Citrus Sinensis ID: 034275


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MVSPGQAAPIRPEILGLYRALLRAAREFRDYNVREYTKRRAIDGFRENQNLTDPESISSAYAEGKNQLAIAKRQAVVYSLYAPKVKSIMELENPADLIN
ccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEECccccccccc
***********PEILGLYRALLRAAREFRDYNVREYTKRRAIDGFRE***********SAYAEGKNQLAIAKRQAVVYSLYAPKVKSIM**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSPGQAAPIRPEILGLYRALLRAAREFRDYNVREYTKRRAIDGFRENQNLTDPESISSAYAEGKNQLAIAKRQAVVYSLYAPKVKSIMELENPADLIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LYR motif-containing protein 4 Required for nuclear and mitochondrial iron-sulfur protein biosynthesis.probableQ0VCG0
LYR motif-containing protein 4 Required for nuclear and mitochondrial iron-sulfur protein biosynthesis.probableB5FZA8
LYR motif-containing protein 4 Required for nuclear and mitochondrial iron-sulfur protein biosynthesis.probableQ8K215

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B6X, chain A
Confidence level:probable
Coverage over the Query: 33-79
View the alignment between query and template
View the model in PyMOL