~~gGrvv~vG~ 36 (100) ||.-.| +|+|+.. .+.++..+...++-||-++++-- T Consensus 8 LG~e~~~~i~d~~~g~~pnal~a~~gtv~gGGllill~p 46 (92) T PF08351_consen 8 LGQEFDLLIFDAFEGFDPNALAALAGTVRGGGLLILLLP 46 (92) T ss_dssp TT--BSSEEEE-SS---HHHHHHHHTTB-TT-EEEEEES T ss_pred hCCccCEEEEEccCCCCHHHHHHHhcceecCeEEEEEcC Confidence 455444 4788765 34678888899999999998753 No 211 >PLN02232 ubiquinone biosynthesis methyltransferase Probab=54.67 E-value=17 Score=23.53 Aligned_cols=35 Identities=17% Similarity=0.321 Sum_probs=24.9 Q ss_pred cccEEEEccCh------HHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGL------NKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~------~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+|+-.-+. ...+++..+.++|||+++++=... T Consensus 44 ~fD~v~~~~~l~~~~d~~~~l~ei~rvLkpGG~l~i~d~~~ 84 (160) T PLN02232 44 EFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNK 84 (160) T ss_pred CeeEEEecchhhcCCCHHHHHHHHHHHcCcCeEEEEEECCC Confidence 46776544332 246889999999999999875544 No 212 >KOG4300 consensus Predicted methyltransferase [General function prediction only] Probab=54.34 E-value=31 Score=24.55 Aligned_cols=37 Identities=14% Similarity=0.116 Sum_probs=27.4 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) .+|.|+.+-+ ...++++.-++|||||++.++=...++ T Consensus 145 s~DtVV~TlvLCSve~~~k~L~e~~rlLRpgG~iifiEHva~~ 187 (252) T KOG4300|consen 145 SYDTVVCTLVLCSVEDPVKQLNEVRRLLRPGGRIIFIEHVAGE 187 (252) T ss_pred CeeeEEEEEEEeccCCHHHHHHHHHHhcCCCcEEEEEeccccc Confidence 4677777533 235788888999999999999766554 No 213 >TIGR00518 alaDH alanine dehydrogenase. The family of known L-alanine dehydrogenases includes representatives from the Proteobacteria, Firmicutes, and Cyanobacteria, all with about 50 % identity or better. An outlier to this group in both sequence and gap pattern is the homolog from Helicobacter pylori, an epsilon division Proteobacteria, which must be considered a putative alanine dehydrogenase. Related proteins include saccharopine dehydrogenase and the N-terminal half of the NAD(P) transhydrogenase alpha subunit. All of these related proteins bind NAD and/or NADP. Probab=54.03 E-value=15 Score=27.47 Aligned_cols=36 Identities=11% Similarity=0.201 Sum_probs=27.5 Q ss_pred cccEEEEccChH-----H-HHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLN-----K-TMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~-----~-~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .+|++|+|++.+ . .-++.++.+++++.++-++...+ T Consensus 230 ~aDvVI~a~~~~g~~~p~lit~~~l~~mk~g~vIvDva~d~G 271 (370) T TIGR00518 230 RADLLIGAVLIPGAKAPKLVSNSLVAQMKPGAVIVDVAIDQG 271 (370) T ss_pred cCCEEEEccccCCCCCCcCcCHHHHhcCCCCCEEEEEecCCC Confidence 589999998432 1 24788888999999999987643 No 214 >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria. The Escherichia coli protein is essential and has been linked to peptidoglycan biosynthesis [, ].; GO: 0008168 methyltransferase activity; PDB: 1N2X_A 1M6Y_A 1WG8_A 3TKA_A. Probab=53.97 E-value=11 Score=27.85 Aligned_cols=23 Identities=9% Similarity=0.359 Sum_probs=20.0 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++.+.+.|++|||++++.... T Consensus 222 ~~L~~a~~~L~~gGrl~VISFHS 244 (310) T PF01795_consen 222 RGLEAAPDLLKPGGRLVVISFHS 244 (310) T ss_dssp HHHHHHHHHEEEEEEEEEEESSH T ss_pred HHHHHHHHHhcCCcEEEEEEecc Confidence 46788899999999999998764 No 215 >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Probab=53.68 E-value=28 Score=24.65 Aligned_cols=37 Identities=14% Similarity=0.335 Sum_probs=28.5 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) .+|++.-+-| -+.++.++.+.++|||+++++-...++ T Consensus 119 sFD~vt~~fglrnv~d~~~aL~E~~RVlKpgG~~~vle~~~p~ 161 (238) T COG2226 119 SFDAVTISFGLRNVTDIDKALKEMYRVLKPGGRLLVLEFSKPD 161 (238) T ss_pred ccCEEEeeehhhcCCCHHHHHHHHHHhhcCCeEEEEEEcCCCC Confidence 4566665544 335899999999999999999887654 No 216 >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB. The seed alignment is built from bacterial sequences only. Eukaryotic homologs include Nop2, a protein required for processing pre-rRNA, that is likely also a rRNA methyltransferase, although the fine specificity may differ. Cutoff scores are set to avoid treating archaeal and eukaroytic homologs automatically as functionally equivalent, although they may have very similar roles. Probab=53.55 E-value=32 Score=26.04 Aligned_cols=20 Identities=5% Similarity=0.245 Sum_probs=16.8 Q ss_pred HHHHHHHHhccCCCEEEEec Q 034260 16 KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG 35 (100) ..++.+.++++|||+++..- T Consensus 349 ~lL~~a~~~LkpgG~lvyst 368 (426) T TIGR00563 349 EILDAIWPLLKTGGTLVYAT 368 (426) T ss_pred HHHHHHHHhcCCCcEEEEEe Confidence 46788999999999999764 No 217 >PF14258 DUF4350: Domain of unknown function (DUF4350) Probab=53.00 E-value=21 Score=19.72 Aligned_cols=20 Identities=20% Similarity=0.405 Sum_probs=16.2 Q ss_pred HHHHHHHHhccCCCEEEEec Q 034260 16 KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG 35 (100) ..+++-.+.++.||++++++ T Consensus 51 ~~~~~l~~~v~~G~~lvl~a 70 (70) T PF14258_consen 51 EEAEALLEWVEAGNTLVLAA 70 (70) T ss_pred HHHHHHHHHHHcCCEEEEeC Confidence 45677788899999999864 No 218 >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Probab=52.80 E-value=36 Score=23.65 Aligned_cols=32 Identities=19% Similarity=0.241 Sum_probs=23.4 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-.. .....++++.+.++|||+++++- T Consensus 112 ~fD~V~~~~vl~~~~~~~~~l~~~~~~LkpgG~l~i~~ 149 (255) T PRK11036 112 PVDLILFHAVLEWVADPKSVLQTLWSVLRPGGALSLMF 149 (255) T ss_pred CCCEEEehhHHHhhCCHHHHHHHHHHHcCCCeEEEEEE Confidence 578877432 22356889999999999998763 No 219 >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Probab=52.63 E-value=33 Score=23.38 Aligned_cols=19 Identities=11% Similarity=0.163 Sum_probs=16.3 Q ss_pred HHHHHHHHhccCCCEEEEe Q 034260 16 KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~v 34 (100) ..++.+.+.|++||++++. T Consensus 146 ~~L~~~~~~LkpGG~~vi~ 164 (209) T PRK11188 146 LALDMCRDVLAPGGSFVVK 164 (209) T ss_pred HHHHHHHHHcCCCCEEEEE Confidence 3678889999999999985 No 220 >PRK04266 fibrillarin; Provisional Probab=52.32 E-value=32 Score=23.92 Aligned_cols=31 Identities=13% Similarity=0.129 Sum_probs=22.1 Q ss_pred cccEEEEccChH----HHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLN----KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~----~~~~~al~~l~~gGrvv~v 34 (100) .+|+++--...+ ..++.+.+.|+|||++++. T Consensus 141 ~~D~i~~d~~~p~~~~~~L~~~~r~LKpGG~lvI~ 175 (226) T PRK04266 141 KVDVIYQDVAQPNQAEIAIDNAEFFLKDGGYLLLA 175 (226) T ss_pred cCCEEEECCCChhHHHHHHHHHHHhcCCCcEEEEE Confidence 478887323322 2367888899999999985 No 221 >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, Probab=51.98 E-value=21 Score=25.84 Aligned_cols=33 Identities=15% Similarity=0.285 Sum_probs=19.5 Q ss_pred cccEEEEccChHHH---HHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNKT---MSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~~---~~~al~~l~~gGrvv~vG~~ 37 (100) .+|+||.|++.+.. ...+++... ++..+++-.. T Consensus 238 ~aDvVi~at~~~~~~~~~~~~~~~~~-~~~~~viDla 273 (311) T cd05213 238 EADVVISATGAPHYAKIVERAMKKRS-GKPRLIVDLA 273 (311) T ss_pred cCCEEEECCCCCchHHHHHHHHhhCC-CCCeEEEEeC Confidence 47999999998765 344444332 2334444433 No 222 >TIGR00119 acolac_sm acetolactate synthase, small subunit. acetohydroxyacid synthase is a synonym. Probab=51.67 E-value=24 Score=23.32 Aligned_cols=28 Identities=11% Similarity=0.131 Sum_probs=24.0 Q ss_pred EEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 7 VSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 7 ~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) +++|.+|.+.-++..+++++|.|.+-++ T Consensus 119 ~~ie~tG~~~ki~~~~~~l~~~gi~e~~ 146 (157) T TIGR00119 119 YTVEVTGDSDKIDAFLELLRPFGIKEVA 146 (157) T ss_pred EEEEEcCCHHHHHHHHHHhhhcCCEEEE Confidence 5899999999999999999999855543 No 223 >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Probab=51.44 E-value=28 Score=23.58 Aligned_cols=34 Identities=12% Similarity=0.113 Sum_probs=24.2 Q ss_pred CcccEEE-----EccChH-HHHHHHHHhccCCCEEEEecC Q 034260 3 AGIDVSF-----DCAGLN-KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 3 ~G~D~vi-----e~~G~~-~~~~~al~~l~~gGrvv~vG~ 36 (100) ..+|+|+ +..+.+ ..++.+.+.++++|++++... T Consensus 113 ~~fD~Ii~~~~l~~~~~~~~~l~~~~~~L~~gG~l~v~~~ 152 (233) T PRK05134 113 GQFDVVTCMEMLEHVPDPASFVRACAKLVKPGGLVFFSTL 152 (233) T ss_pred CCccEEEEhhHhhccCCHHHHHHHHHHHcCCCcEEEEEec Confidence 3578874 444443 456888999999999987643 No 224 >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Probab=51.14 E-value=22 Score=26.33 Aligned_cols=24 Identities=8% Similarity=0.196 Sum_probs=20.1 Q ss_pred HHHHHHHHHhccCCCEEEEecCCC Q 034260 15 NKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 15 ~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ...+.++.+.|++||++.+|+... T Consensus 283 ~~~i~~a~~~LkpgG~L~iVan~~ 306 (342) T PRK09489 283 QTLIRGAVRHLNSGGELRIVANAF 306 (342) T ss_pred HHHHHHHHHhcCcCCEEEEEEeCC Confidence 356788899999999999998654 No 225 >PRK13302 putative L-aspartate dehydrogenase; Provisional Probab=51.11 E-value=29 Score=24.74 Aligned_cols=31 Identities=19% Similarity=0.191 Sum_probs=23.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|++|++.....+.+.++++.|-.+++. T Consensus 67 ~~D~Vvi~tp~~~h~e~~~~aL~aGk~Vi~~ 97 (271) T PRK13302 67 HADIVVEAAPASVLRAIVEPVLAAGKKAIVL 97 (271) T ss_pred CCCEEEECCCcHHHHHHHHHHHHcCCcEEEe Confidence 4799999999877777777777776555543 No 226 >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Probab=50.82 E-value=16 Score=25.77 Aligned_cols=31 Identities=13% Similarity=0.104 Sum_probs=24.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+..- .+...++..+.|+|||+++++. T Consensus 151 sfD~I~~~~-~~~~~~e~~rvLkpgG~li~~~ 181 (272) T PRK11088 151 SLDAIIRIY-APCKAEELARVVKPGGIVITVT 181 (272) T ss_pred ceeEEEEec-CCCCHHHHHhhccCCCEEEEEe Confidence 478877543 3556788899999999999885 No 227 >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B. Probab=50.68 E-value=41 Score=20.10 Aligned_cols=36 Identities=17% Similarity=0.144 Sum_probs=25.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) ++|+|+-|++.+..-++..+.++..|..+.+.-.+. T Consensus 60 ~~~lV~~at~d~~~n~~i~~~a~~~~i~vn~~D~p~ 95 (103) T PF13241_consen 60 GADLVFAATDDPELNEAIYADARARGILVNVVDDPE 95 (103) T ss_dssp TESEEEE-SS-HHHHHHHHHHHHHTTSEEEETT-CC T ss_pred hheEEEecCCCHHHHHHHHHHHhhCCEEEEECCCcC Confidence 689999999987766666677777888888765443 No 228 >TIGR00138 gidB 16S rRNA methyltransferase GidB. GidB (glucose-inhibited division protein B) appears to be present and in a single copy in nearly all complete eubacterial genomes. It is missing only from some obligate intracellular species of various lineages (Chlamydiae, Ehrlichia, Wolbachia, Anaplasma, Buchnera, etc.). GidB shows a methytransferase fold in its the crystal structure, and acts as a 7-methylguanosine (m(7)G) methyltransferase, apparently specific to 16S rRNA. Probab=50.63 E-value=40 Score=22.41 Aligned_cols=31 Identities=23% Similarity=0.207 Sum_probs=22.0 Q ss_pred cccEEEEcc--ChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCA--GLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~--G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|+-.. ..+..++.+.+++++||++++. T Consensus 109 ~fD~I~s~~~~~~~~~~~~~~~~LkpgG~lvi~ 141 (181) T TIGR00138 109 QFDVITSRALASLNVLLELTLNLLKVGGYFLAY 141 (181) T ss_pred CccEEEehhhhCHHHHHHHHHHhcCCCCEEEEE Confidence 477766432 2235667788899999999976 No 229 >PLN02781 Probable caffeoyl-CoA O-methyltransferase Probab=50.17 E-value=31 Score=23.97 Aligned_cols=32 Identities=16% Similarity=0.215 Sum_probs=23.6 Q ss_pred cccEEEEcc---ChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA---GLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~---G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|.|+--. .....++++++.+++||.+++-. T Consensus 144 ~fD~VfiDa~k~~y~~~~~~~~~ll~~GG~ii~dn 178 (234) T PLN02781 144 EFDFAFVDADKPNYVHFHEQLLKLVKVGGIIAFDN 178 (234) T ss_pred CCCEEEECCCHHHHHHHHHHHHHhcCCCeEEEEEc Confidence 588877543 23356889999999999988644 No 230 >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A .... Probab=50.09 E-value=14 Score=21.92 Aligned_cols=19 Identities=5% Similarity=0.267 Sum_probs=16.5 Q ss_pred HHHHHHHHhccCCCEEEEe Q 034260 16 KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~v 34 (100) ..++++.+.++++|+++++ T Consensus 96 ~~~~~~~~~L~~gG~~~~~ 114 (117) T PF13659_consen 96 RFLEAAARLLKPGGVLVFI 114 (117) T ss_dssp HHHHHHHHHEEEEEEEEEE T ss_pred HHHHHHHHHcCCCeEEEEE Confidence 3588999999999999876 No 231 >PLN02233 ubiquinone biosynthesis methyltransferase Probab=49.33 E-value=22 Score=25.01 Aligned_cols=36 Identities=14% Similarity=0.161 Sum_probs=25.8 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .+|+|+-.- -....+++..+.|+|||+++++-.... T Consensus 145 sfD~V~~~~~l~~~~d~~~~l~ei~rvLkpGG~l~i~d~~~~ 186 (261) T PLN02233 145 YFDAITMGYGLRNVVDRLKAMQEMYRVLKPGSRVSILDFNKS 186 (261) T ss_pred CEeEEEEecccccCCCHHHHHHHHHHHcCcCcEEEEEECCCC Confidence 467775432 223578999999999999998865543 No 232 >PRK08300 acetaldehyde dehydrogenase; Validated Probab=48.93 E-value=32 Score=25.26 Aligned_cols=52 Identities=15% Similarity=0.089 Sum_probs=31.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC--C---cccChHHHHh-cCcEEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH--D---MTVPLTPAAA-RYLIYG 56 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~--~---~~i~~~~l~~-k~~~i~ 56 (100) .+|+|++|++.....+.+.++++.| +.++.=.+.. | .+++...+.. ++..+. T Consensus 70 dIDiVf~AT~a~~H~e~a~~a~eaG-k~VID~sPA~~~PlvVP~VN~~~~~~~~~~~ii 127 (302) T PRK08300 70 DIDIVFDATSAGAHVRHAAKLREAG-IRAIDLTPAAIGPYCVPAVNLDEHLDAPNVNMV 127 (302) T ss_pred CCCEEEECCCHHHHHHHHHHHHHcC-CeEEECCccccCCcccCcCCHHHHhcccCCCEE Confidence 5899999999977777766666555 4444433322 3 2356655533 334554 No 233 >PRK10258 biotin biosynthesis protein BioC; Provisional Probab=48.41 E-value=53 Score=22.58 Aligned_cols=35 Identities=14% Similarity=0.328 Sum_probs=25.6 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+|+-... ....+.++.+.+++||.+++..... T Consensus 103 ~fD~V~s~~~l~~~~d~~~~l~~~~~~Lk~gG~l~~~~~~~ 143 (251) T PRK10258 103 TFDLAWSNLAVQWCGNLSTALRELYRVVRPGGVVAFTTLVQ 143 (251) T ss_pred cEEEEEECchhhhcCCHHHHHHHHHHHcCCCeEEEEEeCCC Confidence 4788775432 2357899999999999999875443 No 234 >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Probab=48.35 E-value=26 Score=26.76 Aligned_cols=34 Identities=24% Similarity=0.402 Sum_probs=27.2 Q ss_pred cccEEEEccChHHH-HHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNKT-MSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~~-~~~al~~l~~gGrvv~vG~~ 37 (100) ..|++||++|.|.. .+-+++++..+=.+|++-+- T Consensus 101 ~IdvIIdATG~p~vGA~~~l~Ai~h~KHlVMmNVE 135 (438) T COG4091 101 LIDVIIDATGVPEVGAKIALEAILHGKHLVMMNVE 135 (438) T ss_pred cceEEEEcCCCcchhhHhHHHHHhcCCeEEEEEee Confidence 58999999999853 57788888888888877543 No 235 >PRK07402 precorrin-6B methylase; Provisional Probab=47.48 E-value=43 Score=22.19 Aligned_cols=23 Identities=9% Similarity=0.257 Sum_probs=18.8 Q ss_pred HHHHHHHHHhccCCCEEEEecCC Q 034260 15 NKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 15 ~~~~~~al~~l~~gGrvv~vG~~ 37 (100) ...++++.+.+++||++++.... T Consensus 122 ~~~l~~~~~~LkpgG~li~~~~~ 144 (196) T PRK07402 122 KEILQAVWQYLKPGGRLVATASS 144 (196) T ss_pred HHHHHHHHHhcCCCeEEEEEeec Confidence 36788889999999999988543 No 236 >COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Probab=46.75 E-value=1.3e+02 Score=23.50 Aligned_cols=72 Identities=18% Similarity=0.070 Sum_probs=44.3 Q ss_pred cccEEEEccChHHHHHHHHHhcc--CCCEE-EEecCCCCC--cccChH-HHH--hcCcEEEeEeeceeeeeechhhHHH- Q 034260 4 GIDVSFDCAGLNKTMSTVLDATR--AGDKV-CLVGMGHHD--MTVPLT-PAA--ARYLIYGFLFFFFLVLGYSVIYFRK- 74 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~--~gGrv-v~vG~~~~~--~~i~~~-~l~--~k~~~i~Gs~~~~g~~~~~~~~~~~- 74 (100) ++.