Query         034358
Match_columns 97
No_of_seqs    94 out of 96
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 12:35:50 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034358.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034358hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03242 LEA_3:  Late embryogen 100.0 5.8E-43 1.3E-47  240.2   6.7   91    1-91      1-93  (93)
  2 PF02736 Myosin_N:  Myosin N-te  84.0    0.32 6.9E-06   28.5  -0.0   13   59-71      2-14  (42)
  3 PF09996 DUF2237:  Uncharacteri  69.4       2 4.4E-05   31.1   0.7   10   64-73     14-23  (117)
  4 COG3651 Uncharacterized protei  68.8     1.8 3.9E-05   31.5   0.3   10   63-72     20-29  (125)
  5 PRK09936 hypothetical protein;  51.3     9.2  0.0002   31.5   1.5   26   65-90    133-159 (296)
  6 PF10500 SR-25:  Nuclear RNA-sp  50.5     5.9 0.00013   31.6   0.3   22   59-80    171-192 (225)
  7 PF10948 DUF2635:  Protein of u  48.3      19 0.00041   22.1   2.2   16   62-77      8-23  (47)
  8 smart00265 BH4 BH4 Bcl-2 homol  36.5      24 0.00051   19.6   1.2   17   13-29      7-23  (27)
  9 PF02180 BH4:  Bcl-2 homology r  35.6      30 0.00066   19.2   1.6   17   13-29      7-23  (27)
 10 PF03195 DUF260:  Protein of un  33.0      17 0.00036   25.2   0.3   16   60-75     66-81  (101)
 11 COG4953 PbpC Membrane carboxyp  30.6      31 0.00066   31.8   1.6   27   67-93    365-392 (733)
 12 TIGR03054 photo_alph_chp1 puta  30.1      30 0.00065   25.3   1.3   25   63-87    109-133 (135)
 13 PF09803 DUF2346:  Uncharacteri  28.8      20 0.00044   23.9   0.2   32   62-93     34-65  (80)
 14 TIGR02697 WPE_wolbac Wolbachia  28.2      26 0.00055   20.8   0.5   11   66-76      3-13  (36)
 15 PF12230 PRP21_like_P:  Pre-mRN  27.9      20 0.00043   27.1   0.0   35   59-93    165-207 (229)
 16 PF13405 EF-hand_6:  EF-hand do  26.9      41 0.00089   17.5   1.1   17   74-90     11-27  (31)
 17 PF07886 BA14K:  BA14K-like pro  26.0      39 0.00085   19.1   1.0   12   65-76     14-25  (31)
 18 PF12904 Collagen_bind_2:  Puta  26.0      19 0.00041   24.6  -0.4   16   59-75     50-65  (93)
 19 COG3375 Uncharacterized conser  25.6      41  0.0009   27.5   1.4   13   63-75    178-190 (266)
 20 PF07846 Metallothio_Cad:  Meta  24.5      35 0.00076   18.1   0.6    8   63-70     11-18  (21)
 21 PHA00542 putative Cro-like pro  24.4      71  0.0015   20.6   2.2   26   66-93      6-31  (82)
 22 PRK13750 replication protein;   22.5      33 0.00071   28.3   0.3   16   59-76    133-148 (285)
 23 PF13597 NRDD:  Anaerobic ribon  21.8      42 0.00091   29.0   0.9   25   65-89    519-543 (546)
 24 COG4982 3-oxoacyl-[acyl-carrie  21.4      91   0.002   29.2   2.9   29   60-89    762-790 (866)
 25 PF14785 MalF_P2:  Maltose tran  21.4      27 0.00059   26.3  -0.3   21   59-79    129-149 (164)
 26 cd04711 BAH_Dnmt1_II BAH, or B  20.9      23  0.0005   26.2  -0.8   13   70-82     57-69  (137)
 27 COG3323 Uncharacterized protei  20.9      39 0.00084   24.3   0.4   19   59-78     37-55  (109)
 28 KOG2870 NADH:ubiquinone oxidor  20.1      44 0.00095   28.9   0.6   20   60-79     37-56  (452)

