BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034333
         (97 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CLC|A Chain A, Three-Dimensional Structure Of Endoglucanase D At 1.9
           Angstroms Resolution
          Length = 639

 Score = 29.6 bits (65), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%)

Query: 35  YRDIPEDPNSPMESGGDNSKGESGSTGWSDQREYAEEELPLTFSDRAVVRSFSRRAKKFI 94
           Y  +  +P +   +    S GE  +   +D R +A  E+  T  D   +R F  RA +F 
Sbjct: 322 YEFLKNNPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETLGDEEYLRDFENRAAQFS 381

Query: 95  KK 96
           KK
Sbjct: 382 KK 383


>pdb|1HR6|B Chain B, Yeast Mitochondrial Processing Peptidase
 pdb|1HR6|D Chain D, Yeast Mitochondrial Processing Peptidase
 pdb|1HR6|F Chain F, Yeast Mitochondrial Processing Peptidase
 pdb|1HR6|H Chain H, Yeast Mitochondrial Processing Peptidase
          Length = 443

 Score = 25.8 bits (55), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 11  LQAIGSHTNYWRDEDTALFILKHLYRDIPE 40
           ++ IGSH N +   +  ++  K L  DIP+
Sbjct: 73  IENIGSHLNAYTSRENTVYYAKSLQEDIPK 102


>pdb|1HR7|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR7|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR7|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR7|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR8|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR8|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR8|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR8|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR9|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR9|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR9|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR9|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
          Length = 443

 Score = 25.8 bits (55), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 11  LQAIGSHTNYWRDEDTALFILKHLYRDIPE 40
           ++ IGSH N +   +  ++  K L  DIP+
Sbjct: 73  IENIGSHLNAYTSRENTVYYAKSLQEDIPK 102


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.132    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,224,329
Number of Sequences: 62578
Number of extensions: 135044
Number of successful extensions: 264
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 259
Number of HSP's gapped (non-prelim): 5
length of query: 97
length of database: 14,973,337
effective HSP length: 63
effective length of query: 34
effective length of database: 11,030,923
effective search space: 375051382
effective search space used: 375051382
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)