+++|-+=.|..+++++++++ ..|++ +++|..++. ...+.. .+. ..+..+. .+-+...++.+. T Consensus 332 ~~~v~VDyAHnPd~le~~L~~~~~~~~g~li~VfG~gGDrD~~kr~~mg~ia~~~ad~viv------t~dnpR~edp~~i 405 (475) T COG0769 332 GKLVIVDYAHNPDGLEKALRAVRLHAAGRLIVVFGCGGDRDKSKRPDMGAIAEQLADIVIV------TSDNPRSEDPAVI 405 (475) T ss_pred CCeEEEEeccChHHHHHHHHHHHhhcCCcEEEEECccCCCCcccccchHHHHHhcCCcEEE------cCCCCCCcCHHHH Confidence 68899999999999999999998 34555 455666542 233333 232 2344555 344554455644 Q ss_pred HHHHhcC Q 034260 75 MLYISGQ 81 (100) Q Consensus 75 i~~l~~~ 81 (100) +..+..+ T Consensus 406 ~~~i~~g 412 (475) T COG0769 406 LADILAG 412 (475) T ss_pred HHHHHhc Confidence 3455554 No 237 >TIGR02072 BioC biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology. Probab=46.57 E-value=59 Score=21.63 Aligned_cols=33 Identities=12% Similarity=0.266 Sum_probs=24.8 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+-.. .....+....+.++++|.+++... T Consensus 98 ~fD~vi~~~~l~~~~~~~~~l~~~~~~L~~~G~l~~~~~ 136 (240) T TIGR02072 98 SFDLIVSNLALQWCDDLSQALSELARVLKPGGLLAFSTF 136 (240) T ss_pred ceeEEEEhhhhhhccCHHHHHHHHHHHcCCCcEEEEEeC Confidence 478877643 234578889999999999998654 No 238 >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Probab=46.33 E-value=49 Score=22.10 Aligned_cols=35 Identities=9% Similarity=0.283 Sum_probs=25.0 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+|+-.- -....++.+.++++++|+++++.... T Consensus 121 ~~D~I~~~~~l~~~~~~~~~l~~~~~~L~~gG~li~~~~~~ 161 (239) T PRK00216 121 SFDAVTIAFGLRNVPDIDKALREMYRVLKPGGRLVILEFSK 161 (239) T ss_pred CccEEEEecccccCCCHHHHHHHHHHhccCCcEEEEEEecC Confidence 367765321 23457889999999999999886554 No 239 >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Probab=46.17 E-value=50 Score=24.83 Aligned_cols=33 Identities=12% Similarity=0.106 Sum_probs=24.3 Q ss_pred cccEEE-----EccCh---HHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSF-----DCAGL---NKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vi-----e~~G~---~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+ +.+|. +..++++.++++|||++++... T Consensus 228 ~fD~Ivs~~~~ehvg~~~~~~~l~~i~r~LkpGG~lvl~~i 268 (383) T PRK11705 228 QFDRIVSVGMFEHVGPKNYRTYFEVVRRCLKPDGLFLLHTI 268 (383) T ss_pred CCCEEEEeCchhhCChHHHHHHHHHHHHHcCCCcEEEEEEc Confidence 477775 33454 3568888999999999998654 No 240 >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=46.02 E-value=22 Score=26.01 Aligned_cols=33 Identities=18% Similarity=0.264 Sum_probs=27.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..++..+ +++|..++-+|... T Consensus 201 ~ADIVIsavg~~~~v~~~~--lk~GavVIDvGin~ 233 (296) T PRK14188 201 RADILVAAVGRPEMVKGDW--IKPGATVIDVGINR 233 (296) T ss_pred cCCEEEEecCChhhcchhe--ecCCCEEEEcCCcc Confidence 5899999999988777654 89999888899764 No 241 >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyses S-methylation of aromatic and heterocyclic sulphydryl compounds, including anticancer and immunosuppressive thiopurines [].; GO: 0008119 thiopurine S-methyltransferase activity, 0008152 metabolic process, 0005737 cytoplasm; PDB: 1PJZ_A 2H11_A 2BZG_A 3LCC_A 3BGD_A 2GB4_A 3BGI_B. Probab=45.99 E-value=19 Score=24.93 Aligned_cols=33 Identities=12% Similarity=0.220 Sum_probs=25.0 Q ss_pred cccEEEEccC--------hHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAG--------LNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G--------~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+|++- .+.-.++..++++|+|++.++.+ T Consensus 116 ~fD~iyDr~~l~Alpp~~R~~Ya~~l~~ll~p~g~~lLi~l 156 (218) T PF05724_consen 116 KFDLIYDRTFLCALPPEMRERYAQQLASLLKPGGRGLLITL 156 (218) T ss_dssp SEEEEEECSSTTTS-GGGHHHHHHHHHHCEEEEEEEEEEEE T ss_pred CceEEEEecccccCCHHHHHHHHHHHHHHhCCCCcEEEEEE Confidence 4899999855 23457888899999999666554 No 242 >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP. Later the ubiquitin moiety is transferred to a cysteine residue on one of the many forms of ubiquitin- conjugating enzymes (E2). The family of ubiquitin-activating enzymes shares in its catalytic domain significant similarity with a large family of NAD/FAD-binding proteins. This domain is based on the common NAD/FAD-binding fold and finds members of several families, including UBA ubiquitin activating enzymes; the hesA/moeB/thiF family; NADH peroxidases; the LDH family; sarcosin oxidase; phytoene dehydrogenases; alanine dehydrogenases; hydroxyacyl-CoA dehydrogenases and many other NAD/FAD dependent dehydrogenases and oxidases.; GO: 0003824 catalytic activity; PDB: 1ZKM_D 1ZUD_3 1ZFN_D 1R4M_G 2NVU_A 1R4N_C 3DBR_A 3DBH_C 3DBL_G 1YOV_A .... Probab=45.85 E-value=35 Score=21.22 Aligned_cols=32 Identities=13% Similarity=0.109 Sum_probs=20.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) ++|+|++|+...++-...-+.++..+.-.+.+ T Consensus 92 ~~d~vi~~~d~~~~~~~l~~~~~~~~~p~i~~ 123 (135) T PF00899_consen 92 DYDIVIDCVDSLAARLLLNEICREYGIPFIDA 123 (135) T ss_dssp TSSEEEEESSSHHHHHHHHHHHHHTT-EEEEE T ss_pred CCCEEEEecCCHHHHHHHHHHHHHcCCCEEEE Confidence 57899999988665555555666555554443 No 243 >PLN03075 nicotianamine synthase; Provisional Probab=45.72 E-value=45 Score=24.43 Aligned_cols=32 Identities=22% Similarity=0.165 Sum_probs=24.5 Q ss_pred cccEEEEcc-------ChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA-------GLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~-------G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-.+ .....++...+.++|||.+++=. T Consensus 195 ~FDlVF~~ALi~~dk~~k~~vL~~l~~~LkPGG~Lvlr~ 233 (296) T PLN03075 195 EYDVVFLAALVGMDKEEKVKVIEHLGKHMAPGALLMLRS 233 (296) T ss_pred CcCEEEEecccccccccHHHHHHHHHHhcCCCcEEEEec Confidence 588887765 33357889999999999998643 No 244 >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. Probab=45.62 E-value=35 Score=21.42 Aligned_cols=32 Identities=13% Similarity=0.091 Sum_probs=21.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) ++|+|++|+.........-+.++..+.-.+.+ T Consensus 89 ~~diVi~~~d~~~~~~~l~~~~~~~~i~~i~~ 120 (143) T cd01483 89 GVDLVIDAIDNIAVRRALNRACKELGIPVIDA 120 (143) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHcCCCEEEE Confidence 68999999998766555556666655544443 No 245 >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Probab=44.65 E-value=35 Score=22.70 Aligned_cols=29 Identities=14% Similarity=0.248 Sum_probs=24.3 Q ss_pred cEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 6 DVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 6 D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) -+++|.+|.+.-++..+++++|.|-+-++ T Consensus 119 ~~~iE~tG~~~ki~~~~~~l~~~gi~e~~ 147 (161) T PRK11895 119 SLTIEVTGDSDKIDAFIDLLRPYGIKEIV 147 (161) T ss_pred EEEEEEeCCHHHHHHHHHHhhhcCCEEEE Confidence 36899999999999999999999855443 No 246 >TIGR02886 spore_II_AA anti-sigma F factor antagonist. The anti-sigma F factor antagonist, also called stage II sporulation protein AA, is a protein universal among endospore-forming bacteria, all of which belong to the Firmcutes Probab=44.55 E-value=31 Score=20.34 Aligned_cols=11 Identities=18% Similarity=0.438 Sum_probs=5.3 Q ss_pred CCCEEEEecCC Q 034260 27 AGDKVCLVGMG 37 (100) Q Consensus 27 ~gGrvv~vG~~ 37 (100) .|++++++|.. T Consensus 70 ~g~~l~l~~~~ 80 (106) T TIGR02886 70 EGGEVIVCNVS 80 (106) T ss_pred cCCEEEEEeCC Confidence 44555555443 No 247 >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU. Members of this protein family are the S-adenosylmethionine-depenedent C-20 methyltransferase BchU, part of the pathway of bacteriochlorophyll c production in photosynthetic green sulfur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produced bacteriochlorophyll d. Probab=44.30 E-value=30 Score=24.72 Aligned_cols=20 Identities=25% Similarity=0.531 Sum_probs=17.4 Q ss_pred HHHHHHHhccCCCEEEEecC Q 034260 17 TMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~ 36 (100) .++.+.+.++|||+++++=. T Consensus 236 il~~~~~~L~pgG~l~i~d~ 255 (306) T TIGR02716 236 MCKKAFDAMRSGGRLLILDM 255 (306) T ss_pred HHHHHHHhcCCCCEEEEEEe Confidence 57888999999999999854 No 248 >CHL00100 ilvH acetohydroxyacid synthase small subunit Probab=44.14 E-value=36 Score=22.93 Aligned_cols=29 Identities=3% Similarity=0.038 Sum_probs=24.4 Q ss_pred cEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 6 DVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 6 D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+++|.+|.+.-++..+++++|.|-+-++ T Consensus 119 ~~~ie~tG~~~ki~a~~~~l~~~gi~e~~ 147 (174) T CHL00100 119 SLILEVTGDPGKIVAIEQLLEKFGIIEIA 147 (174) T ss_pred EEEEEEcCCHHHHHHHHHHhhhcCCEEEE Confidence 36899999999999999999998855444 No 249 >PRK05562 precorrin-2 dehydrogenase; Provisional Probab=44.07 E-value=78 Score=22.18 Aligned_cols=52 Identities=4% Similarity=-0.082 Sum_probs=29.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhc-CcEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAAR-YLIY 55 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k-~~~i 55 (100) |+++||-|++.++.-++..+.++..+.+|.+.-......+-...+..+ .++| T Consensus 85 g~~LViaATdD~~vN~~I~~~a~~~~~lvn~vd~p~~~dFi~PAiv~rg~l~I 137 (223) T PRK05562 85 DKHLIVIATDDEKLNNKIRKHCDRLYKLYIDCSDYKKGLCIIPYQRSTKNFVF 137 (223) T ss_pred CCcEEEECCCCHHHHHHHHHHHHHcCCeEEEcCCcccCeEEeeeEEecCCEEE Confidence 689999999986544444455555576666543333333333333444 4555 No 250 >TIGR00537 hemK_rel_arch HemK-related putative methylase. The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase (Medline 95189105). Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. This model represents an archaeal and eukaryotic protein family that lacks an N-terminal domain found in HemK and its eubacterial homologs. It is found in a single copy in the first six completed archaeal and eukaryotic genomes. Probab=44.02 E-value=30 Score=22.58 Aligned_cols=23 Identities=13% Similarity=0.293 Sum_probs=18.2 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++++.+.+++||+++++.... T Consensus 121 ~~l~~~~~~Lk~gG~~~~~~~~~ 143 (179) T TIGR00537 121 RFLDELPEILKEGGRVQLIQSSL 143 (179) T ss_pred HHHHhHHHhhCCCCEEEEEEecc Confidence 34778889999999999986443 No 251 >TIGR00417 speE spermidine synthase. the SpeE subunit of spermidine synthase catalysesthe reaction (putrescine + S-adenosylmethioninamine = spermidine + 5'-methylthioadenosine) and is involved in polyamine biosynthesis and in the biosynthesis of spermidine from arganine. The region between residues 77 and 120 of the seed alignment is thought to be involved in binding to decarboxylated SAM. Probab=43.40 E-value=56 Score=23.05 Aligned_cols=21 Identities=5% Similarity=-0.105 Sum_probs=17.2 Q ss_pred HHHHHHHHhccCCCEEEEecC Q 034260 16 KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~ 36 (100) +.++.+.+.|+++|.+++... T Consensus 167 ef~~~~~~~L~pgG~lv~~~~ 187 (270) T TIGR00417 167 EFYELLKKALNEDGIFVAQSE 187 (270) T ss_pred HHHHHHHHHhCCCcEEEEcCC Confidence 456788899999999998743 No 252 >PRK12335 tellurite resistance protein TehB; Provisional Probab=42.81 E-value=52 Score=23.38 Aligned_cols=33 Identities=12% Similarity=0.185 Sum_probs=23.3 Q ss_pred CcccEEEEcc-----C---hHHHHHHHHHhccCCCEEEEec Q 034260 3 AGIDVSFDCA-----G---LNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 3 ~G~D~vie~~-----G---~~~~~~~al~~l~~gGrvv~vG 35 (100) ..+|+|+... . .+..+++..+++++||.++++. T Consensus 183 ~~fD~I~~~~vl~~l~~~~~~~~l~~~~~~LkpgG~~l~v~ 223 (287) T PRK12335 183 EEYDFILSTVVLMFLNRERIPAIIKNMQEHTNPGGYNLIVC 223 (287) T ss_pred CCccEEEEcchhhhCCHHHHHHHHHHHHHhcCCCcEEEEEE Confidence 3578887653 1 2346788889999999977654 No 253 >COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Probab=42.79 E-value=1e+02 Score=23.81 Aligned_cols=28 Identities=18% Similarity=0.326 Sum_probs=23.0 Q ss_pred cChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 12 AGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 12 ~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) +|+++...-.+.++.||.++.-+-...+ T Consensus 96 SGs~AN~av~~All~pGDtimgm~l~~G 123 (413) T COG0112 96 SGSQANQAVYLALLQPGDTIMGLDLSHG 123 (413) T ss_pred CchHHHHHHHHHHcCCCCeEecccCCCC Confidence 7888888888899999999987766554 No 254 >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit. This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by TIGR02852. This protein is also known as SpoVFA. Probab=41.89 E-value=1.2e+02 Score=21.75 Aligned_cols=51 Identities=12% Similarity=-0.029 Sum_probs=32.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYG 56 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~ 56 (100) .+|+++.|++..-.-...++.++++..++=++..+...+ +...-.++++.. T Consensus 209 ~aDiVint~P~~ii~~~~l~~~k~~aliIDlas~Pg~td--f~~Ak~~G~~a~ 259 (287) T TIGR02853 209 EIDIVINTIPALVLTADVLSKLPKHAVIIDLASKPGGTD--FEYAKKRGIKAL 259 (287) T ss_pred cCCEEEECCChHHhCHHHHhcCCCCeEEEEeCcCCCCCC--HHHHHHCCCEEE Confidence 589999999875333566778888766666666554444 444444444444 No 255 >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Probab=41.84 E-value=35 Score=24.07 Aligned_cols=35 Identities=6% Similarity=0.063 Sum_probs=25.1 Q ss_pred cccEEEEc-----c---ChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDC-----A---GLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~-----~---G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+|+-. . .....++++.+.|+|||++++.-... T Consensus 117 ~FD~V~s~~~l~h~~~~d~~~~l~~i~r~LkPGG~lvi~d~~~ 159 (263) T PTZ00098 117 TFDMIYSRDAILHLSYADKKKLFEKCYKWLKPNGILLITDYCA 159 (263) T ss_pred CeEEEEEhhhHHhCCHHHHHHHHHHHHHHcCCCcEEEEEEecc Confidence 47887752 1 22357888899999999999876543 No 256 >PRK14904 16S rRNA methyltransferase B; Provisional Probab=41.80 E-value=50 Score=25.17 Aligned_cols=20 Identities=5% Similarity=0.110 Sum_probs=16.8 Q ss_pred HHHHHHHhccCCCEEEEecC Q 034260 17 TMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~ 36 (100) .+..+.+++++||+++...- T Consensus 359 iL~~a~~~lkpgG~lvystc 378 (445) T PRK14904 359 LLDHAASLLKPGGVLVYATC 378 (445) T ss_pred HHHHHHHhcCCCcEEEEEeC Confidence 57888999999999998543 No 257 >PRK00048 dihydrodipicolinate reductase; Provisional Probab=41.56 E-value=48 Score=23.32 Aligned_cols=32 Identities=22% Similarity=0.210 Sum_probs=21.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+||+......+.+..+++. |.-+++|. T Consensus 60 ~~DvVid~t~p~~~~~~~~~al~~-G~~vvigt 91 (257) T PRK00048 60 DADVLIDFTTPEATLENLEFALEH-GKPLVIGT 91 (257) T ss_pred CCCEEEECCCHHHHHHHHHHHHHc-CCCEEEEC Confidence 589999999765555555555544 56666774 No 258 >PRK13256 thiopurine S-methyltransferase; Reviewed Probab=41.55 E-value=49 Score=23.19 Aligned_cols=34 Identities=15% Similarity=0.256 Sum_probs=25.6 Q ss_pred cccEEEEccCh--------HHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGL--------NKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~--------~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|.|+|.+-- ....+...+++++||+++++-.. T Consensus 124 ~fD~VyDra~~~Alpp~~R~~Y~~~l~~lL~pgg~llll~~~ 165 (226) T PRK13256 124 VFDIWYDRGAYIALPNDLRTNYAKMMLEVCSNNTQILLLVME 165 (226) T ss_pred CcCeeeeehhHhcCCHHHHHHHHHHHHHHhCCCcEEEEEEEe Confidence 58999996542 13456777889999999998764 No 259 >PRK14968 putative methyltransferase; Provisional Probab=40.71 E-value=36 Score=21.89 Aligned_cols=19 Identities=16% Similarity=0.265 Sum_probs=16.1 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .++++.++++++|.