BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034333
(97 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CLC|A Chain A, Three-Dimensional Structure Of Endoglucanase D At 1.9
Angstroms Resolution
Length = 639
Score = 29.6 bits (65), Expect = 0.40, Method: Compositional matrix adjust.
Identities = 18/62 (29%), Positives = 28/62 (45%)
Query: 35 YRDIPEDPNSPMESGGDNSKGESGSTGWSDQREYAEEELPLTFSDRAVVRSFSRRAKKFI 94
Y + +P + + S GE + +D R +A E+ T D +R F RA +F
Sbjct: 322 YEFLKNNPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETLGDEEYLRDFENRAAQFS 381
Query: 95 KK 96
KK
Sbjct: 382 KK 383
>pdb|1HR6|B Chain B, Yeast Mitochondrial Processing Peptidase
pdb|1HR6|D Chain D, Yeast Mitochondrial Processing Peptidase
pdb|1HR6|F Chain F, Yeast Mitochondrial Processing Peptidase
pdb|1HR6|H Chain H, Yeast Mitochondrial Processing Peptidase
Length = 443
Score = 25.8 bits (55), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 10/30 (33%), Positives = 17/30 (56%)
Query: 11 LQAIGSHTNYWRDEDTALFILKHLYRDIPE 40
++ IGSH N + + ++ K L DIP+
Sbjct: 73 IENIGSHLNAYTSRENTVYYAKSLQEDIPK 102
>pdb|1HR7|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
pdb|1HR7|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
pdb|1HR7|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
pdb|1HR7|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
pdb|1HR8|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Cytochrome C Oxidase Iv Signal Peptide
pdb|1HR8|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Cytochrome C Oxidase Iv Signal Peptide
pdb|1HR8|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Cytochrome C Oxidase Iv Signal Peptide
pdb|1HR8|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Cytochrome C Oxidase Iv Signal Peptide
pdb|1HR9|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Malate Dehydrogenase Signal Peptide
pdb|1HR9|D Chain D, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Malate Dehydrogenase Signal Peptide
pdb|1HR9|F Chain F, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Malate Dehydrogenase Signal Peptide
pdb|1HR9|H Chain H, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
Complexed With Malate Dehydrogenase Signal Peptide
Length = 443
Score = 25.8 bits (55), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 10/30 (33%), Positives = 17/30 (56%)
Query: 11 LQAIGSHTNYWRDEDTALFILKHLYRDIPE 40
++ IGSH N + + ++ K L DIP+
Sbjct: 73 IENIGSHLNAYTSRENTVYYAKSLQEDIPK 102
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.132 0.394
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,224,329
Number of Sequences: 62578
Number of extensions: 135044
Number of successful extensions: 264
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 259
Number of HSP's gapped (non-prelim): 5
length of query: 97
length of database: 14,973,337
effective HSP length: 63
effective length of query: 34
effective length of database: 11,030,923
effective search space: 375051382
effective search space used: 375051382
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)