BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034326
         (98 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1G40|A Chain A, Crystal Structure Of A Complement Protein That Regulates
          Both Pathways Of Complement Activation And Binds
          Heparan Sulfate Proteoglycans
 pdb|1G40|B Chain B, Crystal Structure Of A Complement Protein That Regulates
          Both Pathways Of Complement Activation And Binds
          Heparan Sulfate Proteoglycans
 pdb|1G44|A Chain A, Crystal Structure Of A Complement Control Protein That
          Regulates Both Pathways Of Complement Activation And
          Binds Heparan Sulfate Proteoglycans
 pdb|1G44|B Chain B, Crystal Structure Of A Complement Control Protein That
          Regulates Both Pathways Of Complement Activation And
          Binds Heparan Sulfate Proteoglycans
 pdb|1G44|C Chain C, Crystal Structure Of A Complement Control Protein That
          Regulates Both Pathways Of Complement Activation And
          Binds Heparan Sulfate Proteoglycans
 pdb|1RID|A Chain A, Vaccinia Complement Protein In Complex With Heparin
 pdb|1RID|B Chain B, Vaccinia Complement Protein In Complex With Heparin
 pdb|1Y8E|A Chain A, Vcp:suramin Complex
 pdb|1Y8E|B Chain B, Vcp:suramin Complex
          Length = 244

 Score = 26.2 bits (56), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 13/55 (23%)

Query: 42 LCAPVKQEVEVGIMCESCNGKGWLVCDFCGGQKTNVKAQNNRIYRRCPTCRAVST 96
          LC P  ++ ++G +   C G GW + + C             I RRCP+ R +  
Sbjct: 34 LCLPGYRKQKMGPIYAKCTGTGWTLFNQC-------------IKRRCPSPRDIDN 75


>pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj
          Subfamily A Menber 3
          Length = 104

 Score = 25.4 bits (54), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 8/35 (22%)

Query: 46 VKQEVEVGIM--CESCNGKGW------LVCDFCGG 72
          V +E  V IM  CE CNGKG         C +CGG
Sbjct: 19 VNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGG 53


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.135    0.444 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,262,713
Number of Sequences: 62578
Number of extensions: 63064
Number of successful extensions: 142
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 141
Number of HSP's gapped (non-prelim): 5
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)