++++- T Consensus 130 ~i~~~~~~Lk~gG~~~~~~ 148 (188) T PRK14968 130 FLDEVGRYLKPGGRILLLQ 148 (188) T ss_pred HHHHHHHhcCCCeEEEEEE Confidence 5788999999999988763 No 260 >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot. GFO is a glucose--fructose oxidoreductase, which converts D-glucose and D-fructose into D-gluconolactone and D-glucitol in the sorbitol-gluconate pathway. MOCA is a rhizopine catabolism protein which may catalyse the NADH-dependent dehydrogenase reaction involved in rhizopine catabolism. Other proteins belonging to this family include Gal80, a negative regulator for the expression of lactose and galactose metabolic genes; and several hypothetical proteins from yeast, Escherichia coli and Bacillus subtilis. The oxidoreductase, N-terminal domain is almost always associated with the oxidoreductase, C-terminal domain (see IPR004104 from INTERPRO).; GO: 0016491 oxidoreductase activity; PDB: 1LC0_A 1LC3_A 1GCU_A 3IP3_E 3CEA_C 3EVN_A 3NTQ_A 3NTR_B 3NT5_A 3MZ0_A .... Probab=40.35 E-value=52 Score=19.59 Aligned_cols=26 Identities=15% Similarity=0.137 Sum_probs=17.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGD 29 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gG 29 (100) .+|+|+-|+......+.+.++++.|- T Consensus 62 ~~D~V~I~tp~~~h~~~~~~~l~~g~ 87 (120) T PF01408_consen 62 DVDAVIIATPPSSHAEIAKKALEAGK 87 (120) T ss_dssp TESEEEEESSGGGHHHHHHHHHHTTS T ss_pred cCCEEEEecCCcchHHHHHHHHHcCC Confidence 46777777777666666666666654 No 261 >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes. RrmJ is responsible for methylating 23 S rRNA at position U2552 in the aminoacyl (A)1-site of the ribosome []. U2552 is one of the five universally conserved A-loop residues and has been shown to be methylated at the ribose 2'-OH group in the majority of organisms investigated so far. This suggests that this modification plays an important role in the A-loop function. RrmJ recognises its methylation target only when the 23 S rRNA is present in 50 S ribosomal subunits. This suggests that the RrmJ-mediated methylation must occur late in the maturation process of the ribosome. This is in contrast to other known 23 S rRNA modifications that occur in earlier maturation steps. The 1.5 A crystal structure of RrmJ in complex with its cofactor S-adenosylmethionine revealed that RrmJ has a methyltransferase fold. The active site of RrmJ appears to be formed by a catalytic triad consisting of two lysine residues and the negatively charged aspartate residue. Another highly conserved glutamate residue that is present in the active site of RrmJ appears to play only a minor role in the methyltransfer reaction in vivo []. ; GO: 0003676 nucleic acid binding, 0008168 methyltransferase activity, 0032259 methylation; PDB: 3GCZ_A 2PLW_A 2NYU_A 2OXT_C 3EMD_A 3ELY_A 3ELW_A 3ELU_A 3ELD_A 3EMB_A .... Probab=40.33 E-value=33 Score=22.41 Aligned_cols=22 Identities=9% Similarity=0.161 Sum_probs=16.3 Q ss_pred HHHHHHHhccCCCEEEEecCCC Q 034260 17 TMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+..+++.+++||++++-=... T Consensus 121 ~l~~a~~~L~~gG~~v~K~~~~ 142 (181) T PF01728_consen 121 QLLLALELLKPGGTFVIKVFKG 142 (181) T ss_dssp HHHHHHHHHCTTEEEEEEESSS T ss_pred HHHHHHhhhcCCCEEEEEeccC Confidence 4667778889999988754443 No 262 >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Probab=40.20 E-value=67 Score=23.15 Aligned_cols=32 Identities=22% Similarity=0.233 Sum_probs=24.8 Q ss_pred cccEEEEccChH-HHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLN-KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~-~~~~~al~~l~~gGrvv~vG 35 (100) .+|+++==.+.| ..++.+.+++++||++++.- T Consensus 163 ~vDav~LDmp~PW~~le~~~~~Lkpgg~~~~y~ 195 (256) T COG2519 163 DVDAVFLDLPDPWNVLEHVSDALKPGGVVVVYS 195 (256) T ss_pred ccCEEEEcCCChHHHHHHHHHHhCCCcEEEEEc Confidence 467755444444 78999999999999999875 No 263 >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3.3.1.1 from EC) (AdoHcyase) is an enzyme of the activated methyl cycle, responsible for the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. AdoHcyase is an ubiquitous enzyme which binds and requires NAD+ as a cofactor. AdoHcyase is a highly conserved protein [] of about 430 to 470 amino acids. This entry represents the glycine-rich region in the central part of AdoHcyase, which is thought to be involved in NAD-binding.; GO: 0004013 adenosylhomocysteinase activity; PDB: 2ZJ1_C 3DHY_B 2ZIZ_C 2ZJ0_D 3CE6_B 3GLQ_B 3D64_A 3G1U_C 1A7A_A 3NJ4_C .... Probab=39.69 E-value=19 Score=24.07 Aligned_cols=45 Identities=11% Similarity=0.166 Sum_probs=27.3 Q ss_pred cccEEEEccChHHHH-HHHHHhccCCCEEEEecCCCCCcccChHHHHh Q 034260 4 GIDVSFDCAGLNKTM-STVLDATRAGDKVCLVGMGHHDMTVPLTPAAA 50 (100) Q Consensus 4 G~D~vie~~G~~~~~-~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~ 50 (100) .+|+++-|+|....+ .+-++.++.+.-+.-+|.... ++++..+-. T Consensus 78 ~adi~vtaTG~~~vi~~e~~~~mkdgail~n~Gh~d~--Eid~~~L~~ 123 (162) T PF00670_consen 78 DADIFVTATGNKDVITGEHFRQMKDGAILANAGHFDV--EIDVDALEA 123 (162) T ss_dssp T-SEEEE-SSSSSSB-HHHHHHS-TTEEEEESSSSTT--SBTHHHHHT T ss_pred hCCEEEECCCCccccCHHHHHHhcCCeEEeccCcCce--eEeeccccc Confidence 468889999986643 566788888776666665543 455544433 No 264 >PF04019 DUF359: Protein of unknown function (DUF359); InterPro: IPR007164 This is family of archaebacterial proteins, which are about 170 amino acids in length. They have no known function. The most conserved portion of the protein contains the sequence GEEDL that may be important for its function. Probab=39.29 E-value=80 Score=19.99 Aligned_cols=36 Identities=14% Similarity=-0.041 Sum_probs=22.4 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) -.+.+.--|..+.+....-+.+|.|.+|+.|.+... T Consensus 62 ~~~~I~V~GEEDL~~lPail~aP~gs~V~YGQP~eG 97 (121) T PF04019_consen 62 KPVVIFVDGEEDLAVLPAILYAPEGSVVLYGQPGEG 97 (121) T ss_pred CCEEEEEeChHHHHHHHHHHhCCCCCEEEECCCCCe Confidence 345555566665555555666777777777776643 No 265 >cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase. Members of this family contain the SIS (Sugar ISomerase) domain. The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. The bacterial cell wall sugar N-acetylmuramic acid carries a unique D-lactyl ether substituent at the C3 position. The etherase catalyzes the cleavage of the lactyl ether bond of N-acetylmuramic acid 6-phosphate. Probab=39.18 E-value=34 Score=24.21 Aligned_cols=23 Identities=26% Similarity=0.559 Sum_probs=19.1 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+++.+.+.++.+||+.++|... T Consensus 37 ~av~~~~~~l~~ggrl~~~GaGt 59 (257) T cd05007 37 RAVDAAAERLRAGGRLIYVGAGT 59 (257) T ss_pred HHHHHHHHHHHcCCEEEEEcCcH Confidence 45677888889999999999765 No 266 >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Probab=38.95 E-value=77 Score=22.69 Aligned_cols=35 Identities=11% Similarity=0.126 Sum_probs=24.4 Q ss_pred CcccEEE-----EccChH-HHHHHHHHhccCCCEEEEecCC Q 034260 3 AGIDVSF-----DCAGLN-KTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 3 ~G~D~vi-----e~~G~~-~~~~~al~~l~~gGrvv~vG~~ 37 (100) +.+|+|+ |=+..+ ..+..|.++++|+|.+.+--.. T Consensus 123 ~~FDvV~cmEVlEHv~dp~~~~~~c~~lvkP~G~lf~STin 163 (243) T COG2227 123 GQFDVVTCMEVLEHVPDPESFLRACAKLVKPGGILFLSTIN 163 (243) T ss_pred CCccEEEEhhHHHccCCHHHHHHHHHHHcCCCcEEEEeccc Confidence 4577764 335555 3578899999999998875444 No 267 >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase. Probab=38.84 E-value=35 Score=24.06 Aligned_cols=19 Identities=16% Similarity=0.331 Sum_probs=16.2 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .++.+++++++||+++... T Consensus 181 iL~~a~~~lkpgG~lvYst 199 (264) T TIGR00446 181 LIDSAFDALKPGGVLVYST 199 (264) T ss_pred HHHHHHHhcCCCCEEEEEe Confidence 6788999999999998654 No 268 >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A .... Probab=38.81 E-value=46 Score=20.96 Aligned_cols=35 Identities=9% Similarity=0.169 Sum_probs=25.8 Q ss_pred CcccEEEEcc-----ChH-HHHHHHHHhccCCCEEEEecCC Q 034260 3 AGIDVSFDCA-----GLN-KTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 3 ~G~D~vie~~-----G~~-~~~~~al~~l~~gGrvv~vG~~ 37 (100) ..+|+|+... ..+ ..++.+.+.++++|++++.-.. T Consensus 72 ~~~D~I~~~~~l~~~~~~~~~l~~~~~~lk~~G~~i~~~~~ 112 (152) T PF13847_consen 72 EKFDIIISNGVLHHFPDPEKVLKNIIRLLKPGGILIISDPN 112 (152) T ss_dssp TTEEEEEEESTGGGTSHHHHHHHHHHHHEEEEEEEEEEEEE T ss_pred CCeeEEEEcCchhhccCHHHHHHHHHHHcCCCcEEEEEECC Confidence 3588888863 333 4688999999999999876544 No 269 >PRK14902 16S rRNA methyltransferase B; Provisional Probab=38.09 E-value=70 Score=24.34 Aligned_cols=19 Identities=11% Similarity=0.179 Sum_probs=16.0 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .++.+.+.+++||+++... T Consensus 361 iL~~a~~~LkpGG~lvyst 379 (444) T PRK14902 361 ILESVAQYLKKGGILVYST 379 (444) T ss_pred HHHHHHHHcCCCCEEEEEc Confidence 5788999999999998643 No 270 >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []. ; GO: 0016429 tRNA (adenine-N1-)-methyltransferase activity, 0030488 tRNA methylation; PDB: 2YVL_C 1YB2_A 2B25_B 1O54_A 2PWY_B 1I9G_A 3LGA_B 3LHD_C 3MB5_A. Probab=37.19 E-value=31 Score=24.54 Aligned_cols=32 Identities=16% Similarity=0.275 Sum_probs=24.8 Q ss_pred cccEEEEccChH-HHHHHHHHhc-cCCCEEEEec Q 034260 4 GIDVSFDCAGLN-KTMSTVLDAT-RAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~-~~~~~al~~l-~~gGrvv~vG 35 (100) .+|.||==.+.| .++..+.++| ++||++++.- T Consensus 113 ~~DavfLDlp~Pw~~i~~~~~~L~~~gG~i~~fs 146 (247) T PF08704_consen 113 DFDAVFLDLPDPWEAIPHAKRALKKPGGRICCFS 146 (247) T ss_dssp SEEEEEEESSSGGGGHHHHHHHE-EEEEEEEEEE T ss_pred cccEEEEeCCCHHHHHHHHHHHHhcCCceEEEEC Confidence 467755545544 6899999999 8999999885 No 271 >PRK07340 ornithine cyclodeaminase; Validated Probab=36.87 E-value=26 Score=25.39 Aligned_cols=42 Identities=19% Similarity=0.165 Sum_probs=31.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHH Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTP 47 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~ 47 (100) .+|+|+-|+.+...+-.+ .++||-.+..+|...+ ..+++... T Consensus 188 ~aDiVitaT~s~~Pl~~~--~~~~g~hi~~iGs~~p~~~El~~~~ 230 (304) T PRK07340 188 AVDLVVTATTSRTPVYPE--AARAGRLVVAVGAFTPDMAELAPRT 230 (304) T ss_pred cCCEEEEccCCCCceeCc--cCCCCCEEEecCCCCCCcccCCHHH Confidence 589999999987654444 2799999999998765 45677543 No 272 >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase, an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase. Probab=36.75 E-value=97 Score=18.72 Aligned_cols=33 Identities=21% Similarity=0.198 Sum_probs=20.7 Q ss_pred cccEEEEccChHHHHHH---HHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAGLNKTMST---VLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G~~~~~~~---al~~l~~gGrvv~vG~ 36 (100) .+|++|-|++.....+. ....+++|..++=++. T Consensus 65 ~~DvV~~~~~~~~~~~~~~~~~~~~~~g~~viD~s~ 100 (122) T smart00859 65 AVDIVFLALPHGVSKEIAPLLPKAAEAGVKVIDLSS 100 (122) T ss_pred CCCEEEEcCCcHHHHHHHHHHHhhhcCCCEEEECCc Confidence 57999999998765553 3333456555554543 No 273 >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B .... Probab=36.67 E-value=53 Score=21.00 Aligned_cols=35 Identities=17% Similarity=0.359 Sum_probs=22.5 Q ss_pred cccEEEEccCh----HHHHHHHHHhccCCC--EEEEecCCC Q 034260 4 GIDVSFDCAGL----NKTMSTVLDATRAGD--KVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~----~~~~~~al~~l~~gG--rvv~vG~~~ 38 (100) ++|+|+.|.|. .......+++++..| ++++++... T Consensus 60 ~~d~vi~~~~~~~~~~~~~~~~~~a~~~~~~~~~v~~s~~~ 100 (183) T PF13460_consen 60 GADAVIHAAGPPPKDVDAAKNIIEAAKKAGVKRVVYLSSAG 100 (183) T ss_dssp TSSEEEECCHSTTTHHHHHHHHHHHHHHTTSSEEEEEEETT T ss_pred hcchhhhhhhhhcccccccccccccccccccccceeeeccc Confidence 68999999984 234555555554433 777776543 No 274 >PLN02476 O-methyltransferase Probab=36.55 E-value=55 Score=23.73 Aligned_cols=32 Identities=19% Similarity=0.266 Sum_probs=23.0 Q ss_pred cccEEEEccCh---HHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGL---NKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~---~~~~~~al~~l~~gGrvv~vG 35 (100) .+|.||--+.. +..++.+++++++||.+++=- T Consensus 194 ~FD~VFIDa~K~~Y~~y~e~~l~lL~~GGvIV~DN 228 (278) T PLN02476 194 SYDFAFVDADKRMYQDYFELLLQLVRVGGVIVMDN 228 (278) T ss_pred CCCEEEECCCHHHHHHHHHHHHHhcCCCcEEEEec Confidence 47775544333 356889999999999988643 No 275 >cd01487 E1_ThiF_like E1_ThiF_like. Member of superfamily of activating enzymes (E1) of the ubiquitin-like proteins. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown. Probab=36.36 E-value=42 Score=22.21 Aligned_cols=32 Identities=9% Similarity=0.149 Sum_probs=20.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCC-CEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG-DKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g-Grvv~vG 35 (100) ++|+|+||+....+-..-.+.+.+. +.-.+.+ T Consensus 88 ~~DlVi~~~d~~~~r~~i~~~~~~~~~ip~i~~ 120 (174) T cd01487 88 DCDIVVEAFDNAETKAMLAESLLGNKNKPVVCA 120 (174) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHHCCCCEEEE Confidence 5899999999876654444444433 5555554 No 276 >TIGR00274 N-acetylmuramic acid 6-phosphate etherase. This protein, MurQ, is involved in recycling components of the bacterial murein sacculus turned over during cell growth. The cell wall metabolite anhydro-N-acetylmuramic acid (anhMurNAc) is converted by a kinase, AnmK, to MurNAc-phosphate, then converted to N-acetylglucosamine-phosphate by this etherase, called MurQ. This family of proteins is similar to the C-terminal half of a number of vertebrate glucokinase regulator proteins and contains a Prosite pattern which is shared by this group of proteins in a region of local similarity. Probab=36.19 E-value=43 Score=24.27 Aligned_cols=22 Identities=18% Similarity=0.533 Sum_probs=17.7 Q ss_pred HHHHHHHhccCCCEEEEecCCC Q 034260 17 TMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~~~ 38 (100) +++.+.+.++.+||++++|..+ T Consensus 46 av~~~~~~l~~gGrl~~~G~G~ 67 (291) T TIGR00274 46 AVEQIVQAFQQGGRLIYIGAGT 67 (291) T ss_pred HHHHHHHHHhcCCEEEEECCcH Confidence 4566667889999999999764 No 277 >COG4122 Predicted O-methyltransferase [General function prediction only] Probab=36.02 E-value=70 Score=22.39 Aligned_cols=33 Identities=18% Similarity=0.297 Sum_probs=23.9 Q ss_pred cccEEE-EccCh--HHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSF-DCAGL--NKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vi-e~~G~--~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|| |+.-. +..++.+++++++||-++.=-+ T Consensus 132 ~fDliFIDadK~~yp~~le~~~~lLr~GGliv~DNv 167 (219) T COG4122 132 SFDLVFIDADKADYPEYLERALPLLRPGGLIVADNV 167 (219) T ss_pred CccEEEEeCChhhCHHHHHHHHHHhCCCcEEEEeec Confidence 467754 55433 3678999999999999986543 No 278 >KOG3674 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Probab=35.90 E-value=16 Score=29.08 Aligned_cols=29 Identities=31% Similarity=0.454 Sum_probs=23.5 Q ss_pred ccEEEEccChHH------------HHHHHHHhccCCCEEEE Q 034260 5 IDVSFDCAGLNK------------TMSTVLDATRAGDKVCL 33 (100) Q Consensus 5 ~D~vie~~G~~~------------~~~~al~~l~~gGrvv~ 33 (100) +|-.+||.|.|. -+..|++.++.||+.++ T Consensus 232 ADGS~dcqg~pgeqE~iVssL~~aEV~~AL~~L~~gG~fil 272 (696) T KOG3674|consen 232 ADGSTDCQGKPGEQESIVSSLISAEVEVALKLLRRGGRFIL 272 (696) T ss_pred cCCccccCCCCccHHHHHHHHHHHHHHHHHHHHhcCCeehH Confidence 566789999763 35778999999999985 No 279 >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). Members of this protein family are acetaldehyde dehydrogenase (acetylating), EC 1.2.1.10. This enzyme oxidizes acetaldehyde, using NAD(+), and attaches coenzyme A (CoA), yielding acetyl-CoA. It occurs as a late step in the meta-cleavage pathways of a variety of compounds, including catechol, biphenyl, toluene, salicylate, etc. Probab=35.57 E-value=74 Score=23.11 Aligned_cols=30 Identities=20% Similarity=0.303 Sum_probs=22.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|++|++.....+.+.++++.| +.