No 1  
>PF03242 LEA_3:  Late embryogenesis abundant protein;  InterPro: IPR004926  Late-embryogenesis abundant (LEA) genes encode a diverse group of proteins that accumulate to high levels during the maturation phase of seed development [].  This group includes LEA-5 [], whose expression is induced by salt, drought and heat stress [], and related proteins. ; GO: 0006950 response to stress
Probab=100.00  E-value=5.8e-43  Score=240.17  Aligned_cols=91  Identities=54%  Similarity=0.756  Sum_probs=73.7

Q ss_pred             CchhhHHHHHHHHHHHhhhhHhhhhhhhhhhcccC--ccccccccccccCCcccccccCCccccccCCCCcccccCCCCC
Q 034358            1 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLG--TISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAV   78 (97)
Q Consensus         1 MARs~snak~lsalv~d~~sl~~~RRgYAAAa~~~--~~~~~g~~~~~~~~~~~~~~~~~~~~W~pDP~TG~y~Pen~~~   78 (97)
                      |||||+|+|+||+||+|+++++++||||+|+++..  +..+.+.+....+....++..++++|||||||||||||||||+
T Consensus         1 MArsls~ak~lsal~~~~~s~~~~rRgYaaaA~~~~~sa~r~g~~~~~~~~~~~~~~~~~~~~W~pDPvTGyyrPen~~~   80 (93)
T PF03242_consen    1 MARSLSNAKVLSALVSDAFSSLISRRGYAAAAAAVRSSAARGGAAGKAKMASKAGEDSKEKSSWMPDPVTGYYRPENHFG   80 (93)
T ss_pred             CchhHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHhhcccccccccchhhhhcccccccccccccCCCCccccCCCCCC
Confidence            99999999999999999999999999999998851  1112222222223333344567799999999999999999999


Q ss_pred             CCCHHHHHHHHhc
Q 034358           79 EIDPAELREMLLN   91 (97)
Q Consensus        79 e~D~aelR~~lL~   91 (97)
                      |||+||||++||+
T Consensus        81 EiD~AeLR~~lL~   93 (93)
T PF03242_consen   81 EIDAAELRAKLLK   93 (93)
T ss_pred             CCCHHHHHHHHhC
Confidence            9999999999996


No 2  
>PF02736 Myosin_N:  Myosin N-terminal SH3-like domain;  InterPro: IPR004009 This domain has an SH3-like fold. It is found at the N terminus of many but not all myosins. The function of this domain is unknown.; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 2EC6_A 2W4H_M 1O1E_P 1O1D_D 1O18_A 1O1C_P 1O1B_D 1O1F_A 2W4A_M 2W4G_M ....
Probab=83.96  E-value=0.32  Score=28.47  Aligned_cols=13  Identities=38%  Similarity=1.012  Sum_probs=10.5

Q ss_pred             ccccccCCCCccc
Q 034358           59 SSAWAPDPITGYY   71 (97)
Q Consensus        59 ~~~W~pDP~TG~y   71 (97)
                      +.-|+|||..||=
T Consensus         2 ~~vWvpD~~egfv   14 (42)
T PF02736_consen    2 KWVWVPDPKEGFV   14 (42)
T ss_dssp             TEEEEEESSSSEE
T ss_pred             CEEEEeCCcccEE
Confidence            3459999999984


No 3  
>PF09996 DUF2237:  Uncharacterized protein conserved in bacteria (DUF2237);  InterPro: IPR018714 This family of hypothetical proteins has no known function.; PDB: 2LQ3_A 3USH_B.
Probab=69.38  E-value=2  Score=31.11  Aligned_cols=10  Identities=60%  Similarity=1.361  Sum_probs=7.7

Q ss_pred             cCCCCccccc
Q 034358           64 PDPITGYYRP   73 (97)
Q Consensus        64 pDP~TG~y~P   73 (97)
                      .||.|||||=
T Consensus        14 ~~P~TGf~Rd   23 (117)
T PF09996_consen   14 TDPMTGFYRD   23 (117)
T ss_dssp             TTTT-STTSS
T ss_pred             CCCCcccccC
Confidence            5999999993


No 4  
>COG3651 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.77  E-value=1.8  Score=31.54  Aligned_cols=10  Identities=60%  Similarity=1.411  Sum_probs=8.8

Q ss_pred             ccCCCCcccc
Q 034358           63 APDPITGYYR   72 (97)
Q Consensus        63 ~pDP~TG~y~   72 (97)
                      --||+||+||
T Consensus        20 ~~dPlTGFYR   29 (125)
T COG3651          20 CTDPLTGFYR   29 (125)
T ss_pred             cCCcchhhhc
Confidence            4599999999


