BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034302
(98 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FFT|A Chain A, Nmr Structure Of Spinach Thylakoid Soluble
Phosphoprotein Of 9 Kda In Sds Micelles
Length = 84
Score = 62.8 bits (151), Expect = 5e-11, Method: Compositional matrix adjust.
Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 4/68 (5%)
Query: 20 TAAKEAGGSKEEKSLLDWILGGMQKQDQFYETDPILK--KVEDKSPPSGR--GTTNGRKN 75
+AAK +K+EKS +DW+LG + K+DQFYETDPIL+ V+ SG+ GTT+G+K
Sbjct: 1 SAAKGTAETKQEKSFVDWLLGKITKEDQFYETDPILRGGDVKSSGSTSGKKGGTTSGKKG 60
Query: 76 SASVPQPQ 83
+ S+P +
Sbjct: 61 TVSIPSKK 68
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.308 0.126 0.357
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,606,550
Number of Sequences: 62578
Number of extensions: 90565
Number of successful extensions: 114
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 112
Number of HSP's gapped (non-prelim): 3
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)