Citrus Sinensis ID: 034299


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSGGPGLESLVEQQISVITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRGDNISIVGEVDEELDSHLDLSNLRAHPLKPVIH
cccccccHHHcccEEEEEEccccEEEEEEEEEEccccEEEEcCEEEEEEcccccEEEEEEEEEEEcccEEEEEEEccccccccccccccccccccccc
****PGLESLVEQQISVITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRGDNISIVGEVDEELDSHLDLSNLRAHPLK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGGPGLESLVEQQISVITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRGDNISIVGEVDEELDSHLDLSNLRAHPLKPVIH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-alpha-acetyltransferase 38, NatC auxiliary subunit Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableO95777
N-alpha-acetyltransferase 38, NatC auxiliary subunit Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ6ZWM4
N-alpha-acetyltransferase 38, NatC auxiliary subunit Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ3ZCE0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D3B, chain B
Confidence level:very confident
Coverage over the Query: 5-78
View the alignment between query and template
View the model in PyMOL