++. T Consensus 64 dIDaV~iaTp~~~H~e~a~~al~aG-k~VId 93 (285) T TIGR03215 64 DIDIVFDATSAKAHARHARLLAELG-KIVID 93 (285) T ss_pred CCCEEEECCCcHHHHHHHHHHHHcC-CEEEE Confidence 5899999999987777777776665 44433 No 280 >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Probab=35.49 E-value=90 Score=23.43 Aligned_cols=33 Identities=27% Similarity=0.456 Sum_probs=22.9 Q ss_pred cccEEEEccChH----------HHHHHHHH-----------------hccCCCEEEEecC Q 034260 4 GIDVSFDCAGLN----------KTMSTVLD-----------------ATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G~~----------~~~~~al~-----------------~l~~gGrvv~vG~ 36 (100) ++|++|.++|.. +.++..++ ..+++|++++++. T Consensus 284 ~id~vi~~AG~~~~~~~~~~~~~~~~~~~~~n~~g~~~l~~~~~~~~~~~~~g~iv~~SS 343 (450) T PRK08261 284 GLDIVVHNAGITRDKTLANMDEARWDSVLAVNLLAPLRITEALLAAGALGDGGRIVGVSS 343 (450) T ss_pred CCCEEEECCCcCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHhhhhcCCCEEEEECC Confidence 589999999842 33443333 5567799999885 No 281 >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain. This model represents a subfamily of CysG N-terminal region-related sequences. All sequences in the seed alignment for this model are N-terminal regions of known or predicted siroheme synthases. The C-terminal region of each is uroporphyrin-III C-methyltransferase (EC 2.1.1.107), which catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). The region represented by this model completes the process of oxidation and iron insertion to yield siroheme. Siroheme is a cofactor for nitrite and sulfite reductases, so siroheme synthase is CysG of cysteine biosynthesis in some organisms. Probab=35.27 E-value=1.2e+02 Score=20.60 Aligned_cols=52 Identities=13% Similarity=0.009 Sum_probs=32.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhc-CcEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAAR-YLIY 55 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k-~~~i 55 (100) ++|+|+-|+|.++.-....+.++..|..|.+.--.....+.......+ .++| T Consensus 69 ~~~lVi~at~d~~ln~~i~~~a~~~~ilvn~~d~~e~~~f~~pa~~~~g~l~i 121 (205) T TIGR01470 69 GAFLVIAATDDEELNRRVAHAARARGVPVNVVDDPELCSFIFPSIVDRSPVVV 121 (205) T ss_pred CcEEEEECCCCHHHHHHHHHHHHHcCCEEEECCCcccCeEEEeeEEEcCCEEE Confidence 689999999997666667777777787776543333233333333333 4555 No 282 >PRK08374 homoserine dehydrogenase; Provisional Probab=35.18 E-value=61 Score=23.88 Aligned_cols=25 Identities=20% Similarity=0.276 Sum_probs=17.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG 28 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g 28 (100) .+|+++||++...+.+...++++.| T Consensus 91 ~~DVvVd~t~~~~a~~~~~~al~~G 115 (336) T PRK08374 91 DADIVVDVTNDKNAHEWHLEALKEG 115 (336) T ss_pred CCCEEEECCCcHHHHHHHHHHHhhC Confidence 4799999998766555555555443 No 283 >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains Probab=35.17 E-value=1.6e+02 Score=20.60 Aligned_cols=34 Identities=18% Similarity=0.213 Sum_probs=23.1 Q ss_pred cccEEEEccChH------------------HHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLN------------------KTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~------------------~~~~~al~~l~~gGrvv~vG~~ 37 (100) ++|+|+.++|.+ ..+-..++-..|.+.+++++.| T Consensus 70 ~aDiVv~t~~~~~~~g~~r~~~~~~n~~i~~~i~~~i~~~~p~a~~i~~tNP 121 (263) T cd00650 70 DADVVIITAGVGRKPGMGRLDLLKRNVPIVKEIGDNIEKYSPDAWIIVVSNP 121 (263) T ss_pred CCCEEEECCCCCCCcCCCHHHHHHHHHHHHHHHHHHHHHHCCCeEEEEecCc Confidence 689999988762 1233444445699998888644 No 284 >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Probab=35.13 E-value=92 Score=22.75 Aligned_cols=32 Identities=16% Similarity=0.235 Sum_probs=23.1 Q ss_pred cccEEEEcc------ChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCA------GLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~------G~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-.. -....+.+..+.+++||++++-. T Consensus 189 ~FD~V~s~~vl~H~~dp~~~L~~l~~~LkpGG~lvl~~ 226 (322) T PRK15068 189 AFDTVFSMGVLYHRRSPLDHLKQLKDQLVPGGELVLET 226 (322) T ss_pred CcCEEEECChhhccCCHHHHHHHHHHhcCCCcEEEEEE Confidence 467777431 12357899999999999998753 No 285 >PRK07502 cyclohexadienyl dehydrogenase; Validated Probab=34.50 E-value=88 Score=22.37 Aligned_cols=34 Identities=21% Similarity=0.319 Sum_probs=22.2 Q ss_pred cccEEEEccChHHH---HHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNKT---MSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~~---~~~al~~l~~gGrvv~vG~~ 37 (100) .+|+|+.|++.... +++....++++..++.+|.. T Consensus 66 ~aDvViiavp~~~~~~v~~~l~~~l~~~~iv~dvgs~ 102 (307) T PRK07502 66 GADLVILCVPVGASGAVAAEIAPHLKPGAIVTDVGSV 102 (307) T ss_pred CCCEEEECCCHHHHHHHHHHHHhhCCCCCEEEeCccc Confidence 58999999997532 33333456777766666543 No 286 >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=34.33 E-value=43 Score=24.60 Aligned_cols=33 Identities=18% Similarity=0.288 Sum_probs=27.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..++..+ +++|..++=+|... T Consensus 202 ~ADIVIsavg~~~~v~~~~--ik~GaiVIDvgin~ 234 (301) T PRK14194 202 QADIVVAAVGRPRLIDADW--LKPGAVVIDVGINR 234 (301) T ss_pred cCCEEEEecCChhcccHhh--ccCCcEEEEecccc Confidence 5899999999998777655 89998888888664 No 287 >PLN02396 hexaprenyldihydroxybenzoate methyltransferase Probab=34.27 E-value=84 Score=23.14 Aligned_cols=33 Identities=9% Similarity=0.057 Sum_probs=23.0 Q ss_pred cccEEEEc-----c-ChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDC-----A-GLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~-----~-G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+-. + .....+++..++++|||++++.-. T Consensus 198 ~FD~Vi~~~vLeHv~d~~~~L~~l~r~LkPGG~liist~ 236 (322) T PLN02396 198 KFDAVLSLEVIEHVANPAEFCKSLSALTIPNGATVLSTI 236 (322) T ss_pred CCCEEEEhhHHHhcCCHHHHHHHHHHHcCCCcEEEEEEC Confidence 46776632 2 233577888899999999997643 No 288 >TIGR00377 ant_ant_sig anti-anti-sigma factor. This superfamily includes small (105-125 residue) proteins related to SpoIIAA of Bacillus subtilis, an anti-anti-sigma factor. SpoIIAA can bind to and inhibit the anti-sigma F factor SpoIIAB. Also, it can be phosphorylated by SpoIIAB on a Ser residue at position 59 of the seed alignment. A similar arrangement is inferred for RsbV, an anti-anti-sigma factor for sigma B. This Ser is fairly well conserved within a motif resembling MXS[STA]G[VIL]X[VIL][VILF] among homologous known or predicted anti-anti-sigma factors. Regions similar to SpoIIAA and apparently homologous, but differing considerably near the phosphorlated Ser of SpoIIAA, appear in a single copy in several longer proteins. Probab=34.22 E-value=68 Score=18.71 Aligned_cols=11 Identities=27% Similarity=0.604 Sum_probs=5.3 Q ss_pred CCCEEEEecCC Q 034260 27 AGDKVCLVGMG 37 (100) Q Consensus 27 ~gGrvv~vG~~ 37 (100) +++++.++|.. T Consensus 74 ~~~~~~l~~~~ 84 (108) T TIGR00377 74 VGGQLVLVSVS 84 (108) T ss_pred cCCEEEEEeCC Confidence 44555555543 No 289 >PLN02244 tocopherol O-methyltransferase Probab=34.07 E-value=51 Score=24.17 Aligned_cols=34 Identities=12% Similarity=0.239 Sum_probs=24.7 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|+|+-.-. ....++++.+.++|||+++++... T Consensus 186 ~FD~V~s~~~~~h~~d~~~~l~e~~rvLkpGG~lvi~~~~ 225 (340) T PLN02244 186 QFDLVWSMESGEHMPDKRKFVQELARVAAPGGRIIIVTWC 225 (340) T ss_pred CccEEEECCchhccCCHHHHHHHHHHHcCCCcEEEEEEec Confidence 4787764321 235788999999999999997654 No 290 >PRK06718 precorrin-2 dehydrogenase; Reviewed Probab=33.97 E-value=1.1e+02 Score=20.67 Aligned_cols=51 Identities=10% Similarity=0.010 Sum_probs=28.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhc-CcEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAAR-YLIY 55 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k-~~~i 55 (100) ++|+||-|++.++ +++.+...+..+.++.+.-.+....+-......+ .++| T Consensus 70 ~adlViaaT~d~e-lN~~i~~~a~~~~lvn~~d~~~~~~f~~Pa~~~~g~l~i 121 (202) T PRK06718 70 DAFLVIAATNDPR-VNEQVKEDLPENALFNVITDAESGNVVFPSALHRGKLTI 121 (202) T ss_pred CceEEEEcCCCHH-HHHHHHHHHHhCCcEEECCCCccCeEEEeeEEEcCCeEE Confidence 5899999999864 5555544444556666644333333333333333 4444 No 291 >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E. coli subfamily. Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with the Escherichia. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the more widely distributed clade of ThiF proteins such found in E. coli. Probab=32.67 E-value=54 Score=22.18 Aligned_cols=29 Identities=24% Similarity=0.216 Sum_probs=18.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVC 32 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv 32 (100) ++|+|++|+.+..+-...-+.++..+.-. T Consensus 111 ~~D~Vi~~~d~~~~r~~l~~~~~~~~ip~ 139 (202) T TIGR02356 111 NVDLVLDCTDNFATRYLINDACVALGTPL 139 (202) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHcCCCE Confidence 58999999998765444444444444433 No 292 >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C .... Probab=32.50 E-value=34 Score=21.25 Aligned_cols=34 Identities=6% Similarity=0.052 Sum_probs=23.6 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) .+|+|+-+.. ....++...++++|||.+++.-.. T Consensus 78 ~fD~i~~~~~l~~~~d~~~~l~~l~~~LkpgG~l~~~~~~ 117 (161) T PF13489_consen 78 SFDLIICNDVLEHLPDPEEFLKELSRLLKPGGYLVISDPN 117 (161) T ss_dssp SEEEEEEESSGGGSSHHHHHHHHHHHCEEEEEEEEEEEEB T ss_pred chhhHhhHHHHhhcccHHHHHHHHHHhcCCCCEEEEEEcC Confidence 4566655422 235788889999999999876543 No 293 >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases.; GO: 0008168 methyltransferase activity; PDB: 1WY7_A 1DUS_A 2OZV_A 2PJD_A 1VQ1_A 1NV9_A 1SG9_C 1NV8_A 3Q87_B 3DMF_A .... Probab=32.43 E-value=36 Score=22.16 Aligned_cols=24 Identities=17% Similarity=0.192 Sum_probs=19.7 Q ss_pred HHHHHHHHhccCCCEEEEecCCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) ..++++-+.|+++|++.++..... T Consensus 121 ~~i~~a~~~Lk~~G~l~lv~~~~~ 144 (170) T PF05175_consen 121 DFIEQARRYLKPGGRLFLVINSHL 144 (170) T ss_dssp HHHHHHHHHEEEEEEEEEEEETTS T ss_pred HHHHHHHHhccCCCEEEEEeecCC Confidence 357899999999999988876543 No 294 >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. Several cytoplasmic vertebrate methyltransferases are evolutionary related [], including nicotinamide N-methyltransferase (2.1.1.1 from EC) (NNMT); phenylethanolamine N-methyltransferase (2.1.1.28 from EC) (PNMT); and thioether S-methyltransferase (2.1.1.96 from EC) (TEMT). NNMT catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for the biotransformation of many drugs and xenobiotic compounds. PNMT catalyzes the last step in catecholamine biosynthesis, the conversion of noradrenalin to adrenalin; and TEMT catalyzes the methylation of dimethyl sulphide into trimethylsulphonium. These three enzymes use S-adenosyl-L-methionine as the methyl donor. They are proteins of 30 to 32 kDa.; GO: 0008168 methyltransferase activity; PDB: 2IIP_C 3ROD_A 2OBF_A 3HCA_B 2ONY_B 3KR1_A 2OPB_B 3KQP_B 2AN4_B 3KQM_A .... Probab=32.31 E-value=23 Score=25.38 Aligned_cols=34 Identities=15% Similarity=0.294 Sum_probs=24.1 Q ss_pred ccEEEEccChH----------HHHHHHHHhccCCCEEEEecCCC Q 034260 5 IDVSFDCAGLN----------KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 5 ~D~vie~~G~~----------~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +|+++-+--.. .++.....+++|||.++++|+-. T Consensus 159 ~D~v~s~fcLE~a~~d~~~y~~al~ni~~lLkpGG~Lil~~~l~ 202 (256) T PF01234_consen 159 FDCVISSFCLESACKDLDEYRRALRNISSLLKPGGHLILAGVLG 202 (256) T ss_dssp EEEEEEESSHHHH-SSHHHHHHHHHHHHTTEEEEEEEEEEEESS T ss_pred hhhhhhhHHHHHHcCCHHHHHHHHHHHHHHcCCCcEEEEEEEcC Confidence 67766543322 25666778889999999999754 No 295 >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=32.30 E-value=37 Score=24.76 Aligned_cols=33 Identities=24% Similarity=0.434 Sum_probs=27.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-++|.+..+.. +++++|..++=+|... T Consensus 201 ~ADIVV~avG~~~~i~~--~~ik~gavVIDVGin~ 233 (285) T PRK14189 201 QADIVVAAVGKRNVLTA--DMVKPGATVIDVGMNR 233 (285) T ss_pred hCCEEEEcCCCcCccCH--HHcCCCCEEEEccccc Confidence 58999999999876654 8899999988899764 No 296 >cd06844 STAS Sulphate Transporter and Anti-Sigma factor antagonist domain found in the C-terminal region of sulphate transporters as well as in bacterial and archaeal proteins involved in the regulation of sigma factors. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain is found in the C-terminal region of sulphate transporters as well as in bacterial and archaeal proteins involved in the regulation of sigma factors, like anti-anti-sigma factors and "stressosome" components. The sigma factor regulators are involved in protein-protein interaction which is regulated by phosphorylation. Probab=32.21 E-value=56 Score=19.11 Aligned_cols=10 Identities=30% Similarity=0.717 Sum_probs=4.6 Q ss_pred CCCEEEEecC Q 034260 27 AGDKVCLVGM 36 (100) Q Consensus 27 ~gGrvv~vG~ 36 (100) .|+++.+++. T Consensus 70 ~g~~l~l~~~ 79 (100) T cd06844 70 VGGQFVLTGI 79 (100) T ss_pred cCCEEEEECC Confidence 4444444443 No 297 >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial. This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit and homologs. TIGR01317 describes the small subunit (or equivalent region from longer forms) in eukaryotes, Gram-positive bacteria, and some other lineages, both NADH and NADPH-dependent. TIGR01316 describes a protein of similar length, from Archaea and a number of bacterial lineages, that forms glutamate synthase homotetramers without a large subunit. This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including E. coli. Probab=32.13 E-value=7.2 Score=29.85 Aligned_cols=13 Identities=23% Similarity=0.281 Sum_probs=11.0 Q ss_pred cccEEEEccChHH Q 034260 4 GIDVSFDCAGLNK 16 (100) Q Consensus 4 G~D~vie~~G~~~ 16 (100) ++|.+|+|+|+.. T Consensus 226 ~~D~vilAtGa~~ 238 (467) T TIGR01318 226 DYDAVFLGVGTYR 238 (467) T ss_pred cCCEEEEEeCCCC Confidence 5899999999864 No 298 >PRK14103 trans-aconitate 2-methyltransferase; Provisional Probab=31.97 E-value=61 Score=22.44 Aligned_cols=31 Identities=16% Similarity=0.182 Sum_probs=23.0 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|+-... ....+..+.+.|+|||++++. T Consensus 89 ~fD~v~~~~~l~~~~d~~~~l~~~~~~LkpgG~l~~~ 125 (255) T PRK14103 89 DTDVVVSNAALQWVPEHADLLVRWVDELAPGSWIAVQ 125 (255) T ss_pred CceEEEEehhhhhCCCHHHHHHHHHHhCCCCcEEEEE Confidence 4677766432 245678899999999999875 No 299 >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=31.87 E-value=45 Score=24.30 Aligned_cols=33 Identities=18% Similarity=0.218 Sum_probs=27.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..+.. +.+++|..++=+|... T Consensus 202 ~ADIvi~avG~p~~v~~--~~vk~gavVIDvGin~ 234 (285) T PRK10792 202 NADLLVVAVGKPGFIPG--EWIKPGAIVIDVGINR 234 (285) T ss_pred hCCEEEEcCCCcccccH--HHcCCCcEEEEccccc Confidence 58999999999876655 8899998888888653 No 300 >cd07041 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors. Probab=31.87 E-value=36 Score=20.16 Aligned_cols=33 Identities=21% Similarity=0.299 Sum_probs=18.0 Q ss_pred cEEEEccChHH-------HHHHHHHhc-cCCCEEEEecCCC Q 034260 6 DVSFDCAGLNK-------TMSTVLDAT-RAGDKVCLVGMGH 38 (100) Q Consensus 6 D~vie~~G~~~-------~~~~al~~l-~~gGrvv~vG~~~ 38 (100) .+++|+++.+. ++.+..+.+ +.|+++.++|..+ T Consensus 43 ~vvlDls~v~~iDssg~~~l~~~~~~~~~~g~~l~l~g~~~ 83 (109) T cd07041 43 GVIIDLTGVPVIDSAVARHLLRLARALRLLGARTILTGIRP 83 (109) T ss_pred EEEEECCCCchhcHHHHHHHHHHHHHHHHcCCeEEEEeCCH Confidence 35666655442 334444433 3677777777654 No 301 >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase. This model represents an O-methyltransferase believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and fungi (COQ3). A separate methylase (MenG/UbiE) catalyzes the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase. Probab=31.87 E-value=1.1e+02 Score=20.42 Aligned_cols=33 Identities=9% Similarity=0.042 Sum_probs=22.7 Q ss_pred cccEEEE-----ccChH-HHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFD-----CAGLN-KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie-----~~G~~-~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+++- ....