BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034275
         (99 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZKZ|A Chain A, Crystal Structure Of The Transcriptional Repressor Pagr
          Of Bacillus Anthracis
 pdb|2ZKZ|B Chain B, Crystal Structure Of The Transcriptional Repressor Pagr
          Of Bacillus Anthracis
 pdb|2ZKZ|C Chain C, Crystal Structure Of The Transcriptional Repressor Pagr
          Of Bacillus Anthracis
 pdb|2ZKZ|D Chain D, Crystal Structure Of The Transcriptional Repressor Pagr
          Of Bacillus Anthracis
          Length = 99

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 33 VREYTKRRAIDGFRENQNLTDPES-ISSAYAEGKNQLAIAKRQA--VVYSLYAPKVKSIM 89
          V E  K +A++  +  Q L  P+S +S    + + ++    RQ   + YS+  PKV+ I+
Sbjct: 33 VNELYKHKALNVTQIIQILKLPQSTVSQHLCKXRGKVLKRNRQGLEIYYSINNPKVEGII 92

Query: 90 ELENP 94
          +L NP
Sbjct: 93 KLLNP 97


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.360 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,524,158
Number of Sequences: 62578
Number of extensions: 76444
Number of successful extensions: 75
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 75
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 14,973,337
effective HSP length: 65
effective length of query: 34
effective length of database: 10,905,767
effective search space: 370796078
effective search space used: 370796078
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)