BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034357
(97 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4GGO|A Chain A, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|B Chain B, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|C Chain C, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
pdb|4GGO|D Chain D, Crystal Structure Of Trans-2-Enoyl-Coa Reductase From
Treponema Denticola
Length = 401
Score = 26.9 bits (58), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 8/60 (13%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGIM K+ L P + +G + DP TG E + + +PA E
Sbjct: 146 YSLASPVRTDPDTGIMHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 197
>pdb|1GQO|A Chain A, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|B Chain B, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|C Chain C, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|D Chain D, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|E Chain E, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|F Chain F, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|G Chain G, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|H Chain H, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|I Chain I, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|J Chain J, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|K Chain K, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|L Chain L, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|M Chain M, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|N Chain N, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|O Chain O, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|P Chain P, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|Q Chain Q, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|R Chain R, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|S Chain S, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|T Chain T, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|U Chain U, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|V Chain V, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|X Chain X, Type Ii Dehydroquinase From Bacillus Subtilis
pdb|1GQO|Y Chain Y, Type Ii Dehydroquinase From Bacillus Subtilis
Length = 143
Score = 26.2 bits (56), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 18/31 (58%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGYAAAA 32
AR F+ + ++APVA G + +G GY A
Sbjct: 105 AREEFRHQSVIAPVAKGQIVGLGAEGYKLAV 135
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz
Length = 123
Score = 26.2 bits (56), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 14/70 (20%)
Query: 18 GISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRA 77
GIS+ +G RG + G + R GI K+ V EDS P G +P +R
Sbjct: 39 GISI-VGGRGMGSRLSNGEVMR-GIFIKH-----VLEDS-------PAGKNGTLKPGDRI 84
Query: 78 VEIDPAELRE 87
VE+D +LR+
Sbjct: 85 VEVDGMDLRD 94
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz
(Mupp-1)
Length = 103
Score = 25.8 bits (55), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 14/70 (20%)
Query: 18 GISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRA 77
GIS+ +G RG + G + R GI K+ V EDS P G +P +R
Sbjct: 19 GISI-VGGRGMGSRLSNGEVMR-GIFIKH-----VLEDS-------PAGKNGTLKPGDRI 64
Query: 78 VEIDPAELRE 87
VE+D +LR+
Sbjct: 65 VEVDGMDLRD 74
>pdb|4FBG|A Chain A, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|B Chain B, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|C Chain C, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|D Chain D, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|E Chain E, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|F Chain F, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|G Chain G, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|H Chain H, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|I Chain I, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|J Chain J, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|K Chain K, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|L Chain L, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|M Chain M, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|N Chain N, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|O Chain O, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
pdb|4FBG|P Chain P, Crystal Structure Of Treponema Denticola Trans-2-Enoyl-Coa
Reductase In Complex With Nad
Length = 405
Score = 25.8 bits (55), Expect = 7.0, Method: Composition-based stats.
Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGI K+ L P + +G + DP TG E + + +PA E
Sbjct: 142 YSLASPVRTDPDTGIXHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 193
>pdb|4GGP|A Chain A, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|B Chain B, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|C Chain C, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
pdb|4GGP|D Chain D, Crystal Structure Of Selenomethionine Containing
Trans-2-Enoyl-Coa Reductase From Treponema Denticola
Length = 401
Score = 25.8 bits (55), Expect = 7.4, Method: Composition-based stats.
Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)
Query: 28 YAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELRE 87
Y+ A+P+ T TGI K+ L P + +G + DP TG E + + +PA E
Sbjct: 146 YSLASPVRTDPDTGIXHKSVLKPFGKTFTGKTV----DPFTG----ELKEISAEPANDEE 197
>pdb|3N59|A Chain A, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|B Chain B, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|C Chain C, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|D Chain D, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|E Chain E, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|F Chain F, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|G Chain G, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|H Chain H, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|I Chain I, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|J Chain J, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|K Chain K, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|L Chain L, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|M Chain M, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|N Chain N, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|O Chain O, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|P Chain P, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|Q Chain Q, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|R Chain R, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|S Chain S, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|T Chain T, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|U Chain U, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|V Chain V, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|W Chain W, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N59|X Chain X, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 3-Dehydroshikimate
pdb|3N8K|A Chain A, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|B Chain B, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|C Chain C, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|D Chain D, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|E Chain E, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|F Chain F, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|G Chain G, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|H Chain H, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|I Chain I, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|J Chain J, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|K Chain K, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|L Chain L, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|M Chain M, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|N Chain N, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|O Chain O, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|P Chain P, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|Q Chain Q, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|R Chain R, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|S Chain S, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|T Chain T, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|U Chain U, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|V Chain V, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|W Chain W, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
pdb|3N8K|X Chain X, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With Citrazinic Acid
Length = 172
Score = 25.4 bits (54), Expect = 8.8, Method: Compositional matrix adjust.