+ ..++++.+.++++|++++... T Consensus 112 ~~D~i~~~~~l~~~~~~~~~l~~~~~~L~~gG~l~i~~~ 150 (224) T TIGR01983 112 SFDVVTCMEVLEHVPDPQAFIRACAQLLKPGGILFFSTI 150 (224) T ss_pred CccEEEehhHHHhCCCHHHHHHHHHHhcCCCcEEEEEec Confidence 4677753 33333 466888899999999886543 No 302 >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes. Probab=31.83 E-value=65 Score=21.57 Aligned_cols=33 Identities=15% Similarity=0.212 Sum_probs=23.5 Q ss_pred cccEEEE-----ccCh-HHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFD-----CAGL-NKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie-----~~G~-~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+|+- +++. ...++++.+.|+|||++++... T Consensus 67 ~fD~I~~~~~l~~~~~~~~~l~~~~~~LkpgG~l~i~~~ 105 (224) T smart00828 67 TYDLVFGFEVIHHIKDKMDLFSNISRHLKDGGHLVLADF 105 (224) T ss_pred CCCEeehHHHHHhCCCHHHHHHHHHHHcCCCCEEEEEEc Confidence 4677663 2232 3567888899999999998764 No 303 >PRK00299 sulfur transfer protein SirA; Reviewed Probab=31.58 E-value=1.1e+02 Score=17.64 Aligned_cols=35 Identities=14% Similarity=0.322 Sum_probs=27.1 Q ss_pred cccEEEEccChH---H--HHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLN---K--TMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~---~--~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|..+|+.|.. + -...+++.+.+|+.+.++.-.. T Consensus 7 ~~~~~lD~~Gl~CP~Pll~~kk~l~~l~~G~~l~V~~dd~ 46 (81) T PRK00299 7 SPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDP 46 (81) T ss_pred CcCeEEecCCCCCCHHHHHHHHHHHcCCCCCEEEEEeCCc Confidence 478999999964 1 3688899999999988876543 No 304 >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=31.42 E-value=49 Score=24.12 Aligned_cols=33 Identities=21% Similarity=0.273 Sum_probs=25.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|++|-|+|.+..+.. +.+++|..++=+|... T Consensus 201 ~ADIVIsAvg~p~~i~~--~~vk~gavVIDvGi~~ 233 (286) T PRK14175 201 DADVIVSAVGKPGLVTK--DVVKEGAVIIDVGNTP 233 (286) T ss_pred hCCEEEECCCCCcccCH--HHcCCCcEEEEcCCCc Confidence 58999999999876665 5688887766678765 No 305 >PRK12570 N-acetylmuramic acid-6-phosphate etherase; Reviewed Probab=31.35 E-value=62 Score=23.52 Aligned_cols=23 Identities=17% Similarity=0.512 Sum_probs=18.4 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+.+.+.+.++.+||+.++|..+ T Consensus 46 ~a~~~~~~~l~~ggrl~~~GaG~ 68 (296) T PRK12570 46 QAVDKIVAAFKKGGRLIYMGAGT 68 (296) T ss_pred HHHHHHHHHHHcCCeEEEECCch Confidence 34566777889999999999765 No 306 >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Probab=31.34 E-value=53 Score=24.44 Aligned_cols=19 Identities=11% Similarity=0.242 Sum_probs=16.4 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .++.|++++++||++|..- T Consensus 270 iL~~a~~~lk~GG~LVYST 288 (355) T COG0144 270 ILAAALKLLKPGGVLVYST 288 (355) T ss_pred HHHHHHHhcCCCCEEEEEc Confidence 5788999999999999753 No 307 >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Probab=31.27 E-value=80 Score=22.56 Aligned_cols=20 Identities=10% Similarity=0.154 Sum_probs=15.2 Q ss_pred CcccEEEEccChHHHHHHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVL 22 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al 22 (100) .++|+||||+.....+.+.+ T Consensus 83 ~~~d~ViEav~E~~~~K~~l 102 (286) T PRK07819 83 ADRQLVIEAVVEDEAVKTEI 102 (286) T ss_pred CCCCEEEEecccCHHHHHHH Confidence 36899999999876655554 No 308 >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Probab=31.01 E-value=67 Score=22.25 Aligned_cols=22 Identities=9% Similarity=0.141 Sum_probs=18.7 Q ss_pred HHHHHHHHhccCCCEEEEecCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~ 37 (100) ..+++..+.|+|||.+++.... T Consensus 145 ~~l~~i~~~LkpGG~l~l~e~~ 166 (247) T PRK15451 145 ALLDKIYQGLNPGGALVLSEKF 166 (247) T ss_pred HHHHHHHHhcCCCCEEEEEEec Confidence 5789999999999999997643 No 309 >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=30.89 E-value=44 Score=24.33 Aligned_cols=34 Identities=21% Similarity=0.229 Sum_probs=27.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +.+|+++-|+|.+..++.. ++++|..++=+|... T Consensus 200 ~~ADIVI~avg~~~~v~~~--~ik~GavVIDvgin~ 233 (284) T PRK14179 200 RKADILVVAIGRGHFVTKE--FVKEGAVVIDVGMNR 233 (284) T ss_pred hhCCEEEEecCccccCCHH--HccCCcEEEEeccee Confidence 3589999999999877764 489998888888764 No 310 >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional Probab=30.06 E-value=46 Score=21.48 Aligned_cols=33 Identities=12% Similarity=0.051 Sum_probs=24.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-++|.+..++ -+.+++|-.++-+|... T Consensus 71 ~ADIVvsAtg~~~~i~--~~~ikpGa~Vidvg~~~ 103 (140) T cd05212 71 DADVVVVGSPKPEKVP--TEWIKPGATVINCSPTK 103 (140) T ss_pred hCCEEEEecCCCCccC--HHHcCCCCEEEEcCCCc Confidence 5899999999885544 35589998887666554 No 311 >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Probab=29.79 E-value=75 Score=21.33 Aligned_cols=21 Identities=5% Similarity=0.162 Sum_probs=18.0 Q ss_pred HHHHHHHHHhccCCCEEEEec Q 034260 15 NKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 15 ~~~~~~al~~l~~gGrvv~vG 35 (100) +..++.+.+.++|+|++++.- T Consensus 136 ~~~l~~i~~~LkpgG~l~i~~ 156 (202) T PRK00121 136 PEFLALYARKLKPGGEIHFAT 156 (202) T ss_pred HHHHHHHHHHcCCCCEEEEEc Confidence 457889999999999999864 No 312 >PLN02366 spermidine synthase Probab=29.75 E-value=1.1e+02 Score=22.35 Aligned_cols=21 Identities=29% Similarity=0.384 Sum_probs=16.8 Q ss_pred HHHHHHHHhccCCCEEEEecC Q 034260 16 KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~ 36 (100) +.++.+.+.|+++|.++.-+. T Consensus 187 ef~~~~~~~L~pgGvlv~q~~ 207 (308) T PLN02366 187 PFFESVARALRPGGVVCTQAE 207 (308) T ss_pred HHHHHHHHhcCCCcEEEECcC Confidence 357888999999999986543 No 313 >COG2103 Predicted sugar phosphate isomerase [General function prediction only] Probab=29.66 E-value=73 Score=23.36 Aligned_cols=23 Identities=17% Similarity=0.469 Sum_probs=19.1 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+++.+.+.++.|||++.+|... T Consensus 48 ~Av~~~~~~l~~GGRLiY~GAGT 70 (298) T COG2103 48 AAVDIIAAALKQGGRLIYIGAGT 70 (298) T ss_pred HHHHHHHHHHHcCCeEEEEcCCc Confidence 35777888899999999998764 No 314 >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine Probab=29.47 E-value=1.1e+02 Score=22.04 Aligned_cols=34 Identities=12% Similarity=0.108 Sum_probs=24.4 Q ss_pred cccEEEEccChHH------------------HHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNK------------------TMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~------------------~~~~al~~l~~gGrvv~vG~~ 37 (100) ++|+++-|+|.+. .+-..++-..|.|.+++++.| T Consensus 68 ~aDIVIitag~~~~~g~~R~dll~~N~~i~~~~~~~i~~~~~~~~vivvsNP 119 (306) T cd05291 68 DADIVVITAGAPQKPGETRLDLLEKNAKIMKSIVPKIKASGFDGIFLVASNP 119 (306) T ss_pred CCCEEEEccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhCCCeEEEEecCh Confidence 6899999999851 233445555788998888754 No 315 >PRK08644 thiamine biosynthesis protein ThiF; Provisional Probab=29.33 E-value=66 Score=22.02 Aligned_cols=31 Identities=10% Similarity=0.128 Sum_probs=19.3 Q ss_pred cccEEEEccChHHHHHHHHHhccCC-CEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG-DKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g-Grvv~v 34 (100) ++|+|+||+....+-....+.+... +.-.+. T Consensus 117 ~~DvVI~a~D~~~~r~~l~~~~~~~~~~p~I~ 148 (212) T PRK08644 117 DCDIVVEAFDNAETKAMLVETVLEHPGKKLVA 148 (212) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHhCCCCEEE Confidence 5899999999876644444444443 443343 No 316 >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). Probab=29.10 E-value=61 Score=22.27 Aligned_cols=25 Identities=28% Similarity=0.286 Sum_probs=16.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAG 28 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~g 28 (100) ++|+|++|+....+-...-+.++.. T Consensus 111 ~~DvVi~~~d~~~~r~~l~~~~~~~ 135 (228) T cd00757 111 GYDLVLDCTDNFATRYLINDACVKL 135 (228) T ss_pred CCCEEEEcCCCHHHHHHHHHHHHHc Confidence 5899999999886643333434333 No 317 >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Probab=29.03 E-value=63 Score=23.35 Aligned_cols=35 Identities=14% Similarity=0.108 Sum_probs=21.0 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCC-EEEEecC Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGD-KVCLVGM 36 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gG-rvv~vG~ 36 (100) ++++|+|+||.-.-.+=-..+..+..++ .++..|. T Consensus 119 ~~~~DyvIDaiD~v~~Kv~Li~~c~~~ki~vIss~G 154 (263) T COG1179 119 SKGFDYVIDAIDSVRAKVALIAYCRRNKIPVISSMG 154 (263) T ss_pred cCCCCEEEEchhhhHHHHHHHHHHHHcCCCEEeecc Confidence 4589999999987655444444444443 3444433 No 318 >PRK06823 ornithine cyclodeaminase; Validated Probab=28.95 E-value=93 Score=22.77 Aligned_cols=45 Identities=7% Similarity=0.110 Sum_probs=31.8 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHHH Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTPA 48 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~l 48 (100) +++|+|+-|+++...+- --+.+++|-.+..+|...+ ..+++...+ T Consensus 191 ~~ADIV~taT~s~~P~~-~~~~l~~G~hi~~iGs~~p~~~Eld~~~l 236 (315) T PRK06823 191 HAANLIVTTTPSREPLL-QAEDIQPGTHITAVGADSPGKQELDAELV 236 (315) T ss_pred cCCCEEEEecCCCCcee-CHHHcCCCcEEEecCCCCcccccCCHHHH Confidence 36899999998764332 1356899999999997765 456776544 No 319 >PF08468 MTS_N: Methyltransferase small domain N-terminal; InterPro: IPR013675 This domain is found to the N terminus of the methyltransferase small domain (IPR007848 from INTERPRO) in bacterial proteins []. ; GO: 0008990 rRNA (guanine-N2-)-methyltransferase activity, 0006364 rRNA processing; PDB: 2PJD_A. Probab=28.49 E-value=51 Score=21.66 Aligned_cols=25 Identities=16% Similarity=0.385 Sum_probs=18.1 Q ss_pred HHHHHHHhccCCCEEEEecCCCCCc Q 034260 17 TMSTVLDATRAGDKVCLVGMGHHDM 41 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~~~~~~ 41 (100) .+..++..+++|+.|.+||--...+ T Consensus 87 lL~~l~~~L~~g~~i~vVGEnk~GI 111 (155) T PF08468_consen 87 LLANLLSHLPPGTEIFVVGENKGGI 111 (155) T ss_dssp HHHHHHTTS-TT-EEEEEEEGGGTG T ss_pred HHHHHHHhCCCCCEEEEEecCcccH Confidence 4677888899999999999765443 No 320 >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Probab=28.39 E-value=62 Score=25.22 Aligned_cols=18 Identities=11% Similarity=0.318 Sum_probs=15.1 Q ss_pred HHHHHHHhccCCCEEEEe Q 034260 17 TMSTVLDATRAGDKVCLV 34 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~v 34 (100) .++.|++++++||++|.. T Consensus 224 iL~~A~~~LkpGG~LVYS 241 (470) T PRK11933 224 LIESAFHALKPGGTLVYS 241 (470) T ss_pred HHHHHHHHcCCCcEEEEE Confidence 578889999999999653 No 321 >KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Probab=28.28 E-value=1.4e+02 Score=23.14 Aligned_cols=30 Identities=10% Similarity=0.103 Sum_probs=24.3 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) +|=|+-|+|-..+++.++++++.-|.=+++ T Consensus 126 a~DV~ltsGC~qAIe~~i~~LA~p~aNILl 155 (447) T KOG0259|consen 126 ADDVVLTSGCSQAIELAISSLANPGANILL 155 (447) T ss_pred cCceEEeccchHHHHHHHHHhcCCCCceec Confidence 567888999999999999999766655554 No 322 >PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Probab=28.24 E-value=68 Score=23.30 Aligned_cols=23 Identities=22% Similarity=0.472 Sum_probs=19.0 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..++.+.+.++.+||+.++|... T Consensus 50 ~av~~~~~~l~~ggrI~~~GaGt 72 (299) T PRK05441 50 AAVDAAAAALRQGGRLIYIGAGT 72 (299) T ss_pred HHHHHHHHHHHCCCEEEEEcCcH Confidence 35677888899999999999764 No 323 >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Probab=28.07 E-value=1.3e+02 Score=19.95 Aligned_cols=35 Identities=20% Similarity=0.172 Sum_probs=24.4 Q ss_pred cccEEEEccChH-----------------------HHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLN-----------------------KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~-----------------------~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +.|.++.++|.. ..++..+.+++++|++++++... T Consensus 81 ~id~ii~~ag~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~iv~~ss~~ 138 (238) T PRK05786 81 AIDGLVVTVGGYVEDTVEEFSGLEEMLTNHIKIPLYAVNASLRFLKEGSSIVLVSSMS 138 (238) T ss_pred CCCEEEEcCCCcCCCchHHHHHHHHHHHHhchHHHHHHHHHHHHHhcCCEEEEEecch Confidence 468888888742 12455566677889999998653 No 324 >PRK00536 speE spermidine synthase; Provisional Probab=28.03 E-value=1e+02 Score=22.06 Aligned_cols=33 Identities=6% Similarity=-0.119 Sum_probs=25.7 Q ss_pred cccE-EEEccChHHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDV-SFDCAGLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~-vie~~G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|+ ++|++-.++-.+.+-++|+++|.+|.=+. T Consensus 139 ~fDVIIvDs~~~~~fy~~~~~~L~~~Gi~v~Qs~ 172 (262) T PRK00536 139 KYDLIICLQEPDIHKIDGLKRMLKEDGVFISVAK 172 (262) T ss_pred cCCEEEEcCCCChHHHHHHHHhcCCCcEEEECCC Confidence 5788 45667767778889999999999987543 No 325 >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes. The function of this family is unknown. Probab=28.00 E-value=88 Score=21.71 Aligned_cols=24 Identities=13% Similarity=0.108 Sum_probs=20.2 Q ss_pred HHHHHHHHhccCCCEEEEecCCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) ..++.+-+.|++||.+++.|=+.. T Consensus 122 ~lf~~a~~~L~~gG~L~~YGPF~~ 145 (204) T PF06080_consen 122 GLFAGAARLLKPGGLLFLYGPFNR 145 (204) T ss_pred HHHHHHHHhCCCCCEEEEeCCccc Confidence 457888899999999999997654 No 326 >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenas Probab=27.98 E-value=94 Score=22.22 Aligned_cols=35 Identities=23% Similarity=0.243 Sum_probs=22.0 Q ss_pred CcccEEEEccChHH------------------HHHHHHHhccCCCEEEEecCC Q 034260 3 AGIDVSFDCAGLNK------------------TMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 3 ~G~D~vie~~G~~~------------------~~~~al~~l~~gGrvv~vG~~ 37 (100) +++|+||+|+|.+. .+-..++-..|.+.+++++.+ T Consensus 65 ~dADiVIit~g~p~~~~~~r~e~~~~n~~i~~~i~~~i~~~~p~~~iIv~sNP 117 (300) T cd01339 65 AGSDVVVITAGIPRKPGMSRDDLLGTNAKIVKEVAENIKKYAPNAIVIVVTNP 117 (300) T ss_pred CCCCEEEEecCCCCCcCCCHHHHHHHHHHHHHHHHHHHHHHCCCeEEEEecCc Confidence 36899999997431 122333334578888877744 No 327 >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Probab=27.90 E-value=73 Score=23.10 Aligned_cols=34 Identities=18% Similarity=0.139 Sum_probs=26.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|++||.+-. +....-++.+...|+-.++|..+ T Consensus 69 ~~DV~IDFT~P-~~~~~~l~~~~~~~~~lVIGTTG 102 (266) T COG0289 69 DADVLIDFTTP-EATLENLEFALEHGKPLVIGTTG 102 (266) T ss_pred CCCEEEECCCc-hhhHHHHHHHHHcCCCeEEECCC Confidence 46999999986 45556677777777888888765 No 328 >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Probab=27.62 E-value=78 Score=22.17 Aligned_cols=31 Identities=26% Similarity=0.283 Sum_probs=18.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|+||+....+....-+.++..+.-.+. T Consensus 122 ~~DiVi~~~D~~~~r~~ln~~~~~~~ip~v~ 152 (245) T PRK05690 122 GHDLVLDCTDNVATRNQLNRACFAAKKPLVS 152 (245) T ss_pred cCCEEEecCCCHHHHHHHHHHHHHhCCEEEE Confidence 5899999999876543333444444443333 No 329 >PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) []. The pyridoxal-P group is attached to a lysine residue around which the sequence is highly conserved in all forms of the enzyme []. The enzyme carries out interconversion of serine and glycine using PLP as the cofactor. SHMT catalyses the transfer of a hydroxymethyl group from N5, N10- methylene tetrahydrofolate to glycine, resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers and the mammalian enzyme forms a homotetramer [, ]. PLP dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalysed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), D-amino acid superfamily (fold type IV) and glycogen phophorylase family (fold type V) [, ]. In vertebrates, glycine hydroxymethyltransferase exists in a cytoplasmic and a mitochondrial form whereas only one form is found in prokaryotes.; GO: 0004372 glycine hydroxymethyltransferase activity, 0006544 glycine metabolic process, 0006563 L-serine metabolic process; PDB: 3GBX_B 3H7F_A 1YJS_A 2VMW_A 2W7H_A 2W7E_A 2VMY_B 2W7L_A 2VMZ_A 2VMS_A .... Probab=27.45 E-value=26 Score=26.75 Aligned_cols=27 Identities=15% Similarity=0.381 Sum_probs=19.7 Q ss_pred cChHHHHHHHHHhccCCCEEEEecCCC Q 034260 12 AGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 12 ~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +|.