No 5  
>PRK09936 hypothetical protein; Provisional
Probab=51.34  E-value=9.2  Score=31.48  Aligned_cols=26  Identities=27%  Similarity=0.451  Sum_probs=16.3

Q ss_pred             CCCCcccccCCCCC-CCCHHHHHHHHh
Q 034358           65 DPITGYYRPENRAV-EIDPAELREMLL   90 (97)
Q Consensus        65 DP~TG~y~Pen~~~-e~D~aelR~~lL   90 (97)
                      =|++|||+|..--. .-..++-|+.|+
T Consensus       133 ~~v~GWYiP~ElDd~~W~~~~rR~~L~  159 (296)
T PRK09936        133 VPVDGWYLPAELDDLNWRDEARRQPLL  159 (296)
T ss_pred             CCCCeEEeeeccchhcccCHHHHHHHH
Confidence            46799999964421 111266677777


No 6  
>PF10500 SR-25:  Nuclear RNA-splicing-associated protein;  InterPro: IPR019532  SR-25, otherwise known as ADP-ribosylation factor-like factor 6-interacting protein 4, is expressed in virtually all tissue types. At the N terminus there is a repeat of serine-arginine (SR repeat), and towards the middle of the protein there are clusters of both serines and of basic amino acids. The presence of many nuclear localisation signals strongly implies that this is a nuclear protein that may contribute to RNA splicing []. SR-25 is also implicated, along with heat-shock-protein-27, as a mediator in the Rac1 (GTPase ras-related C3 botulinum toxin substrate 1; also see IPR019093 from INTERPRO) signalling pathway [].
Probab=50.48  E-value=5.9  Score=31.55  Aligned_cols=22  Identities=32%  Similarity=0.181  Sum_probs=18.9

Q ss_pred             ccccccCCCCcccccCCCCCCC
Q 034358           59 SSAWAPDPITGYYRPENRAVEI   80 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen~~~e~   80 (97)
                      -+-||-||+||-+|=....+||
T Consensus       171 vIRrVvDpETGRtRLIkGdGEi  192 (225)
T PF10500_consen  171 VIRRVVDPETGRTRLIKGDGEI  192 (225)
T ss_pred             hheeeecCCCCceeeecccchH
Confidence            3559999999999999888876


No 7  
>PF10948 DUF2635:  Protein of unknown function (DUF2635);  InterPro: IPR024400 This family consists of uncharacterised proteins found in bacteria and bacteriophages. It includes protein Gp38 from Enterobacteria phage Mu.
Probab=48.28  E-value=19  Score=22.08  Aligned_cols=16  Identities=31%  Similarity=0.358  Sum_probs=13.0

Q ss_pred             cccCCCCcccccCCCC
Q 034358           62 WAPDPITGYYRPENRA   77 (97)
Q Consensus        62 W~pDP~TG~y~Pen~~   77 (97)
                      =||||.||-+.|+...
T Consensus         8 ~VrdP~~g~~Lp~eG~   23 (47)
T PF10948_consen    8 SVRDPDTGQLLPAEGE   23 (47)
T ss_pred             CcCCCCCCCccCcccc
Confidence            3789999999988763


No 8  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=36.54  E-value=24  Score=19.59  Aligned_cols=17  Identities=24%  Similarity=0.511  Sum_probs=14.5

Q ss_pred             HHHHhhhhHhhhhhhhh
Q 034358           13 APVADGISLSIGRRGYA   29 (97)
Q Consensus        13 alv~d~~sl~~~RRgYA   29 (97)
                      .||.|-++--|++|||.
T Consensus         7 elV~~yv~yKLsQrgy~   23 (27)
T smart00265        7 ELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             HHHHHHHHHHHhhcCCC
Confidence            47889888889999995


No 9  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=35.59  E-value=30  Score=19.22  Aligned_cols=17  Identities=41%  Similarity=0.628  Sum_probs=14.6