Identities = 11/30 (36%), Positives = 18/30 (60%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGYAAA 31
AR F+ L+P+A G+ + +G +GY A
Sbjct: 133 AREEFRRHSYLSPIATGVIVGLGIQGYLLA 162
>pdb|3N76|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Compound 5
pdb|3N7A|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|B Chain B, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|C Chain C, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|D Chain D, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|E Chain E, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|F Chain F, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|G Chain G, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|H Chain H, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|I Chain I, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|J Chain J, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|K Chain K, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|L Chain L, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|M Chain M, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|N Chain N, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|O Chain O, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|P Chain P, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|Q Chain Q, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|R Chain R, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|S Chain S, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|T Chain T, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|U Chain U, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|V Chain V, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|W Chain W, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N7A|X Chain X, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 2
pdb|3N86|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|B Chain B, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|C Chain C, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|D Chain D, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|E Chain E, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|F Chain F, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|G Chain G, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|H Chain H, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|I Chain I, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|J Chain J, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|K Chain K, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|L Chain L, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|M Chain M, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|N Chain N, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|O Chain O, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|P Chain P, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|Q Chain Q, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|R Chain R, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|S Chain S, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|T Chain T, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|U Chain U, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|V Chain V, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|W Chain W, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N86|X Chain X, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 4
pdb|3N87|A Chain A, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|B Chain B, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|C Chain C, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|D Chain D, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|E Chain E, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|F Chain F, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|G Chain G, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|H Chain H, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|I Chain I, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|J Chain J, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|K Chain K, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|L Chain L, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|M Chain M, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|N Chain N, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|O Chain O, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|P Chain P, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|Q Chain Q, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|R Chain R, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|S Chain S, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|T Chain T, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|U Chain U, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|V Chain V, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|W Chain W, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N87|X Chain X, Crystal Structure Of 3-dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 3
pdb|3N8N|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|B Chain B, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|C Chain C, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|D Chain D, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|E Chain E, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|F Chain F, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|G Chain G, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|H Chain H, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|I Chain I, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|J Chain J, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|K Chain K, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|L Chain L, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|M Chain M, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|N Chain N, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|O Chain O, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|P Chain P, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|Q Chain Q, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|R Chain R, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|S Chain S, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|T Chain T, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|U Chain U, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|V Chain V, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|W Chain W, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
pdb|3N8N|X Chain X, Crystal Structure Of 3-Dehydroquinate Dehydratase From
Mycobacterium Tuberculosis In Complex With Inhibitor 6
Length = 147
Score = 25.4 bits (54), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 10/27 (37%), Positives = 17/27 (62%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGY 28
AR F+ L+P+A G+ + +G +GY
Sbjct: 108 AREEFRRHSYLSPIATGVIVGLGIQGY 134
>pdb|2DHQ|A Chain A, 3-Dehydroquinate Dehydratase From Mycobacterium
Tuberculosis
pdb|1H05|A Chain A, 3-Dehydroquinate Dehydratase From Mycobacterium
Tuberculosis In Complex With Sulphate
pdb|1H0S|A Chain A, 3-Dehydroquinate Dehydratase From Mycobacterium
Tuberculosis In Complex With 3-Hydroxyimino-Quinic Acid
pdb|1H0R|A Chain A, Type Ii Dehydroquinase From Mycobacterium Tuberculosis
Complexed With 2,3-Anhydro-Quinic Acid
pdb|2XB8|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase In Complex With Inhibitor Compound
(2r)-2-( 4-Methoxybenzyl)-3-Dehydroquinic Acid
pdb|2Y71|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Complexed With
(1r,4s,5r)-1,4,5-Trihydroxy-
3-((5-Methylbenzo(B)thiophen-2-Yl)methoxy)cyclohex-2-
Enecarboxylate
pdb|2Y76|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Complexed With (1r,4s,5r)-3-(Benzo(B)
Thiophen-5-Ylmethoxy)-2-(Benzo(B)thiophen-5-Ylmethyl)-1,
4, 5-Trihydroxycyclohex-2-Enecarboxylate
pdb|2Y77|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Complexed With (1r,4s,5r)-3-(Benzo(B)
Thiophen-2-Ylmethoxy)-1,4,5-Trihydroxy-2-(Thiophen-2-
Ylmethyl)cyclohex-2-Enecarboxylate
pdb|4B6O|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Inhibited By (2s)-2-(4-Methoxy)benzyl-3-
Dehydroquinic Acid
pdb|4B6P|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Inhibited By (2s)-2-Perfluorobenzyl-3-
Dehydroquinic Acid
pdb|4B6Q|A Chain A, Structure Of Mycobacterium Tuberculosis Type Ii
Dehydroquinase Inhibited By (2r)-2-(Benzothiophen-5-Yl)
Methyl-3-Dehydroquinic Acid
Length = 146
Score = 25.4 bits (54), Expect = 9.1, Method: Compositional matrix adjust.
Identities = 10/27 (37%), Positives = 17/27 (62%)
Query: 2 ARSLFKAKLLLAPVADGISLSIGRRGY 28
AR F+ L+P+A G+ + +G +GY
Sbjct: 107 AREEFRRHSYLSPIATGVIVGLGIQGY 133
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.133 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,801,073
Number of Sequences: 62578
Number of extensions: 100253
Number of successful extensions: 226
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 221
Number of HSP's gapped (non-prelim): 14
length of query: 97
length of database: 14,973,337
effective HSP length: 63
effective length of query: 34
effective length of database: 11,030,923
effective search space: 375051382
effective search space used: 375051382
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)