++.+.-...+++||.+|..+-... T Consensus 94 SGs~An~av~~aLl~pGD~Im~l~l~~ 120 (399) T PF00464_consen 94 SGSQANLAVYMALLKPGDTIMGLSLPH 120 (399) T ss_dssp SHHHHHHHHHHHHT-TT-EEEEEEGGG T ss_pred CchHHHHHHHHHHHhhcCcEEecChhh Confidence 677777777888899999999887554 No 330 >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB. This model describes the molybdopterin biosynthesis protein MoeB in E. coli and related species. The enzyme covalently modifies the molybdopterin synthase MoaD by sulfurylation. This enzyme is closely related to ThiF, a thiamine biosynthesis enzyme that modifies ThiS by an analogous adenylation. Both MoeB and ThiF belong to the HesA/MoeB/ThiF family (pfam00899). Probab=27.41 E-value=73 Score=22.28 Aligned_cols=26 Identities=15% Similarity=0.181 Sum_probs=16.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGD 29 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gG 29 (100) ++|+|+||+....+-...-++++..+ T Consensus 114 ~~DlVvd~~D~~~~r~~ln~~~~~~~ 139 (240) T TIGR02355 114 EHDIVVDCTDNVEVRNQLNRQCFAAK 139 (240) T ss_pred cCCEEEEcCCCHHHHHHHHHHHHHcC Confidence 58999999999865333334443333 No 331 >PRK13938 phosphoheptose isomerase; Provisional Probab=27.38 E-value=74 Score=21.66 Aligned_cols=23 Identities=26% Similarity=0.436 Sum_probs=17.9 Q ss_pred HHHHHHHhccCCCEEEEecCCCC Q 034260 17 TMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~~~~ 39 (100) ..+...+.++.+||+.++|.+.. T Consensus 34 ~a~~~~~~l~~g~rI~i~G~G~S 56 (196) T PRK13938 34 IGDRLIAGYRAGARVFMCGNGGS 56 (196) T ss_pred HHHHHHHHHHCCCEEEEEeCcHH Confidence 44566677899999999998753 No 332 >PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2.3.1.41 from EC, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria. ; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0008610 lipid biosynthetic process; PDB: 3IL3_A 1ZOW_C 3GWE_B 3GWA_B 1UB7_B 3LED_B 2EBD_A 1HNJ_A 2EFT_B 1HN9_B .... Probab=27.13 E-value=51 Score=18.89 Aligned_cols=24 Identities=33% Similarity=0.650 Sum_probs=17.6 Q ss_pred HHHHHHHH--hccCCCEEEEecCCCC Q 034260 16 KTMSTVLD--ATRAGDKVCLVGMGHH 39 (100) Q Consensus 16 ~~~~~al~--~l~~gGrvv~vG~~~~ 39 (100) -++..+++ .+++|.+++++|...+ T Consensus 55 ~~L~~~~~~g~~~~Gd~vl~~~~G~G 80 (90) T PF08541_consen 55 INLADALEEGRIKPGDRVLLVGFGAG 80 (90) T ss_dssp HHHHHHHHTTSSCTTEEEEEEEEETT T ss_pred HHHHHHHHcCCCCCCCEEEEEEEEhh Confidence 35677777 7788888888876543 No 333 >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase. In E. coli, this protein flanks the DNA repair protein MutY, also called micA. Probab=27.09 E-value=90 Score=20.73 Aligned_cols=21 Identities=5% Similarity=0.118 Sum_probs=17.8 Q ss_pred HHHHHHHHHhccCCCEEEEec Q 034260 15 NKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 15 ~~~~~~al~~l~~gGrvv~vG 35 (100) +..++++.+.|++||++.+.- T Consensus 112 ~~~l~~~~r~LkpgG~l~~~t 132 (194) T TIGR00091 112 PHFLKEYANVLKKGGVIHFKT 132 (194) T ss_pred HHHHHHHHHHhCCCCEEEEEe Confidence 357889999999999998764 No 334 >PF09363 XFP_C: XFP C-terminal domain; InterPro: IPR018969 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria. PK activity has been sporadically reported in other microorganisms including eukaryotic yeasts. Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase is a thiamine diphosphate (ThdP)-dependent enzyme found in bacteria such as Bifidobacterium sp [, ]. This enzyme has dual-specificity with the following catalytic activities: 4.1.2.9 from EC: xylose 5-P + Pi = acetyl-P + glyeraldehyde-3-P 4.1.2.22 from EC: fructose-6-P + Pi = acetyl-P + erythrose-4-P Phosphoketolases are distantly related to transketolases, e.g. IPR005475 from INTERPRO.; GO: 0016832 aldehyde-lyase activity, 0005975 carbohydrate metabolic process; PDB: 3AI7_B 3AHC_A 3AHJ_A 3AHG_A 3AHE_A 3AHI_A 3AHD_A 3AHF_A 3AHH_A. Probab=26.99 E-value=83 Score=21.88 Aligned_cols=56 Identities=20% Similarity=0.183 Sum_probs=28.7 Q ss_pred CCcccEEEEccChHHHHH--HHHHhcc---CCCEEEEecCCC------C---Cccc---ChHHHHhcCcEEEe Q 034260 2 GAGIDVSFDCAGLNKTMS--TVLDATR---AGDKVCLVGMGH------H---DMTV---PLTPAAARYLIYGF 57 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~--~al~~l~---~gGrvv~vG~~~------~---~~~i---~~~~l~~k~~~i~G 57 (100) |..+|+|+-|+|..+|++ .|.++|+ |.=||-+|-+-. . |--+ .+..+..+.+-|.. T Consensus 32 g~ePDVVlA~aGd~pT~E~lAA~~lLr~~~P~lkiRvVNVvDLm~L~~~~~hPhglsd~~Fd~lFT~DkPViF 104 (203) T PF09363_consen 32 GEEPDVVLACAGDVPTLEVLAAASLLREHFPELKIRVVNVVDLMKLQPPSEHPHGLSDEEFDALFTKDKPVIF 104 (203) T ss_dssp TTT-SEEEEEESHHHHHHHHHHHHHHHHT--T--EEEEEESBGGGGS-TTT-TTS--HHHHHHHH-SSS-EEE T ss_pred CCCCCEEEEecCchhhHHHHHHHHHHHHhccCceEEEEEEeEccccCCCCCCCCcCCHHHHHHhcCCCCCEEE Confidence 346899999999987764 3445554 444555554321 0 1112 23456677777774 No 335 >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=26.86 E-value=51 Score=24.14 Aligned_cols=33 Identities=21% Similarity=0.288 Sum_probs=27.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..+.. +++++|..++=+|... T Consensus 204 ~ADIvIsAvGkp~~i~~--~~vk~gavVIDvGin~ 236 (293) T PRK14185 204 EADIIIAALGQPEFVKA--DMVKEGAVVIDVGTTR 236 (293) T ss_pred hCCEEEEccCCcCccCH--HHcCCCCEEEEecCcc Confidence 58999999999876653 8899999888888754 No 336 >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2. Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with one the E. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the divergent clade of putative ThiF proteins such found in Campylobacter. Probab=26.63 E-value=83 Score=21.36 Aligned_cols=15 Identities=7% Similarity=0.078 Sum_probs=11.8 Q ss_pred cccEEEEccChHHHH Q 034260 4 GIDVSFDCAGLNKTM 18 (100) Q Consensus 4 G~D~vie~~G~~~~~ 18 (100) ++|+|+||+...++- T Consensus 110 ~~DlVi~a~Dn~~~k 124 (200) T TIGR02354 110 DADIVCEAFDNAEAK 124 (200) T ss_pred CCCEEEECCCCHHHH Confidence 589999998876543 No 337 >PRK13937 phosphoheptose isomerase; Provisional Probab=26.42 E-value=79 Score=21.05 Aligned_cols=24 Identities=29% Similarity=0.497 Sum_probs=20.0 Q ss_pred HHHHHHHHhccCCCEEEEecCCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) .+.+++.+.++.++|+.++|.... T Consensus 26 ~aa~~i~~~l~~a~rI~i~G~G~S 49 (188) T PRK13937 26 KVAEALIEALANGGKILLCGNGGS 49 (188) T ss_pred HHHHHHHHHHHCCCEEEEEeCcHh Confidence 467888889999999999998653 No 338 >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms). Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. Separate models are built for the two types in order to exclude the USG-1 protein, found in several species, which is specifically related to the Bacillus subtilis type of aspartate-semialdehyde dehydrogenase. Members of this type are found primarily in organisms that lack peptidoglycan. Probab=26.34 E-value=1.3e+02 Score=22.10 Aligned_cols=34 Identities=15% Similarity=0.131 Sum_probs=24.3 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~ 36 (100) .++|+|+.|+++..+.+.+-++.+.|-+++..+. T Consensus 72 ~~~DvVf~a~p~~~s~~~~~~~~~~G~~VIDlsg 105 (341) T TIGR00978 72 KDVDIVFSALPSEVAEEVEPKLAEAGKPVFSNAS 105 (341) T ss_pred ccCCEEEEeCCHHHHHHHHHHHHHCCCEEEECCh Confidence 3589999999998777666566566666665554 No 339 >PRK10901 16S rRNA methyltransferase B; Provisional Probab=26.24 E-value=84 Score=23.84 Aligned_cols=20 Identities=5% Similarity=0.194 Sum_probs=16.8 Q ss_pred HHHHHHHHhccCCCEEEEec Q 034260 16 KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG 35 (100) ..++.+.++++|||++++.- T Consensus 353 ~iL~~a~~~LkpGG~lvyst 372 (427) T PRK10901 353 EILDALWPLLKPGGTLLYAT 372 (427) T ss_pred HHHHHHHHhcCCCCEEEEEe Confidence 36788999999999999654 No 340 >PRK01160 hypothetical protein; Provisional Probab=26.12 E-value=1.8e+02 Score=19.82 Aligned_cols=34 Identities=12% Similarity=0.009 Sum_probs=21.4 Q ss_pred EEEEccChHHHHHHHHHhccCCCEEEEecCCCCC Q 034260 7 VSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHD 40 (100) Q Consensus 7 ~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~ 40 (100) +.|..-|.........-..+|.|.+|+.|.+... T Consensus 117 ~~I~VdGEEDLa~lP~il~aP~gs~VlYGQP~eG 150 (178) T PRK01160 117 VRIEVNGEEDLAVIPAVLYAPLGTVVAYGQPDEG 150 (178) T ss_pred EEEEEcChHHHHHHHHHHhcCCCCEEEeCCCCCc Confidence 4555566665555555566677777777776543 No 341 >COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Probab=26.10 E-value=79 Score=24.62 Aligned_cols=36 Identities=22% Similarity=0.280 Sum_probs=30.0 Q ss_pred cccE--EEEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 4 GIDV--SFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 4 G~D~--vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) |.|+ +||+-..+..+++|++++++.|..+....+.. T Consensus 111 GidvfRiFDAlND~RNl~~ai~a~kk~G~h~q~~i~YT 148 (472) T COG5016 111 GIDVFRIFDALNDVRNLKTAIKAAKKHGAHVQGTISYT 148 (472) T ss_pred CCcEEEechhccchhHHHHHHHHHHhcCceeEEEEEec Confidence 5666 89999999999999999999988877666543 No 342 >PRK08328 hypothetical protein; Provisional Probab=25.92 E-value=81 Score=21.84 Aligned_cols=14 Identities=43% Similarity=0.686 Sum_probs=11.8 Q ss_pred cccEEEEccChHHH Q 034260 4 GIDVSFDCAGLNKT 17 (100) Q Consensus 4 G~D~vie~~G~~~~ 17 (100) +.|+|+||+....+ T Consensus 118 ~~D~Vid~~d~~~~ 131 (231) T PRK08328 118 GVDVIVDCLDNFET 131 (231) T ss_pred cCCEEEECCCCHHH Confidence 58999999998655 No 343 >cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism. Probab=25.59 E-value=1.8e+02 Score=18.25 Aligned_cols=11 Identities=27% Similarity=0.748 Sum_probs=5.2 Q ss_pred CEEEEecCCCC Q 034260 29 DKVCLVGMGHH 39 (100) Q Consensus 29 Grvv~vG~~~~ 39 (100) ..++++..... T Consensus 51 ~d~vvi~lGtN 61 (150) T cd01840 51 RKTVVIGLGTN 61 (150) T ss_pred CCeEEEEecCC Confidence 34555544443 No 344 >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown. Probab=25.58 E-value=97 Score=21.67 Aligned_cols=27 Identities=11% Similarity=0.074 Sum_probs=19.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDK 30 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGr 30 (100) .+|+|+||......-....+.++..+. T Consensus 102 ~~D~VvdaiD~~~~k~~L~~~c~~~~i 128 (231) T cd00755 102 DPDFVVDAIDSIRAKVALIAYCRKRKI 128 (231) T ss_pred CCCEEEEcCCCHHHHHHHHHHHHHhCC Confidence 589999999987665555556655553 No 345 >TIGR00452 methyltransferase, putative. Known examples to date are restricted to the proteobacteria. Probab=25.22 E-value=86 Score=23.02 Aligned_cols=31 Identities=10% Similarity=0.108 Sum_probs=22.2 Q ss_pred cccEEEEcc-----Ch-HHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCA-----GL-NKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~-----G~-~~~~~~al~~l~~gGrvv~v 34 (100) .+|+|+-.. .. ...+.++.+.+++||++++- T Consensus 188 ~FD~V~s~gvL~H~~dp~~~L~el~r~LkpGG~Lvle 224 (314) T TIGR00452 188 AFDTVFSMGVLYHRKSPLEHLKQLKHQLVIKGELVLE 224 (314) T ss_pred CcCEEEEcchhhccCCHHHHHHHHHHhcCCCCEEEEE Confidence 467766431 12 25789999999999999974 No 346 >TIGR00740 methyltransferase, putative. A simple BLAST search finds all members of this family and weaker hits to a large number of known and predicted methyltransferases. A single iteration with PSI-BLAST, keeping only clear members of the family, leads to a large number of highly significant hits to a set of known and predicted methyltransferases with a large repertoire of different specifities. This model is restricted to a subfamily found so far only in the Proteobacteria, sharing consistent length, full-length homology, and on average better than 35 % identity. It is reasonable to predict equivalent function within this subfamily. Probab=25.20 E-value=92 Score=21.27 Aligned_cols=21 Identities=5% Similarity=0.156 Sum_probs=17.8 Q ss_pred HHHHHHHHhccCCCEEEEecC Q 034260 16 KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~ 36 (100) ..+++..+.++|||++++.-. T Consensus 142 ~~l~~i~~~LkpgG~l~i~d~ 162 (239) T TIGR00740 142 ALLTKIYEGLNPNGVLVLSEK 162 (239) T ss_pred HHHHHHHHhcCCCeEEEEeec Confidence 468899999999999998754 No 347 >cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit Va is one of three mammalian subunits that lacks a transmembrane region. Subunit Va is located on the matrix side of the membrane and binds thyroid hormone T2, releasing allosteric inhibition caused by the binding of ATP to subunit IV and allowing high turnover at elevated intramitochondrial ATP/ADP ratios. Probab=24.68 E-value=42 Score=20.81 Aligned_cols=20 Identities=25% Similarity=0.331 Sum_probs=17.6 Q ss_pred EEEccChHHHHHHHHHhccC Q 034260 8 SFDCAGLNKTMSTVLDATRA 27 (100) Q Consensus 8 vie~~G~~~~~~~al~~l~~ 27 (100) ..|.+..|..+.+|++++|+ T Consensus 35 ~~DlVP~P~ii~aaLrAcRR 54 (103) T cd00923 35 GYDLVPEPKVIEAALRACRR 54 (103) T ss_pred ccccCCCcHHHHHHHHHHHH Confidence 46889999999999999985 No 348 >COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Probab=24.56 E-value=92 Score=22.54 Aligned_cols=29 Identities=14% Similarity=0.182 Sum_probs=21.7 Q ss_pred CCcccEEEEccChHHHHHHHHHhccCCCE Q 034260 2 GAGIDVSFDCAGLNKTMSTVLDATRAGDK 30 (100) Q Consensus 2 G~G~D~vie~~G~~~~~~~al~~l~~gGr 30 (100) |..++++++-+-+....+..++-+..||+ T Consensus 125 G~~A~lll~pT~sv~~~~~~L~~l~~GG~ 153 (261) T COG1240 125 GEKAELLLPPTSSVELAERALERLPTGGK 153 (261) T ss_pred CCcceEEeCCcccHHHHHHHHHhCCCCCC Confidence 45578888888777777777777777764 No 349 >PRK01683 trans-aconitate 2-methyltransferase; Provisional Probab=24.55 E-value=99 Score=21.27 Aligned_cols=32 Identities=13% Similarity=0.188 Sum_probs=23.1 Q ss_pred cccEEEEccC------hHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAG------LNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G------~~~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+-... ....+++..++|++||++++.. T Consensus 93 ~fD~v~~~~~l~~~~d~~~~l~~~~~~LkpgG~~~~~~ 130 (258) T PRK01683 93 ALDLIFANASLQWLPDHLELFPRLVSLLAPGGVLAVQM 130 (258) T ss_pred CccEEEEccChhhCCCHHHHHHHHHHhcCCCcEEEEEC Confidence 4677664432 2357889999999999998853 No 350 >PRK06349 homoserine dehydrogenase; Provisional Probab=24.43 E-value=1.3e+02 Score=22.86 Aligned_cols=31 Identities=26% Similarity=0.321 Sum_probs=19.2 Q ss_pred cccEEEEccChH-HHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLN-KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~-~~~~~al~~l~~gGrvv~vG 35 (100) .+|+|+||+|.. ...+...++++.| +-|+.. T Consensus 72 ~iDvVve~tg~~~~~~~~~~~aL~~G-khVVta 103 (426) T PRK06349 72 DIDIVVELMGGIEPARELILKALEAG-KHVVTA 103 (426) T ss_pred CCCEEEECCCCchHHHHHHHHHHHCC-CeEEEc Confidence 579999998764 3445555666554 444443 No 351 >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4). All are thought to be S-adenosyl-L-methionine (SAM) utilising methyltransferases []. Mycolic acid cyclopropane synthase or cyclopropane-fatty-acyl-phospholipid synthase (CFA synthase) 2.1.1.79 from EC catalyses the reaction:S-adenosyl-L-methionine + phospholipid olefinic fatty acid -> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid. The major mycolic acid produced by Mycobacterium tuberculosis contains two cis-cyclopropanes in the meromycolate chain. Cyclopropanation may contribute to the structural integrity of the cell wall complex [].; GO: 0008610 lipid biosynthetic process; PDB: 3HA5_A 2FK8_A 3HA7_A 3HA3_A 2FK7_A 1KPG_D 1KP9_B 1KPH_D 3VC2_E 3VC1_D .... Probab=24.38 E-value=55 Score=23.42 Aligned_cols=27 Identities=15% Similarity=0.306 Sum_probs=20.0 Q ss_pred EEccCh---HHHHHHHHHhccCCCEEEEec Q 034260 9 FDCAGL---NKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 9 ie~~G~---~~~~~~al~~l~~gGrvv~vG 35 (100) +|.