BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034332
(97 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4GGO|A Chain A, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|B Chain B, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|C Chain C, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|D Chain D, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
Length = 401
Score = 27.3 bits (59), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGIM K+ L P + +G + DP TG E + + +PA E
Sbjct: 146 YSLASPVRTDPDTGIMHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 197
Query: 88 MLLNHKV 94
KV
Sbjct: 198 AAATVKV 204
>pdb|4FBG|A Chain A, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|B Chain B, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|C Chain C, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|D Chain D, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|E Chain E, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|F Chain F, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|G Chain G, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|H Chain H, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|I Chain I, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|J Chain J, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|K Chain K, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|L Chain L, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|M Chain M, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|N Chain N, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|O Chain O, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|P Chain P, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
Length = 405
Score = 25.8 bits (55), Expect = 5.7, Method: Composition-based stats.
Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGI K+ L P + +G + DP TG E + + +PA E
Sbjct: 142 YSLASPVRTDPDTGIXHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 193
Query: 88 MLLNHKV 94
KV
Sbjct: 194 AAATVKV 200
>pdb|4GGP|A Chain A, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|B Chain B, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|C Chain C, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|D Chain D, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
Length = 401
Score = 25.8 bits (55), Expect = 5.8, Method: Composition-based stats.
Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGI K+ L P + +G + DP TG E + + +PA E
Sbjct: 146 YSLASPVRTDPDTGIXHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 197
Query: 88 MLLNHKV 94
KV
Sbjct: 198 AAATVKV 204
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz
Length = 123
Score = 25.8 bits (55), Expect = 5.8, Method: Compositional matrix adjust.
Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 14/70 (20%)
Query: 18 GISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRA 77
GIS+ +G RG + G + R GI K+ V EDS P G +P +R
Sbjct: 39 GISI-VGGRGMGSRLSNGEVMR-GIFIKH-----VLEDS-------PAGKNGTLKPGDRI 84
Query: 78 VEIDPAELRE 87
VE+D +LR+
Sbjct: 85 VEVDGMDLRD 94
>pdb|1GQO|A Chain A, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|B Chain B, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|C Chain C, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|D Chain D, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|E Chain E, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|F Chain F, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|G Chain G, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|H Chain H, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|I Chain I, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|J Chain J, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|K Chain K, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|L Chain L, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|M Chain M, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|N Chain N, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|O Chain O, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|P Chain P, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|Q Chain Q, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|R Chain R, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|S Chain S, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|T Chain T, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|U Chain U, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|V Chain V, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|X Chain X, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|Y Chain Y, Type Ii Dehydroquinase From Bacillus Subtilis
Length = 143
Score = 25.8 bits (55), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 18/31 (58%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGYAAAA 32
AR F+ + ++APVA G + +G GY A
Sbjct: 105 AREEFRHQSVIAPVAKGQIVGLGAEGYKLAV 135
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz
(Mupp-1)
Length = 103
Score = 25.8 bits (55), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 14/70 (20%)
Query: 18 GISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRA 77
GIS+ +G RG + G + R GI K+ V EDS P G +P +R
Sbjct: 19 GISI-VGGRGMGSRLSNGEVMR-GIFIKH-----VLEDS-------PAGKNGTLKPGDRI 64
Query: 78 VEIDPAELRE 87
VE+D +LR+
Sbjct: 65 VEVDGMDLRD 74
>pdb|3N59|A Chain A, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|B Chain B, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|C Chain C, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|D Chain D, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|E Chain E, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|F Chain F, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|G Chain G, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|H Chain H, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|I Chain I, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|J Chain J, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|K Chain K, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|L Chain L, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|M Chain M, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|N Chain N, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|O Chain O, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|P Chain P, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|Q Chain Q, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|R Chain R, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|S Chain S, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|T Chain T, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|U Chain U, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|V Chain V, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|W Chain W, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|X Chain X, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N8K|A Chain A, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|B Chain B, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|C Chain C, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|D Chain D, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|E Chain E, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|F Chain F, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|G Chain G, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|H Chain H, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|I Chain I, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|J Chain J, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|K Chain K, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|L Chain L, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|M Chain M, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|N Chain N, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|O Chain O, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|P Chain P, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|Q Chain Q, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|R Chain R, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|S Chain S, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|T Chain T, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|U Chain U, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|V Chain V, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|W Chain W, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|X Chain X, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
Length = 172
Score = 25.4 bits (54), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 11/30 (36%), Positives = 18/30 (60%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGYAAA 31
AR F+ L+P+A G+ + +G +GY A
Sbjct: 133 AREEFRRHSYLSPIATGVIVGLGIQGYLLA 162
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.382
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,780,831
Number of Sequences: 62578
Number of extensions: 99724
Number of successful extensions: 224
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 219
Number of HSP's gapped (non-prelim): 14
length of query: 97
length of database: 14,973,337
effective HSP length: 63
effective length of query: 34
effective length of database: 11,030,923
effective search space: 375051382
effective search space used: 375051382
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)