Q ss_pred             HHHHhhhhHhhhhhhhh
Q 034358           13 APVADGISLSIGRRGYA   29 (97)
Q Consensus        13 alv~d~~sl~~~RRgYA   29 (97)
                      .||.|-++--|++|||.
T Consensus         7 ~lV~~yi~yKLsQrgy~   23 (27)
T PF02180_consen    7 ELVEDYISYKLSQRGYV   23 (27)
T ss_dssp             HHHHHHHHHHHHHTTST
T ss_pred             HHHHHHHHHHhhhcCCC
Confidence            47889888889999995


No 10 
>PF03195 DUF260:  Protein of unknown function DUF260;  InterPro: IPR004883 The lateral organ boundaries (LOB) gene is expressed at the adaxial base of initiating lateral organs and encodes a plant-specific protein of unknown function. The N-terminal one half of the LOB protein contains a conserved approximately 100-amino acid domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins and in proteins from a variety of other plant species. Genes encoding LOB domain (LBD) proteins are expressed in a variety of temporal- and tissue-specific patterns, suggesting that they may function in diverse processes [] The LOB domain contains conserved blocks of amino acids that identify the LBD gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is defining feature of the LOB domain, is present in all LBD proteins. It is possible that this motif forms a new zinc finger [].
Probab=33.00  E-value=17  Score=25.21  Aligned_cols=16  Identities=31%  Similarity=0.341  Sum_probs=12.5

Q ss_pred             cccccCCCCcccccCC
Q 034358           60 SAWAPDPITGYYRPEN   75 (97)
Q Consensus        60 ~~W~pDP~TG~y~Pen   75 (97)
                      ..|..||+.|.+--..
T Consensus        66 ~~R~~dPv~Gc~G~i~   81 (101)
T PF03195_consen   66 NARARDPVYGCVGIIS   81 (101)
T ss_pred             HhhccCCCcchHHHHH
Confidence            4599999999885443


No 11 
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=30.60  E-value=31  Score=31.78  Aligned_cols=27  Identities=37%  Similarity=0.539  Sum_probs=21.3

Q ss_pred             CCcccccCCCCCC-CCHHHHHHHHhccc
Q 034358           67 ITGYYRPENRAVE-IDPAELREMLLNHK   93 (97)
Q Consensus        67 ~TG~y~Pen~~~e-~D~aelR~~lL~~~   93 (97)
                      .+|+|+|+|...- ..+.-.|+.|.++.
T Consensus       365 ~fg~YrP~Nfd~~F~G~VsvreAL~~SL  392 (733)
T COG4953         365 RFGDYRPENFDSNFHGPVSVREALIKSL  392 (733)
T ss_pred             cccCcCCccccccccCcchHHHHHHHhc
Confidence            4699999998655 67888888888754


No 12 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=30.10  E-value=30  Score=25.35  Aligned_cols=25  Identities=24%  Similarity=0.235  Sum_probs=21.4

Q ss_pred             ccCCCCcccccCCCCCCCCHHHHHH
Q 034358           63 APDPITGYYRPENRAVEIDPAELRE   87 (97)
Q Consensus        63 ~pDP~TG~y~Pen~~~e~D~aelR~   87 (97)
                      +-||.||..+.-+.|+....+...+
T Consensus       109 L~Dp~Tg~~i~L~aFG~dN~aaFa~  133 (135)
T TIGR03054       109 LTDPATGWSIELNAFGADNAAAFER  133 (135)
T ss_pred             EEcCCCCcEEEEeecCCchHHHHHh
Confidence            6799999999999999988776543


No 13 
>PF09803 DUF2346:  Uncharacterized conserved protein (DUF2346);  InterPro: IPR018625  Members of this family of proteins have no known function. 
Probab=28.75  E-value=20  Score=23.93  Aligned_cols=32  Identities=25%  Similarity=0.496  Sum_probs=23.7

Q ss_pred             cccCCCCcccccCCCCCCCCHHHHHHHHhccc
Q 034358           62 WAPDPITGYYRPENRAVEIDPAELREMLLNHK   93 (97)
Q Consensus        62 W~pDP~TG~y~Pen~~~e~D~aelR~~lL~~~   93 (97)
                      ||.+-...+|.|++....-...++++.+..++
T Consensus        34 ~v~~~~~~~~ppe~~~~~~ele~~~~~~~~k~   65 (80)
T PF09803_consen   34 WVIKRKRELYPPENEEIREELEEFKEELRKKR   65 (80)
T ss_pred             HhHHHhcccCCCCCcccHHHHHHHHHHHHHHH
Confidence            88777888999998765555667777776544