+|. +.-++.+-+.|+|||++++=. T Consensus 137 ~Ehvg~~~~~~~f~~~~~~LkpgG~~~lq~ 166 (273) T PF02353_consen 137 FEHVGRKNYPAFFRKISRLLKPGGRLVLQT 166 (273) T ss_dssp GGGTCGGGHHHHHHHHHHHSETTEEEEEEE T ss_pred hhhcChhHHHHHHHHHHHhcCCCcEEEEEe Confidence 455664 356888999999999998543 No 352 >PLN02589 caffeoyl-CoA O-methyltransferase Probab=24.37 E-value=1.1e+02 Score=21.61 Aligned_cols=31 Identities=16% Similarity=0.201 Sum_probs=21.5 Q ss_pred cccEEE-EccCh--HHHHHHHHHhccCCCEEEEe Q 034260 4 GIDVSF-DCAGL--NKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vi-e~~G~--~~~~~~al~~l~~gGrvv~v 34 (100) .+|.|| |+--. +..++.+++++++||.+++= T Consensus 156 ~fD~iFiDadK~~Y~~y~~~~l~ll~~GGviv~D 189 (247) T PLN02589 156 TFDFIFVDADKDNYINYHKRLIDLVKVGGVIGYD 189 (247) T ss_pred cccEEEecCCHHHhHHHHHHHHHhcCCCeEEEEc Confidence 567754 44322 24578899999999998864 No 353 >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=23.89 E-value=61 Score=23.60 Aligned_cols=34 Identities=24% Similarity=0.378 Sum_probs=27.5 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +.+|+++-|+|.+..+.. +++++|..++=+|... T Consensus 200 k~ADIvIsAvGkp~~i~~--~~vk~gavVIDvGin~ 233 (282) T PRK14180 200 TKADILIVAVGKPNFITA--DMVKEGAVVIDVGINH 233 (282) T ss_pred hhcCEEEEccCCcCcCCH--HHcCCCcEEEEecccc Confidence 358999999999876553 7899998888888754 No 354 >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate []. The enzyme participates in the citric acid cycle. This entry represents the N-terminal, and is thought to be a Rossmann NAD-binding fold.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IB6_B 3HHP_C 1IE3_A 2PWZ_A 1EMD_A 2CMD_A 1EZ4_D 9LDT_B 9LDB_B 2D4A_C .... Probab=23.88 E-value=1.5e+02 Score=18.77 Aligned_cols=34 Identities=15% Similarity=0.165 Sum_probs=21.7 Q ss_pred cccEEEEccChHH------------------HHHHHHHhccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNK------------------TMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~------------------~~~~al~~l~~gGrvv~vG~~ 37 (100) ++|+|+-++|.+. .+-..+....|.|.+++++.| T Consensus 69 ~aDivvitag~~~~~g~sR~~ll~~N~~i~~~~~~~i~~~~p~~~vivvtNP 120 (141) T PF00056_consen 69 DADIVVITAGVPRKPGMSRLDLLEANAKIVKEIAKKIAKYAPDAIVIVVTNP 120 (141) T ss_dssp TESEEEETTSTSSSTTSSHHHHHHHHHHHHHHHHHHHHHHSTTSEEEE-SSS T ss_pred cccEEEEeccccccccccHHHHHHHhHhHHHHHHHHHHHhCCccEEEEeCCc Confidence 5899999998742 223344444688888887544 No 355 >KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Probab=23.76 E-value=74 Score=24.23 Aligned_cols=19 Identities=11% Similarity=0.205 Sum_probs=15.6 Q ss_pred HHHHHHHhccCCCEEEEec Q 034260 17 TMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG 35 (100) .+..+++++++||++|.-- T Consensus 278 iL~rgl~lLk~GG~lVYST 296 (375) T KOG2198|consen 278 ILRRGLRLLKVGGRLVYST 296 (375) T ss_pred HHHHHHHHhcCCCEEEEec Confidence 4577899999999999643 No 356 >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=23.56 E-value=62 Score=23.74 Aligned_cols=33 Identities=21% Similarity=0.340 Sum_probs=27.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..+.. +++++|..++=+|... T Consensus 204 ~ADIvIsAvGkp~~i~~--~~ik~gaiVIDvGin~ 236 (297) T PRK14167 204 RADIVVAAAGVPELIDG--SMLSEGATVIDVGINR 236 (297) T ss_pred hCCEEEEccCCcCccCH--HHcCCCCEEEEccccc Confidence 58999999999876654 7899998888888654 No 357 >PRK07806 short chain dehydrogenase; Provisional Probab=23.42 E-value=1.8e+02 Score=19.38 Aligned_cols=33 Identities=24% Similarity=0.240 Sum_probs=22.4 Q ss_pred cccEEEEccChH-------------------HHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSFDCAGLN-------------------KTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vie~~G~~-------------------~~~~~al~~l~~gGrvv~vG~ 36 (100) ++|+++-++|.. ..++.+...++.+|+++.++. T Consensus 84 ~~d~vi~~ag~~~~~~~~~~~~~~vn~~~~~~l~~~~~~~~~~~~~iv~isS 135 (248) T PRK07806 84 GLDALVLNASGGMESGMDEDYAMRLNRDAQRNLARAALPLMPAGSRVVFVTS 135 (248) T ss_pred CCcEEEECCCCCCCCCCCcceeeEeeeHHHHHHHHHHHhhccCCceEEEEeC Confidence 478877777642 245566666667789998865 No 358 >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Probab=23.22 E-value=1.5e+02 Score=21.76 Aligned_cols=32 Identities=28% Similarity=0.229 Sum_probs=22.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) ++|+|+-|++.....+.+.++++.|-.++=.+ T Consensus 68 ~vD~Vf~alP~~~~~~~v~~a~~aG~~VID~S 99 (343) T PRK00436 68 GADVVFLALPHGVSMDLAPQLLEAGVKVIDLS 99 (343) T ss_pred CCCEEEECCCcHHHHHHHHHHHhCCCEEEECC Confidence 58999999999877777777766544444333 No 359 >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=23.19 E-value=74 Score=23.14 Aligned_cols=33 Identities=21% Similarity=0.311 Sum_probs=25.4 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..+... ++++|..++=+|... T Consensus 195 ~ADIvI~Avgk~~lv~~~--~vk~GavVIDVgi~~ 227 (279) T PRK14178 195 QADILVSAAGKAGFITPD--MVKPGATVIDVGINQ 227 (279) T ss_pred hCCEEEECCCcccccCHH--HcCCCcEEEEeeccc Confidence 589999999977655543 379998888888763 No 360 >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Probab=23.17 E-value=2.3e+02 Score=19.52 Aligned_cols=35 Identities=17% Similarity=0.125 Sum_probs=28.0 Q ss_pred cccEEEEccChH--------HHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLN--------KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~--------~~~~~al~~l~~gGrvv~vG~~~ 38 (100) -+|.||-|...- +.+++.++.++.||.++.+-..+ T Consensus 117 ~~D~viS~lPll~~P~~~~iaile~~~~rl~~gg~lvqftYgp 159 (194) T COG3963 117 FFDSVISGLPLLNFPMHRRIAILESLLYRLPAGGPLVQFTYGP 159 (194) T ss_pred eeeeEEeccccccCcHHHHHHHHHHHHHhcCCCCeEEEEEecC Confidence 478888887632 46899999999999999997763 No 361 >PTZ00146 fibrillarin; Provisional Probab=22.72 E-value=1.4e+02 Score=21.90 Aligned_cols=31 Identities=13% Similarity=0.092 Sum_probs=21.6 Q ss_pred cccEEEEccChHH----HHHHHHHhccCCCEEEEe Q 034260 4 GIDVSFDCAGLNK----TMSTVLDATRAGDKVCLV 34 (100) Q Consensus 4 G~D~vie~~G~~~----~~~~al~~l~~gGrvv~v 34 (100) .+|+|+-.+..+. ....+-..|+++|++++. T Consensus 202 ~vDvV~~Dva~pdq~~il~~na~r~LKpGG~~vI~ 236 (293) T PTZ00146 202 MVDVIFADVAQPDQARIVALNAQYFLKNGGHFIIS 236 (293) T ss_pred CCCEEEEeCCCcchHHHHHHHHHHhccCCCEEEEE Confidence 4688777654432 234667799999999983 No 362 >PRK15116 sulfur acceptor protein CsdL; Provisional Probab=22.66 E-value=1.3e+02 Score=21.57 Aligned_cols=34 Identities=12% Similarity=0.187 Sum_probs=20.8 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCE-EEEecCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDK-VCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGr-vv~vG~~ 37 (100) .+|+||||.+...+-....+.++..+. ++..|.. T Consensus 121 ~~D~VIdaiD~~~~k~~L~~~c~~~~ip~I~~gGa 155 (268) T PRK15116 121 GFSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGA 155 (268) T ss_pred CCCEEEEcCCCHHHHHHHHHHHHHcCCCEEEECCc Confidence 589999999986554444455554443 4444433 No 363 >PRK06407 ornithine cyclodeaminase; Provisional Probab=22.64 E-value=1.4e+02 Score=21.71 Aligned_cols=43 Identities=9% Similarity=-0.059 Sum_probs=30.7 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChHH Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLTP 47 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~~ 47 (100) ++|+|+-|+++...+- --+.++||-.+..+|...+ ..+++... T Consensus 182 ~aDIV~taT~s~~P~~-~~~~l~pg~hV~aiGs~~p~~~El~~~~ 225 (301) T PRK06407 182 DADTITSITNSDTPIF-NRKYLGDEYHVNLAGSNYPNRREAEHSV 225 (301) T ss_pred cCCEEEEecCCCCcEe-cHHHcCCCceEEecCCCCCCcccCCHHH Confidence 6899999998764332 2346799889999998765 45677553 No 364 >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D. Probab=22.63 E-value=63 Score=18.93 Aligned_cols=17 Identities=12% Similarity=0.292 Sum_probs=11.8 Q ss_pred HHHHHHHhccCCCEEEE Q 034260 17 TMSTVLDATRAGDKVCL 33 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~ 33 (100) .++.+...+++||.+++ T Consensus 87 dl~~~~~~l~~ggviv~ 103 (106) T PF13578_consen 87 DLENALPRLAPGGVIVF 103 (106) T ss_dssp HHHHHGGGEEEEEEEEE T ss_pred HHHHHHHHcCCCeEEEE Confidence 45667777788887664 No 365 >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3). Bin3, which shows similarity to a number of protein methyltransferases that modify RNA-binding proteins, interacts with Bicoid, which itself directs pattern formation in the early Drosophila embryo. The interaction might allow Bicoid to switch between its dual roles in transcription and translation []. Note that proteins of the entry contain a conserved HLN motif.; GO: 0008168 methyltransferase activity; PDB: 3G07_B. Probab=22.54 E-value=56 Score=20.47 Aligned_cols=19 Identities=16% Similarity=0.268 Sum_probs=15.9 Q ss_pred HHHHHHHHhccCCCEEEEe Q 034260 16 KTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~v 34 (100) ..+....++++|||.+++= T Consensus 25 ~~f~~~~~~L~pGG~lilE 43 (110) T PF06859_consen 25 RFFRRIYSLLRPGGILILE 43 (110) T ss_dssp HHHHHHHHHEEEEEEEEEE T ss_pred HHHHHHHHhhCCCCEEEEe Confidence 4677888999999999974 No 366 >PRK05597 molybdopterin biosynthesis protein MoeB; Validated Probab=22.49 E-value=92 Score=23.11 Aligned_cols=27 Identities=19% Similarity=-0.078 Sum_probs=17.2 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDK 30 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGr 30 (100) ++|+|+||+....+-...-++++..+. T Consensus 118 ~~DvVvd~~d~~~~r~~~n~~c~~~~i 144 (355) T PRK05597 118 DADVILDGSDNFDTRHLASWAAARLGI 144 (355) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHcCC Confidence 689999999987654333344444343 No 367 >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=22.32 E-value=60 Score=23.68 Aligned_cols=33 Identities=24% Similarity=0.376 Sum_probs=26.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-|+|.+..+.. +++++|..++=+|... T Consensus 204 ~ADIVI~AvG~p~li~~--~~vk~GavVIDVGi~~ 236 (286) T PRK14184 204 EADFLFVAIGRPRFVTA--DMVKPGAVVVDVGINR 236 (286) T ss_pred hCCEEEEecCCCCcCCH--HHcCCCCEEEEeeeec Confidence 58999999999876654 6678888888888664 No 368 >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Probab=22.23 E-value=1e+02 Score=23.33 Aligned_cols=23 Identities=9% Similarity=0.189 Sum_probs=18.9 Q ss_pred HHHHHHHHhccCCCEEEEecCCC Q 034260 16 KTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG~~~ 38 (100) ..+.++.+.|++||++.+++... T Consensus 321 ~l~~~a~~~LkpGG~L~iV~nr~ 343 (378) T PRK15001 321 EMFHHARRCLKINGELYIVANRH 343 (378) T ss_pred HHHHHHHHhcccCCEEEEEEecC Confidence 45788889999999999997443 No 369 >PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function.; PDB: 3L5O_B 3NPG_A. Probab=22.12 E-value=2.3e+02 Score=18.23 Aligned_cols=49 Identities=22% Similarity=0.209 Sum_probs=32.3 Q ss_pred ccEEEEccCh---HHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhcCcEEEe Q 034260 5 IDVSFDCAGL---NKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAARYLIYGF 57 (100) Q Consensus 5 ~D~vie~~G~---~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k~~~i~G 57 (100) +|+++- ||. ..+++.-++.++++..++++|-.. ++.+..+.....+..| T Consensus 63 aD~vii-TGsTlvN~Ti~~iL~~~~~~~~vil~GpS~---~~~P~~l~~~Gv~~v~ 114 (147) T PF04016_consen 63 ADVVII-TGSTLVNGTIDDILELARNAREVILYGPSA---PLHPEALFDYGVTYVG 114 (147) T ss_dssp -SEEEE-ECHHCCTTTHHHHHHHTTTSSEEEEESCCG---GS-GGGGCCTT-SEEE T ss_pred CCEEEE-EeeeeecCCHHHHHHhCccCCeEEEEecCc---hhhHHHHHhCCCCEEE Confidence 566664 332 268999999999888999988553 3334455566787875 No 370 >TIGR01177 conserved hypothetical protein TIGR01177. This family is found exclusively in the Archaea. Probab=22.07 E-value=1.2e+02 Score=22.11 Aligned_cols=20 Identities=0% Similarity=0.107 Sum_probs=16.8 Q ss_pred HHHHHHHHhccCCCEEEEec Q 034260 16 KTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 16 ~~~~~al~~l~~gGrvv~vG 35 (100) ..++.+.+.+++||+++++- T Consensus 275 ~~l~~~~r~Lk~gG~lv~~~ 294 (329) T TIGR01177 275 RSLEEFHEVLKSEGWIVYAV 294 (329) T ss_pred HHHHHHHHHccCCcEEEEEE Confidence 46788889999999999874 No 371 >PRK09485 mmuM homocysteine methyltransferase; Provisional Probab=21.98 E-value=3.1e+02 Score=19.78 Aligned_cols=65 Identities=9% Similarity=-0.084 Sum_probs=37.0 Q ss_pred EEEEccChHHHHHHHHHhccCCCE--EEEecCCCCCc---------ccCh-------HHHHhcCcEEEeEeeceeeeeec Q 034260 7 VSFDCAGLNKTMSTVLDATRAGDK--VCLVGMGHHDM---------TVPL-------TPAAARYLIYGFLFFFFLVLGYS 68 (100) Q Consensus 7 ~vie~~G~~~~~~~al~~l~~gGr--vv~vG~~~~~~---------~i~~-------~~l~~k~~~i~Gs~~~~g~~~~~ 68 (100) +-+.|+| +..+..+++.++.... +.+....+.+. .-+. ..+...+.+|.| |.++-+ T Consensus 218 iGiNC~~-p~~~~~~l~~~~~~~~~pl~~~PNaG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iiG-----GCCGtt 291 (304) T PRK09485 218 VGVNCTA-PELVTAAIAALRAVTDKPLVVYPNSGEVYDAVTKTWHGPADDASLGELAPEWYAAGARLIG-----GCCRTT 291 (304) T ss_pred EEecCCC-HHHHHHHHHHHHhccCCcEEEECCCCCCCCCCCCcccCCCChHHHHHHHHHHHHcCCeEEe-----eCCCCC Confidence 4588985 6778888877755432 22222221110 0011 134566889997 877777 Q ss_pred hhhHHHHHH Q 034260 69 VIYFRKMLY 77 (100) Q Consensus 69 ~~~~~~i~~ 77 (100) ++..+++.. T Consensus 292 P~hI~al~~ 300 (304) T PRK09485 292 PEDIAALAA 300 (304) T ss_pred HHHHHHHHH Confidence 777776653 No 372 >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases []. Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A .... Probab=21.91 E-value=95 Score=21.18 Aligned_cols=22 Identities=18% Similarity=0.368 Sum_probs=18.6 Q ss_pred HHHHHHHHhccCC--CEEEEecCC Q 034260 16 KTMSTVLDATRAG--DKVCLVGMG 37 (100) Q Consensus 16 ~~~~~al~~l~~g--Grvv~vG~~ 37 (100) ..++.+.++++|| ||++++-.. T Consensus 178 ~iL~~~~~al~pg~~g~llI~e~~ 201 (241) T PF00891_consen 178 KILRNAAAALKPGKDGRLLIIEMV 201 (241) T ss_dssp HHHHHHHHHSEECTTEEEEEEEEE T ss_pred HHHHHHHHHhCCCCCCeEEEEeec Confidence 3578899999988 999998764 No 373 >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins. Carotenoids with cyclic end groups are essential components of the photosynthetic membranes in all plants, algae, and cyanobacteria. These lipid-soluble compounds protect against photo-oxidation, harvest light for photosynthesis, and dissipate excess light energy absorbed by the antenna pigments. The cyclisation of lycopene (psi, psi-carotene) is a key branch point in the pathway of carotenoid biosynthesis. Two types of cyclic end groups are found in higher plant carotenoids: the beta and epsilon rings. Carotenoids with two beta rings are ubiquitous, and those with one beta and one epsilon ring are common; however, carotenoids with two epsilon rings are rare [].; GO: 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0016117 carotenoid biosynthetic process Probab=21.76 E-value=2.1e+02 Score=21.13 Aligned_cols=28 Identities=32% Similarity=0.299 Sum_probs=23.6 Q ss_pred cEEEEccChHHHHHHHHHh--ccCCCEEEEe Q 034260 6 DVSFDCAGLNKTMSTVLDA--TRAGDKVCLV 34 (100) Q Consensus 6 D~vie~~G~~~~~~~al~~--l~~gGrvv~v 34 (100) |++|-..|. +.+..|.++ .+++-+|+++ T Consensus 1 DviIvGaGp-AGlslA~~l~~~~~g~~Vlli 30 (374) T PF05834_consen 1 DVIIVGAGP-AGLSLARRLADARPGLSVLLI 30 (374) T ss_pred CEEEECCcH-HHHHHHHHHHhcCCCCEEEEE Confidence 788888884 678888888 8899999999 No 374 >PRK04457 spermidine synthase; Provisional Probab=21.60 E-value=1.1e+02 Score=21.55 Aligned_cols=20 Identities=5% Similarity=-0.001 Sum_probs=17.3 Q ss_pred HHHHHHHHHhccCCCEEEEe Q 034260 15 NKTMSTVLDATRAGDKVCLV 34 (100) Q Consensus 15 ~~~~~~al~~l~~gGrvv~v 34 (100) ...++++.+.|+++|++++- T Consensus 157 ~efl~~~~~~L~pgGvlvin 176 (262) T PRK04457 157 QPFFDDCRNALSSDGIFVVN 176 (262) T ss_pred HHHHHHHHHhcCCCcEEEEE Confidence 36789999999999999974 No 375 >PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species. Probab=21.57 E-value=91 Score=21.19 Aligned_cols=30 Identities=20% Similarity=0.253 Sum_probs=21.5 Q ss_pred EEccChHHHHHHHHHhccCCCEEEEecCCCC Q 034260 9 FDCAGLNKTMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 9 ie~~G~~~~~~~al~~l~~gGrvv~vG~~~~ 39 (100) +|.