Query         034359
Match_columns 97
No_of_seqs    50 out of 52
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 12:36:25 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034359.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034359hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00053 photosystem II subuni 100.0 7.4E-34 1.6E-38  204.5   4.7   62   24-85      1-65  (117)
  2 PF04725 PsbR:  Photosystem II   99.9 7.6E-26 1.7E-30  159.5   2.9   46   40-85      1-47  (99)
  3 PLN00083 photosystem II subuni  98.7 3.6E-09 7.8E-14   75.3   1.8   25   61-85     29-54  (101)
  4 cd00738 HGTP_anticodon HGTP an  47.8     7.7 0.00017   23.4   0.4   19   74-92     46-64  (94)
  5 cd00861 ProRS_anticodon_short   46.6      12 0.00026   22.9   1.2   30   61-92     35-64  (94)
  6 PF02530 Porin_2:  Porin subfam  46.5      12 0.00027   30.1   1.6   21   76-96     15-36  (379)
  7 cd00858 GlyRS_anticodon GlyRS   41.4      11 0.00025   25.0   0.6   30   61-93     59-88  (121)
  8 PF02493 MORN:  MORN repeat;  I  38.9      20 0.00042   17.7   1.1   13   68-80      9-21  (23)
  9 cd00860 ThrRS_anticodon ThrRS   33.7      15 0.00033   22.0   0.2   20   73-92     42-61  (91)
 10 PF03889 DUF331:  Domain of unk  23.0      32 0.00068   21.2   0.3   14   67-80     23-36  (39)
 11 COG0124 HisS Histidyl-tRNA syn  22.6      22 0.00048   30.1  -0.7   30   61-92    366-395 (429)
 12 PRK10545 nucleotide excision r  22.3      69  0.0015   25.8   2.1   21   68-88     31-51  (286)
 13 TIGR02727 MTHFS_bact 5,10-meth  21.0      34 0.00073   24.4   0.1   17   61-77    125-142 (181)

No 1  
>PLN00053 photosystem II subunit R; Provisional
Probab=100.00  E-value=7.4e-34  Score=204.53  Aligned_cols=62  Identities=55%  Similarity=0.853  Sum_probs=59.9

Q ss_pred             ccCCCCCcc--ceeEEEEcCe-eeeeecccccCCCcccCCCcCcCCCcccceeeEecccccCcee
Q 034359           24 ARGLPSLAK--TSFKIVAKGG-KIKTDKPYGVNGGMDLREGLDASGRKAKYKFLNQQPLNSGELF   85 (97)
Q Consensus        24 vrgLpslaR--ssf~VvAsg~-KIkt~kP~G~~ggm~~k~gvDAsGRk~KGkGVYqf~dKYGan~   85 (97)
                      +||||+++|  ++|+|+||++ ||||++|||++|+|++|+||||||||+||||||||+||||||.
T Consensus         1 ~~glp~l~r~~ss~~v~as~~kkikt~~p~G~~G~m~~k~gvDasGRk~kGkGVYqFvdKYGANV   65 (117)
T PLN00053          1 VRGLPPLSRTARSFKVTASGGKKIKTDQPYGPSGGMNLKDGVDASGRKGKGKGVYQFVDKYGANV   65 (117)
T ss_pred             CCccCcccccccceEEEecCCceeeecCCcccCCCcccccccCCCCccCCCcceEEehhhcCccc
Confidence            589999999  6899999988 9999999999999999999999999999999999999999996


No 2  
>PF04725 PsbR:  Photosystem II 10 kDa polypeptide PsbR;  InterPro: IPR006814 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight intrinsic protein PsbR found in PSII, which is also known as the 10 kDa polypeptide. The PsbR gene is found only in the nucleus of green algae and higher plants. PsbR may provide a binding site for the extrinsic oxygen-evolving complex protein PsbP to the thylakoid membrane. PsbR has a transmembrane domain to anchor it to the thylakoid membrane, and a charged N-terminal domain capable of forming ion bridges with extrinsic proteins, allowing PsbR to act as a docking protein. PsbR may be a pH-dependent stabilising protein that functions at both donor and acceptor sides of PSII [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0042651 thylakoid membrane
Probab=99.91  E-value=7.6e-26  Score=159.47  Aligned_cols=46  Identities=57%  Similarity=0.792  Sum_probs=44.2

Q ss_pred             cCe-eeeeecccccCCCcccCCCcCcCCCcccceeeEecccccCcee
Q 034359           40 KGG-KIKTDKPYGVNGGMDLREGLDASGRKAKYKFLNQQPLNSGELF   85 (97)
Q Consensus        40 sg~-KIkt~kP~G~~ggm~~k~gvDAsGRk~KGkGVYqf~dKYGan~   85 (97)
                      |++ |||||+|||++|+|++|+|+||||||+||||||||+||||||.
T Consensus         1 Sg~KKIkt~~p~G~~g~m~~k~gvDa~gRkgKg~gVYqf~~KyGANV   47 (99)
T PF04725_consen    1 SGGKKIKTDKPYGPSGGMTLKDGVDASGRKGKGKGVYQFVDKYGANV   47 (99)
T ss_pred             CCCccccccCCccCCCCccccCCccCCCCCCCCceeEEehhhcCccc
Confidence            455 9999999999999999999999999999999999999999996