No 14 
>TIGR02697 WPE_wolbac Wolbachia palindromic element (WPE) domain. This domain conceptually resembles TIGR01045, the Rickettsial palindromic element (RPE) domain. In both cases, a protein-coding palindromic element spreads through a genome, inserting usually in protein-coding regions. The additional protein coding sequence is thought to allow function of the host protein because of location in surface-exposed regions of the protein structure. Note that this model appears to work better in fragment mode.
Probab=28.22  E-value=26  Score=20.82  Aligned_cols=11  Identities=36%  Similarity=0.733  Sum_probs=9.7

Q ss_pred             CCCcccccCCC
Q 034358           66 PITGYYRPENR   76 (97)
Q Consensus        66 P~TG~y~Pen~   76 (97)
                      ||-+||-|||-
T Consensus         3 PV~~hwDp~~l   13 (36)
T TIGR02697         3 PVPRHWDPENL   13 (36)
T ss_pred             ccccccCcchh
Confidence            78899999986


No 15 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=27.92  E-value=20  Score=27.05  Aligned_cols=35  Identities=29%  Similarity=0.385  Sum_probs=0.0

Q ss_pred             ccccccCCCCcccccCCCCCC------CCHH--HHHHHHhccc
Q 034358           59 SSAWAPDPITGYYRPENRAVE------IDPA--ELREMLLNHK   93 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen~~~e------~D~a--elR~~lL~~~   93 (97)
                      ..-|+-.|.||-.+|++-+.|      +||.  |-|.+++.++
T Consensus       165 ~~~~~~cPitGe~IP~~e~~eHmRi~LlDP~wkEqr~~~~~k~  207 (229)
T PF12230_consen  165 KEKMIICPITGEMIPADEMDEHMRIELLDPRWKEQRDRYEAKR  207 (229)
T ss_dssp             -------------------------------------------
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccc
Confidence            446999999999999999887      5663  5555555444


No 16 
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=26.86  E-value=41  Score=17.49  Aligned_cols=17  Identities=35%  Similarity=0.323  Sum_probs=13.1

Q ss_pred             CCCCCCCCHHHHHHHHh
Q 034358           74 ENRAVEIDPAELREMLL   90 (97)
Q Consensus        74 en~~~e~D~aelR~~lL   90 (97)
                      .|+.+.||..||++.|-
T Consensus        11 ~d~dG~I~~~el~~~l~   27 (31)
T PF13405_consen   11 KDGDGFIDFEELRAILR   27 (31)
T ss_dssp             TTSSSEEEHHHHHHHHH
T ss_pred             CCCCCcCcHHHHHHHHH
Confidence            35668899999998763


No 17 
>PF07886 BA14K:  BA14K-like protein;  InterPro: IPR012413 The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus (Q44701 from SWISSPROT) and by Brucella suis (Q8FVU0 from SWISSPROT). BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process []. 
Probab=25.99  E-value=39  Score=19.07  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=10.5

Q ss_pred             CCCCcccccCCC
Q 034358           65 DPITGYYRPENR   76 (97)
Q Consensus        65 DP~TG~y~Pen~   76 (97)
                      ||.||.|+|-+.
T Consensus        14 ~p~~~Ty~~~~G   25 (31)
T PF07886_consen   14 DPRDNTYQPYDG   25 (31)
T ss_pred             CCCCCcEeCCCC
Confidence            899999999764


No 18 
>PF12904 Collagen_bind_2:  Putative collagen-binding domain of a collagenase ;  InterPro: IPR024749 This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. The structure of one family member, Q8A905 from SWISSPROT, has been characterised. The domain occurs in the C-terminal region of the protein.; PDB: 3KZS_D.
Probab=25.97  E-value=19  Score=24.55  Aligned_cols=16  Identities=38%  Similarity=0.596  Sum_probs=11.9

Q ss_pred             ccccccCCCCcccccCC
Q 034358           59 SSAWAPDPITGYYRPEN   75 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen   75 (97)
                      +.+|+ ||.||-|.+..
T Consensus        50 ~a~Wf-dPR~G~~~~~g   65 (93)
T PF12904_consen   50 KAWWF-DPRTGKYTYIG   65 (93)
T ss_dssp             EEEEE-ETTT-BEEEEE
T ss_pred             eEEEE-cCCCCCEEEee
Confidence            56687 99999998764