-|....+...-.++++||++.+ |++-+ T Consensus 85 idp~Gdl~~m~~i~~vLK~GG~L~l-~vPvG 114 (177) T PF03269_consen 85 IDPIGDLRAMAKIKCVLKPGGLLFL-GVPVG 114 (177) T ss_pred CCccccHHHHHHHHHhhccCCeEEE-EeecC Confidence 4455666677777788999999875 55543 No 376 >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Probab=21.54 E-value=1.5e+02 Score=21.91 Aligned_cols=37 Identities=16% Similarity=0.205 Sum_probs=26.7 Q ss_pred CcccEEEEccChHH------------------HHHHHHHhccCCCEEEEecCCCC Q 034260 3 AGIDVSFDCAGLNK------------------TMSTVLDATRAGDKVCLVGMGHH 39 (100) Q Consensus 3 ~G~D~vie~~G~~~------------------~~~~al~~l~~gGrvv~vG~~~~ 39 (100) +++|+|+-++|.+. .+...+....|.|.+.+++.+-+ T Consensus 68 ~~aDiVvitAG~prKpGmtR~DLl~~Na~I~~~i~~~i~~~~~d~ivlVvtNPvD 122 (313) T COG0039 68 KGADIVVITAGVPRKPGMTRLDLLEKNAKIVKDIAKAIAKYAPDAIVLVVTNPVD 122 (313) T ss_pred cCCCEEEEeCCCCCCCCCCHHHHHHhhHHHHHHHHHHHHhhCCCeEEEEecCcHH Confidence 37899999998763 34455556678899988876643 No 377 >PLN00135 malate dehydrogenase Probab=21.42 E-value=1.5e+02 Score=21.64 Aligned_cols=34 Identities=18% Similarity=0.372 Sum_probs=24.2 Q ss_pred cccEEEEccChHH------------------HHHHHHHh-ccCCCEEEEecCC Q 034260 4 GIDVSFDCAGLNK------------------TMSTVLDA-TRAGDKVCLVGMG 37 (100) Q Consensus 4 G~D~vie~~G~~~------------------~~~~al~~-l~~gGrvv~vG~~ 37 (100) ++|+|+-|+|.+. .+-+.+.- ..|.|.+++++.| T Consensus 58 daDiVVitAG~~~k~g~sR~dll~~N~~I~~~i~~~i~~~~~p~aivivvsNP 110 (309) T PLN00135 58 GVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPDCKVLVVANP 110 (309) T ss_pred CCCEEEEeCCCCCCCCCcHHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEeCCc Confidence 6899999999852 23334444 5789999999854 No 378 >PRK11579 putative oxidoreductase; Provisional Probab=21.41 E-value=1.8e+02 Score=21.12 Aligned_cols=38 Identities=24% Similarity=0.186 Sum_probs=29.1 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccCh Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPL 45 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~ 45 (100) .+|+|+.|++...-.+.++++++. |+-|++ .+|+..+. T Consensus 64 ~vD~V~I~tp~~~H~~~~~~al~a-GkhVl~---EKPla~t~ 101 (346) T PRK11579 64 NIDLIVIPTPNDTHFPLAKAALEA-GKHVVV---DKPFTVTL 101 (346) T ss_pred CCCEEEEcCCcHHHHHHHHHHHHC-CCeEEE---eCCCCCCH Confidence 589999999998888999998876 466665 55555544 No 379 >PRK10637 cysG siroheme synthase; Provisional Probab=21.22 E-value=2.6e+02 Score=21.52 Aligned_cols=52 Identities=13% Similarity=0.076 Sum_probs=32.9 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCCCcccChHHHHhc-CcEE Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHHDMTVPLTPAAAR-YLIY 55 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~~~~i~~~~l~~k-~~~i 55 (100) ++++||-|++.+..=++..+.++..|.+|-+.-......+-...++.+ .++| T Consensus 72 ~~~lv~~at~d~~~n~~i~~~a~~~~~lvN~~d~~~~~~f~~pa~~~~g~l~i 124 (457) T PRK10637 72 TCWLAIAATDDDAVNQRVSEAAEARRIFCNVVDAPKAASFIMPSIIDRSPLMV 124 (457) T ss_pred CCEEEEECCCCHHHhHHHHHHHHHcCcEEEECCCcccCeEEEeeEEecCCEEE Confidence 689999999987655555566677788887765544334333333333 4554 No 380 >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype. Probab=21.22 E-value=1.7e+02 Score=19.53 Aligned_cols=43 Identities=9% Similarity=0.067 Sum_probs=29.6 Q ss_pred hHHHHHHHHHhccCCCEEEEe-------cCCCCCcccChHHHHhcCcEEE Q 034260 14 LNKTMSTVLDATRAGDKVCLV-------GMGHHDMTVPLTPAAARYLIYG 56 (100) Q Consensus 14 ~~~~~~~al~~l~~gGrvv~v-------G~~~~~~~i~~~~l~~k~~~i~ 56 (100) ..+.+++++..++.|.+..++ |..+.+..|+++..+..++++. T Consensus 124 vi~Gl~e~L~~Mk~Ge~~~~~iP~~~AYG~~g~~~~Ippns~L~f~IeL~ 173 (177) T TIGR03516 124 LFSGLRDGLKLMKEGETATFLFPSHKAYGYYGDQNKIGPNLPIISTVTLL 173 (177) T ss_pred hhHHHHHHHcCCCCCCEEEEEECHHHcCCCCCCCCCcCcCCcEEEEEEEE Confidence 456899999999999999977 3333334566666555555554 No 381 >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases. The family includes also bacterial O-methyltransferases that may be involved in antibiotic production [].; GO: 0008171 O-methyltransferase activity; PDB: 1SUI_C 1SUS_D 3CBG_A 2GPY_B 3TR6_A 2AVD_A 3DUL_B 3DUW_B 2ZTH_A 1VID_A .... Probab=21.19 E-value=1.2e+02 Score=20.80 Aligned_cols=33 Identities=18% Similarity=0.218 Sum_probs=23.1 Q ss_pred cccEEE-EccCh--HHHHHHHHHhccCCCEEEEecC Q 034260 4 GIDVSF-DCAGL--NKTMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 4 G~D~vi-e~~G~--~~~~~~al~~l~~gGrvv~vG~ 36 (100) .+|.|| |+.=. ...++.+++++++||.+++=-+ T Consensus 121 ~fD~VFiDa~K~~y~~y~~~~~~ll~~ggvii~DN~ 156 (205) T PF01596_consen 121 QFDFVFIDADKRNYLEYFEKALPLLRPGGVIIADNV 156 (205) T ss_dssp SEEEEEEESTGGGHHHHHHHHHHHEEEEEEEEEETT T ss_pred ceeEEEEcccccchhhHHHHHhhhccCCeEEEEccc Confidence 367754 55332 2468889999999999997543 No 382 >PRK14022 UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional Probab=21.14 E-value=2.5e+02 Score=21.49 Aligned_cols=35 Identities=23% Similarity=0.415 Sum_probs=26.5 Q ss_pred cccEEEEccChHHHHHHHHHhccC---CCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRA---GDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~---gGrvv~vG~~~ 38 (100) ++.++.|-+-+|..++.+++.++. +-+++++|... T Consensus 339 g~~vi~DyahNP~s~~aal~~l~~~~~~r~i~V~G~~~ 376 (481) T PRK14022 339 GAKVFIDYAHNGDSLNKLIDVVEEHQKGKLILLLGAAG 376 (481) T ss_pred CCEEEEECCCCHHHHHHHHHHHhhhCCCCEEEEECCCC Confidence 567899988888899999999963 33566777654 No 383 >PRK14903 16S rRNA methyltransferase B; Provisional Probab=21.11 E-value=1.1e+02 Score=23.29 Aligned_cols=20 Identities=10% Similarity=0.044 Sum_probs=16.2 Q ss_pred HHHHHHHhccCCCEEEEecC Q 034260 17 TMSTVLDATRAGDKVCLVGM 36 (100) Q Consensus 17 ~~~~al~~l~~gGrvv~vG~ 36 (100) .+..+.+++++||+++..-- T Consensus 348 iL~~a~~~LkpGG~LvYsTC 367 (431) T PRK14903 348 IVSQAWKLLEKGGILLYSTC 367 (431) T ss_pred HHHHHHHhcCCCCEEEEEEC Confidence 37789999999999886543 No 384 >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Probab=20.82 E-value=1.1e+02 Score=22.31 Aligned_cols=29 Identities=10% Similarity=0.247 Sum_probs=19.1 Q ss_pred HHHHHHHhccCC--CEEEEecCCCCCcccCh Q 034260 17 TMSTVLDATRAG--DKVCLVGMGHHDMTVPL 45 (100) Q Consensus 17 ~~~~al~~l~~g--Grvv~vG~~~~~~~i~~ 45 (100) ....++..+++. |+||+++...+..++|. T Consensus 129 ~Tk~alp~m~~r~~GhIVvisSiaG~~~~P~ 159 (282) T KOG1205|consen 129 LTKAALPSMKKRNDGHIVVISSIAGKMPLPF 159 (282) T ss_pred HHHHHHHHhhhcCCCeEEEEeccccccCCCc Confidence 456666666443 99999987766544444 No 385 >cd07043 STAS_anti-anti-sigma_factors Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes. Probab=20.73 E-value=1.6e+02 Score=16.50 Aligned_cols=7 Identities=29% Similarity=0.591 Sum_probs=2.6 Q ss_pred CEEEEec Q 034260 29 DKVCLVG 35 (100) Q Consensus 29 Grvv~vG 35 (100) +.+.+.| T Consensus 71 ~~v~i~~ 77 (99) T cd07043 71 GRLVLVN 77 (99) T ss_pred CeEEEEc Confidence 3333333 No 386 >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Probab=20.72 E-value=3.2e+02 Score=21.45 Aligned_cols=30 Identities=13% Similarity=0.105 Sum_probs=20.2 Q ss_pred cccEEEEccChHHHHHHH----HHhccCCCEEEE Q 034260 4 GIDVSFDCAGLNKTMSTV----LDATRAGDKVCL 33 (100) Q Consensus 4 G~D~vie~~G~~~~~~~a----l~~l~~gGrvv~ 33 (100) ++|+||||+.....+.+. ++.+.+.+.++. T Consensus 86 ~aDlViEav~E~~~vK~~vf~~l~~~~~~~aila 119 (507) T PRK08268 86 DCDLVVEAIVERLDVKQALFAQLEAIVSPDCILA 119 (507) T ss_pred CCCEEEEcCcccHHHHHHHHHHHHhhCCCCcEEE Confidence 689999999987665554 344445555554 No 387 >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF, which can be interconverted between different oxidation states by methylene-THF dehydrogenase (1.5.1.5 from EC), methenyl-THF cyclohydrolase (3.5.4.9 from EC) and formyl-THF synthetase (6.3.4.3 from EC) [, ]. The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes, including the tri-functional eukaryotic C1-tetrahydrofolate synthase []; a bifunctional eukaryotic mitochondrial protein; and the bifunctional Escherichia coli folD protein [, ]. Methylene-tetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclo-hydrolase share an overlapping active site [], and as such are usually located together in proteins, acting in tandem on the carbon-nitrogen bonds of substrates other than peptide bonds. This entry represents the NAD(P)-binding domain found in these enzymes.; GO: 0003824 catalytic activity, 0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity, 0009396 folic acid-containing compound biosynthetic process, 0055114 oxidation-reduction process; PDB: 1B0A_A 2C2X_B 2C2Y_A 3NGL_C 3NGX_A 4A26_B 1EDZ_A 1EE9_A 3P2O_B 1DIA_A .... Probab=20.68 E-value=57 Score=21.61 Aligned_cols=33 Identities=21% Similarity=0.282 Sum_probs=20.6 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) .+|+++-++|.+..+. -+.+++|..++=+|... T Consensus 79 ~ADIVVsa~G~~~~i~--~~~ik~gavVIDvG~~~ 111 (160) T PF02882_consen 79 RADIVVSAVGKPNLIK--ADWIKPGAVVIDVGINY 111 (160) T ss_dssp TSSEEEE-SSSTT-B---GGGS-TTEEEEE--CEE T ss_pred eccEEeeeeccccccc--cccccCCcEEEecCCcc Confidence 5899999999986654 34788987777677653 No 388 >COG4123 Predicted O-methyltransferase [General function prediction only] Probab=20.67 E-value=1.4e+02 Score=21.40 Aligned_cols=24 Identities=13% Similarity=0.270 Sum_probs=19.8 Q ss_pred hHHHHHHHHHhccCCCEEEEecCC Q 034260 14 LNKTMSTVLDATRAGDKVCLVGMG 37 (100) Q Consensus 14 ~~~~~~~al~~l~~gGrvv~vG~~ 37 (100) ..+.++.|-++++++|++.+|--+ T Consensus 149 le~~i~~a~~~lk~~G~l~~V~r~ 172 (248) T COG4123 149 LEDLIRAAAKLLKPGGRLAFVHRP 172 (248) T ss_pred HHHHHHHHHHHccCCCEEEEEecH Confidence 446788899999999999998544 No 389 >PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D .... Probab=20.60 E-value=1.3e+02 Score=18.88 Aligned_cols=38 Identities=16% Similarity=0.169 Sum_probs=15.3 Q ss_pred HHHHHh--ccCCCEEEEecCCCCC-cccCh-HHHHhcCcEEE Q 034260 19 STVLDA--TRAGDKVCLVGMGHHD-MTVPL-TPAAARYLIYG 56 (100) Q Consensus 19 ~~al~~--l~~gGrvv~vG~~~~~-~~i~~-~~l~~k~~~i~ 56 (100) ++.++. +++|=.++++..++.. ..+.. .....++.++. T Consensus 93 ~~~~~~~~~~~gDvli~iS~SG~s~~vi~a~~~Ak~~G~~vI 134 (138) T PF13580_consen 93 RQLLALYDIRPGDVLIVISNSGNSPNVIEAAEEAKERGMKVI 134 (138) T ss_dssp HHHHHHTT--TT-EEEEEESSS-SHHHHHHHHHHHHTT-EEE T ss_pred HHHHHHcCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE Confidence 344444 5666666666655542 22222 22334555554 No 390 >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Probab=20.56 E-value=1.4e+02 Score=24.90 Aligned_cols=27 Identities=26% Similarity=0.250 Sum_probs=19.6 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEE Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKV 31 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrv 31 (100) .|+++||++.........++++.|=.+ T Consensus 548 ~~vvvd~t~~~~~~~~~~~al~~g~~V 574 (819) T PRK09436 548 NPVIVDCTSSQAVADQYADFLAAGFHV 574 (819) T ss_pred CCEEEECCCChHHHHHHHHHHHcCCEE Confidence 589999999877666666666655333 No 391 >PRK07269 cystathionine gamma-synthase; Reviewed Probab=20.35 E-value=2.1e+02 Score=21.15 Aligned_cols=32 Identities=16% Similarity=0.168 Sum_probs=23.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEec Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVG 35 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG 35 (100) |.+.++-+.+..+++..++.++++|.++++.. T Consensus 68 g~~~~v~~~sG~aAi~~~l~~l~~GD~VI~~~ 99 (364) T PRK07269 68 SADYALATSSGMSAIVLAFSVFPVGSKVVAVR 99 (364) T ss_pred CCCeEEEeCCHHHHHHHHHHHhCCCCEEEEec Confidence 34556666666778888888889998888663 No 392 >PLN02700 homoserine dehydrogenase family protein Probab=20.22 E-value=1.6e+02 Score=22.34 Aligned_cols=27 Identities=22% Similarity=0.258 Sum_probs=18.7 Q ss_pred ccEEEEccChHHHHHHHHHhccCCCEE Q 034260 5 IDVSFDCAGLNKTMSTVLDATRAGDKV 31 (100) Q Consensus 5 ~D~vie~~G~~~~~~~al~~l~~gGrv 31 (100) .++++||+++..+.+...++++.|=.| T Consensus 110 ~~ViVD~T~s~~~~~~y~~aL~~G~hV 136 (377) T PLN02700 110 GLVVVDCSASMETIGALNEAVDLGCCI 136 (377) T ss_pred CCEEEECCCChHHHHHHHHHHHCCCeE Confidence 589999999876665555666655333 No 393 >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Probab=20.16 E-value=88 Score=22.85 Aligned_cols=34 Identities=18% Similarity=0.331 Sum_probs=26.9 Q ss_pred CcccEEEEccChHHHHHHHHHhccCCCEEEEecCCC Q 034260 3 AGIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGH 38 (100) Q Consensus 3 ~G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~ 38 (100) +.+|+++-|+|.+..+. -+++++|..++=+|... T Consensus 206 ~~ADIvv~AvG~p~~i~--~~~vk~gavVIDvGin~ 239 (287) T PRK14176 206 LDADILVVATGVKHLIK--ADMVKEGAVIFDVGITK 239 (287) T ss_pred hhCCEEEEccCCccccC--HHHcCCCcEEEEecccc Confidence 35899999999987664 35899998888888753 No 394 >PF01951 Archease: Archease protein family (MTH1598/TM1083); InterPro: IPR023572 The archease superfamily of proteins are represented in all three domains of life. Archease genes are generally located adjacent to genes encoding proteins involved in DNA or RNA processing and therefore been predicted to be modulators or chaperones involved in DNA or RNA metabolism. Many of the roles of archeases remain to be established experimentally. The function of one of the archeases from the hyperthermophile Pyrococcus abyssi has been determined. The gene encoding the archease (PAB1946) is located in a bicistronic operon immediately upstream from a second open reading frame (PAB1947), which encodes a tRNA m5C methyltransferase. The methyl transferase catalyses m5C formation at several cytosine's within tRNAs with preference for C49; the specificity of the methyltransferase reaction being increased by the archease. The archease exists in monomeric and oligomeric states, with only the oligomeric forms able to bind the methyltransferase. Binding prevents aggregation and hinders dimerisation of the methyltransferase-tRNA complex []. The function of this family of archeases as chaperones is supported by structural analysis of O27635 from SWISSPROT from Methanobacterium thermoautotrophicum, which shows homology to heat shock protein 33, which is a chaperone protein that inhibits the aggregation of partially denatured proteins []. Structurally, the archeases are composed of a single three layer beta-alpha-beta sandwich domain similar to those found in other chaperones.; PDB: 1J5U_A 1JW3_A. Probab=20.14 E-value=73 Score=20.29 Aligned_cols=25 Identities=12% Similarity=0.145 Sum_probs=14.9 Q ss_pred CCCcccEEEEccChH--HHHHHHHHhc Q 034260 1 MGAGIDVSFDCAGLN--KTMSTVLDAT 25 (100) Q Consensus 1 ~G~G~D~vie~~G~~--~~~~~al~~l 25 (100) +.+.+|+.|++.|.. ..+++|..++ T Consensus 4 ldHtADi~i~~~G~sleelf~~aa~al 30 (137) T PF01951_consen 4 LDHTADIGIEAWGDSLEELFENAALAL 30 (137) T ss_dssp ---SSEEEEEEEESSCHHHHHHHHHHH T ss_pred cCccccEEEEEEECCHHHHHHHHHHHH Confidence 356799999999964 3444444433 No 395 >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type. This enzyme, a homolog of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric, NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other Archaea. For a number of close homologs, scoring between trusted and noise cutoffs, it is not clear at present what is the enzymatic activity. Probab=20.01 E-value=1.3e+02 Score=21.97 Aligned_cols=42 Identities=14% Similarity=0.181 Sum_probs=29.5 Q ss_pred cccEEEEccChHHHHHHHHHhccCCCEEEEecCCCC-CcccChH Q 034260 4 GIDVSFDCAGLNKTMSTVLDATRAGDKVCLVGMGHH-DMTVPLT 46 (100) Q Consensus 4 G~D~vie~~G~~~~~~~al~~l~~gGrvv~vG~~~~-~~~i~~~ 46 (100) ++|+|+-|+.+...+- --+.+++|-.+..+|...+ ..+++.. T Consensus 192 ~aDiVitaT~s~~P~~-~~~~l~~g~~v~~vGs~~p~~~Eld~~ 234 (325) T TIGR02371 192 GCDILVTTTPSRKPVV-KADWVSEGTHINAIGADAPGKQELDPE 234 (325) T ss_pred cCCEEEEecCCCCcEe-cHHHcCCCCEEEecCCCCcccccCCHH Confidence 6899999998754321 2346799999999997754 3456654 Done!