No 3  
>PLN00083 photosystem II subunit R; Provisional
Probab=98.75  E-value=3.6e-09  Score=75.31  Aligned_cols=25  Identities=20%  Similarity=0.287  Sum_probs=23.1

Q ss_pred             CcCcCCCcccceeeEecccccC-cee
Q 034359           61 GLDASGRKAKYKFLNQQPLNSG-ELF   85 (97)
Q Consensus        61 gvDAsGRk~KGkGVYqf~dKYG-an~   85 (97)
                      |--++|||+||||||||+|||| ||.
T Consensus        29 gsapkgRk~Kg~gVYqf~~KyGkANV   54 (101)
T PLN00083         29 GSAPKTRSGKAGYVYKLGLRNGKANV   54 (101)
T ss_pred             CCCCCCccCCCceEEEehhccCcccc
Confidence            6667999999999999999999 986


No 4  
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. This domain is also found in the accessory subunit of mitochondrial polymerase gamma (Pol gamma b).
Probab=47.78  E-value=7.7  Score=23.39  Aligned_cols=19  Identities=21%  Similarity=0.223  Sum_probs=16.6

Q ss_pred             eEecccccCceeEEEeccc
Q 034359           74 LNQQPLNSGELFVYIFGER   92 (97)
Q Consensus        74 VYqf~dKYGan~~~~~~~~   92 (97)
                      -++++++.|+.|+.|+|++
T Consensus        46 ~~~~a~~~g~~~~iiig~~   64 (94)
T cd00738          46 KFREADLRGVPFAVVVGED   64 (94)
T ss_pred             HHHHHHhCCCCEEEEECCC
Confidence            4788999999999999964


No 5  
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=46.63  E-value=12  Score=22.87  Aligned_cols=30  Identities=13%  Similarity=0.090  Sum_probs=21.6

Q ss_pred             CcCcCCCcccceeeEecccccCceeEEEeccc
Q 034359           61 GLDASGRKAKYKFLNQQPLNSGELFVYIFGER   92 (97)
Q Consensus        61 gvDAsGRk~KGkGVYqf~dKYGan~~~~~~~~   92 (97)
                      -+|.+++  +=+--++++++.|+.|+.|.|+.
T Consensus        35 ~~d~~~~--~l~k~i~~a~~~g~~~~iiiG~~   64 (94)
T cd00861          35 LLDDRNE--RPGVKFADADLIGIPYRIVVGKK   64 (94)
T ss_pred             EEECCCC--CcccchhHHHhcCCCEEEEECCc
Confidence            4555554  33345778999999999999964


No 6  
>PF02530 Porin_2:  Porin subfamily;  InterPro: IPR003684 This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to Gram-negative porins []. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of Gram-negative bacteria.; GO: 0015288 porin activity, 0006810 transport, 0016020 membrane
Probab=46.50  E-value=12  Score=30.09  Aligned_cols=21  Identities=38%  Similarity=0.567  Sum_probs=18.3

Q ss_pred             ecccccCceeEEEec-cceecC
Q 034359           76 QQPLNSGELFVYIFG-ERCLPI   96 (97)
Q Consensus        76 qf~dKYGan~~~~~~-~~~~~~   96 (97)
                      |-+|-||+-|.||=| |-||-|
T Consensus        15 rvc~~yg~gf~~IPGTdTclri   36 (379)
T PF02530_consen   15 RVCDAYGAGFFYIPGTDTCLRI   36 (379)
T ss_pred             EeccCcCCceEEcCCCCceEee
Confidence            457899999999999 889976


No 7  
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. GlyRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=41.41  E-value=11  Score=25.04  Aligned_cols=30  Identities=13%  Similarity=-0.028  Sum_probs=22.4

Q ss_pred             CcCcCCCcccceeeEecccccCceeEEEeccce
Q 034359           61 GLDASGRKAKYKFLNQQPLNSGELFVYIFGERC   93 (97)
Q Consensus        61 gvDAsGRk~KGkGVYqf~dKYGan~~~~~~~~~   93 (97)
                      -+|-+ +  +=+--+++++|.|+.|+.|+|++.
T Consensus        59 ~~d~~-~--sl~kqlk~A~k~g~~~~iiiG~~e   88 (121)
T cd00858          59 KYDDS-G--SIGRRYARQDEIGTPFCVTVDFDT   88 (121)
T ss_pred             EEeCC-C--CHHHHHHHhHhcCCCEEEEECcCc
Confidence            34444 4  444567889999999999999864


No 8  
>PF02493 MORN:  MORN repeat;  InterPro: IPR003409 The MORN (Membrane Occupation and Recognition Nexus) motif is found in multiple copies in several proteins including junctophilins (). The function of this motif is unknown.; PDB: 1H3I_B 1MT6_A 1N6C_A 3OS5_A 3M53_A 3M55_A 3CBP_A 4E47_B 3M58_A 3CBO_A ....
Probab=38.88  E-value=20  Score=17.69  Aligned_cols=13  Identities=15%  Similarity=-0.153  Sum_probs=9.2