No 19 
>COG3375 Uncharacterized conserved protein [Function unknown]
Probab=25.64  E-value=41  Score=27.46  Aligned_cols=13  Identities=38%  Similarity=0.506  Sum_probs=11.1

Q ss_pred             ccCCCCcccccCC
Q 034358           63 APDPITGYYRPEN   75 (97)
Q Consensus        63 ~pDP~TG~y~Pen   75 (97)
                      .++++||||||..
T Consensus       178 in~~~~g~~rp~~  190 (266)
T COG3375         178 INPGGTGYLRPVE  190 (266)
T ss_pred             cCCCCcccccccc
Confidence            3469999999988


No 20 
>PF07846 Metallothio_Cad:  Metallothionein family;  InterPro: IPR012484 The sequence making up family 7 of the metallothionein superfamily are found repeated in metallothionein proteins expressed by two Tetrahymena species. Metallothioneins are low molecular mass, cysteine-rich metal-binding proteins that are thought to be involved in the regulation of levels of trace metals, and detoxification of these metals when present in excess []. Some of the metallothioneins found in this family (for example, Q8T6B3 from SWISSPROT) are known to be induced by cadmium and are thought to be involved in the cellular sequestration of toxic metal ions. The high proportion of cysteine residues allows the metal ions to be bound by the formation of clusters of metal-thiolate complexes []. Tetrahymena spp. metallothioneins differ from other eukaryotic metallothioneins mainly in the length of their sequences and in the cysteine-containing motifs they exhibit. ; GO: 0046870 cadmium ion binding
Probab=24.47  E-value=35  Score=18.07  Aligned_cols=8  Identities=38%  Similarity=0.738  Sum_probs=6.3

Q ss_pred             ccCCCCcc
Q 034358           63 APDPITGY   70 (97)
Q Consensus        63 ~pDP~TG~   70 (97)
                      --||.|||
T Consensus        11 C~DPnsG~   18 (21)
T PF07846_consen   11 CTDPNSGC   18 (21)
T ss_pred             ccCCCCcc
Confidence            35999997


No 21 
>PHA00542 putative Cro-like protein
Probab=24.42  E-value=71  Score=20.57  Aligned_cols=26  Identities=27%  Similarity=0.252  Sum_probs=17.9

Q ss_pred             CCCcccccCCCCCCCCHHHHHHHHhccc
Q 034358           66 PITGYYRPENRAVEIDPAELREMLLNHK   93 (97)
Q Consensus        66 P~TG~y~Pen~~~e~D~aelR~~lL~~~   93 (97)
                      |.+|.|||.-+..  ++.++...+..++
T Consensus         6 ~~~~~~Rp~~~~~--~~~~l~~~l~~~g   31 (82)
T PHA00542          6 PATTPTIPAAYTQ--RPDELVCALIRAG   31 (82)
T ss_pred             cccCCcCCcccCc--CHHHHHHHHHHCC
Confidence            5689999997755  3556766665544


No 22 
>PRK13750 replication protein; Provisional
Probab=22.50  E-value=33  Score=28.28  Aligned_cols=16  Identities=31%  Similarity=0.814  Sum_probs=13.5

Q ss_pred             ccccccCCCCcccccCCC
Q 034358           59 SSAWAPDPITGYYRPENR   76 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen~   76 (97)
                      +..|  |+.+|+|+|...
T Consensus       133 ek~w--D~~~g~yiPk~I  148 (285)
T PRK13750        133 QTEY--DPLIGCYIPTDI  148 (285)
T ss_pred             eeec--cchhhcccCcce
Confidence            5568  999999999765


No 23 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=21.85  E-value=42  Score=29.04  Aligned_cols=25  Identities=32%  Similarity=0.538  Sum_probs=8.2

Q ss_pred             CCCCcccccCCCCCCCCHHHHHHHH
Q 034358           65 DPITGYYRPENRAVEIDPAELREML   89 (97)
Q Consensus        65 DP~TG~y~Pen~~~e~D~aelR~~l   89 (97)
                      .-+||||+|.+.+.+-=-+|++.+.
T Consensus       519 ~Rv~GYl~~v~~~n~gK~~E~~~R~  543 (546)
T PF13597_consen  519 SRVTGYLRPVSRWNKGKQAEFKDRV  543 (546)
T ss_dssp             B-SSSS-BTTS--------------
T ss_pred             EEeeccccCccccCHHHHHHHHHhc
Confidence            4699999999988877777776543