Q ss_pred             cccceeeEecccc
Q 034359           68 KAKYKFLNQQPLN   80 (97)
Q Consensus        68 k~KGkGVYqf~dK   80 (97)
                      +..|+|+|+|+|.
T Consensus         9 ~~~G~G~~~~~~G   21 (23)
T PF02493_consen    9 KKHGYGVYTFPDG   21 (23)
T ss_dssp             EEECEEEEE-TTS
T ss_pred             cccccEEEEeCCC
Confidence            3568999999873


No 9  
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=33.71  E-value=15  Score=22.02  Aligned_cols=20  Identities=5%  Similarity=0.139  Sum_probs=16.9

Q ss_pred             eeEecccccCceeEEEeccc
Q 034359           73 FLNQQPLNSGELFVYIFGER   92 (97)
Q Consensus        73 GVYqf~dKYGan~~~~~~~~   92 (97)
                      --++++++-|+.++.|+|++
T Consensus        42 ~~~~~a~~~g~~~~iiig~~   61 (91)
T cd00860          42 KKIREAQLQKIPYILVVGDK   61 (91)
T ss_pred             HHHHHHHHcCCCEEEEECcc
Confidence            35788999999999999964


No 10 
>PF03889 DUF331:  Domain of unknown function;  InterPro: IPR005589 The members of this family are uncharacterised proteins from a number of bacterial species. They range in size from 50-100 residues.
Probab=23.04  E-value=32  Score=21.19  Aligned_cols=14  Identities=21%  Similarity=-0.026  Sum_probs=9.7

Q ss_pred             CcccceeeEecccc
Q 034359           67 RKAKYKFLNQQPLN   80 (97)
Q Consensus        67 Rk~KGkGVYqf~dK   80 (97)
                      +.-||||-||=-.|
T Consensus        23 k~kKGKGSy~Rk~k   36 (39)
T PF03889_consen   23 KAKKGKGSYQRKAK   36 (39)
T ss_pred             ccccCccccchhhh
Confidence            45688998885444


No 11 
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=22.56  E-value=22  Score=30.14  Aligned_cols=30  Identities=37%  Similarity=0.407  Sum_probs=25.6

Q ss_pred             CcCcCCCcccceeeEecccccCceeEEEeccc
Q 034359           61 GLDASGRKAKYKFLNQQPLNSGELFVYIFGER   92 (97)
Q Consensus        61 gvDAsGRk~KGkGVYqf~dKYGan~~~~~~~~   92 (97)
                      -+|-++|+  =|.-+++|||-|+.|+.|.||+
T Consensus       366 ~~~~~~r~--~k~q~k~A~~~g~~~~viiGe~  395 (429)
T COG0124         366 EVDYSGRK--LKKQFKYADKLGARFAVILGED  395 (429)
T ss_pred             EEEecccc--HHHHHHHHHHCCCCEEEEEcch
Confidence            57778888  4566899999999999999986


No 12 
>PRK10545 nucleotide excision repair endonuclease; Provisional
Probab=22.34  E-value=69  Score=25.81  Aligned_cols=21  Identities=19%  Similarity=0.034  Sum_probs=16.9

Q ss_pred             cccceeeEecccccCceeEEE
Q 034359           68 KAKYKFLNQQPLNSGELFVYI   88 (97)
Q Consensus        68 k~KGkGVYqf~dKYGan~~~~   88 (97)
                      -+.--|||.|-|+-|....||
T Consensus        31 LP~~PGVYlf~d~~g~~~LYV   51 (286)
T PRK10545         31 LPKLPGVYLFHGESDTMPLYI   51 (286)
T ss_pred             CCCCCeEEEEEcCCCCEEEEE
Confidence            355679999999988877777


No 13 
>TIGR02727 MTHFS_bact 5,10-methenyltetrahydrofolate synthetase. This enzyme, 5,10-methenyltetrahydrofolate synthetase, is also called 5-formyltetrahydrofolate cycloligase. Function of bacterial proteins in this family was inferred originally from the known activity of eukaryotic homologs. Recently, activity was shown explicitly for the member from Mycoplasma pneumonia. Members of this family from alpha- and gamma-proteobacteria, designated ygfA, are often found in an operon with 6S structural RNA, and show a similar pattern of high expression during stationary phase. The function may be to deplete folate to slow 1-carbon biosynthetic metabolism.
Probab=21.04  E-value=34  Score=24.40  Aligned_cols=17  Identities=18%  Similarity=0.094  Sum_probs=12.8

Q ss_pred             CcCcCC-CcccceeeEec
Q 034359           61 GLDASG-RKAKYKFLNQQ   77 (97)
Q Consensus        61 gvDAsG-Rk~KGkGVYqf   77 (97)
                      ++|.+| |-|.|+|-|.-
T Consensus       125 afD~~G~RLG~GgGyYDR  142 (181)
T TIGR02727       125 AFDRRGYRLGYGGGYYDR  142 (181)
T ss_pred             EEcCCCccccCCcchHHH
Confidence            456665 89999999953


Done!