No 24 
>COG4982 3-oxoacyl-[acyl-carrier protein]
Probab=21.39  E-value=91  Score=29.17  Aligned_cols=29  Identities=21%  Similarity=0.618  Sum_probs=24.5

Q ss_pred             cccccCCCCcccccCCCCCCCCHHHHHHHH
Q 034358           60 SAWAPDPITGYYRPENRAVEIDPAELREML   89 (97)
Q Consensus        60 ~~W~pDP~TG~y~Pen~~~e~D~aelR~~l   89 (97)
                      ++|--||.+|.|--+.. ..||-.|+-++.
T Consensus       762 I~w~~dP~pgWyDt~sg-e~Vde~dv~~rY  790 (866)
T COG4982         762 ISWENDPYPGWYDTKSG-EPVDEKDVKARY  790 (866)
T ss_pred             hhccCCCCCCceeCCCC-CcCCHHHHHHHH
Confidence            67999999999988776 679999988764


No 25 
>PF14785 MalF_P2:  Maltose transport system permease protein MalF P2 domain; PDB: 3RLF_F 3PUX_F 3PV0_F 3PUY_F 3PUV_F 2R6G_F 3PUZ_F 3PUW_F.
Probab=21.38  E-value=27  Score=26.29  Aligned_cols=21  Identities=14%  Similarity=0.406  Sum_probs=13.1

Q ss_pred             ccccccCCCCcccccCCCCCC
Q 034358           59 SSAWAPDPITGYYRPENRAVE   79 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen~~~e   79 (97)
                      ..-..||..+|||.+.|.-++
T Consensus       129 G~~yrPN~d~GFyq~~~~~g~  149 (164)
T PF14785_consen  129 GEVYRPNMDIGFYQAIDADGQ  149 (164)
T ss_dssp             --EEEEETTTTEEEEE-----
T ss_pred             CCEEecCCCcceeEeccccCc
Confidence            455889999999999976554


No 26 
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=20.94  E-value=23  Score=26.21  Aligned_cols=13  Identities=38%  Similarity=0.792  Sum_probs=10.0

Q ss_pred             ccccCCCCCCCCH
Q 034358           70 YYRPENRAVEIDP   82 (97)
Q Consensus        70 ~y~Pen~~~e~D~   82 (97)
                      ||||||..+-...
T Consensus        57 fYRPEdi~~g~~~   69 (137)
T cd04711          57 FYRPENTHKGFKA   69 (137)
T ss_pred             Eeccccccccccc
Confidence            8999998775433


No 27 
>COG3323 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.87  E-value=39  Score=24.27  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=13.3

Q ss_pred             ccccccCCCCcccccCCCCC
Q 034358           59 SSAWAPDPITGYYRPENRAV   78 (97)
Q Consensus        59 ~~~W~pDP~TG~y~Pen~~~   78 (97)
                      ..+|- --.||+|||...++
T Consensus        37 ~C~~~-~~g~G~frP~egAn   55 (109)
T COG3323          37 HCTFS-SEGTGQFRPLEGAN   55 (109)
T ss_pred             eEEEE-eeeeEEEeecCCCC
Confidence            34454 35899999988764


No 28 
>KOG2870 consensus NADH:ubiquinone oxidoreductase, NDUFS2/49 kDa subunit [Energy production and conversion]
Probab=20.08  E-value=44  Score=28.88  Aligned_cols=20  Identities=20%  Similarity=0.587  Sum_probs=15.3

Q ss_pred             cccccCCCCcccccCCCCCC
Q 034358           60 SAWAPDPITGYYRPENRAVE   79 (97)
Q Consensus        60 ~~W~pDP~TG~y~Pen~~~e   79 (97)
                      ..|+|||+|-+|.+--.++.
T Consensus        37 ~~~yp~~~~~~w~~pp~~~~   56 (452)
T KOG2870|consen   37 KVWYPDRVTDFWKDPPWNDN   56 (452)
T ss_pred             ceeccchhhhccCCCCCcCC
Confidence            45999999999987655443


Done!