Query         034367
Match_columns 96
No_of_seqs    116 out of 1050
Neff          6.8 
Searched_HMMs 46136
Date          Fri Mar 29 12:41:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034367.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034367hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00265 MADS_MEF2_like MEF2 (m 100.0 1.5E-33 3.3E-38  174.7   4.5   74    2-75      1-74  (77)
  2 KOG0014 MADS box transcription 100.0 3.3E-33 7.1E-38  195.7   5.7   86    1-86      1-88  (195)
  3 cd00266 MADS_SRF_like SRF-like 100.0 8.7E-32 1.9E-36  168.9   5.7   81    2-82      1-82  (83)
  4 smart00432 MADS MADS domain.   100.0   1E-29 2.2E-34  150.6   4.8   59    2-60      1-59  (59)
  5 cd00120 MADS MADS: MCM1, Agamo 100.0 4.6E-29 9.9E-34  147.8   3.6   59    2-60      1-59  (59)
  6 PF00319 SRF-TF:  SRF-type tran  99.9 1.7E-27 3.7E-32  137.3   0.8   51    9-59      1-51  (51)
  7 KOG0015 Regulator of arginine   99.9 8.9E-23 1.9E-27  152.2   2.1   84    2-85     63-146 (338)
  8 COG5068 ARG80 Regulator of arg  99.6 1.2E-15 2.5E-20  117.9   3.4   69    1-69     81-149 (412)
  9 PF10491 Nrf1_DNA-bind:  NLS-bi  78.8     3.2 6.9E-05   30.3   3.5   47   26-72     35-88  (214)
 10 PF09151 DUF1936:  Domain of un  75.3     3.8 8.3E-05   21.3   2.3   25   34-58      2-26  (36)
 11 COG4888 Uncharacterized Zn rib  57.3     8.8 0.00019   25.0   1.9   54    1-57      1-58  (104)
 12 PF11232 Med25:  Mediator compl  50.6      27 0.00058   24.2   3.5   36   37-72    109-145 (152)
 13 PF14263 DUF4354:  Domain of un  49.7     5.7 0.00012   26.7   0.1   44   11-59     41-84  (124)
 14 cd01365 KISc_KIF1A_KIF1B Kines  47.9      24 0.00051   26.9   3.2   33   36-68     83-118 (356)
 15 COG0139 HisI Phosphoribosyl-AM  46.3     6.2 0.00013   26.0  -0.1   28   27-54     69-96  (111)
 16 PF10584 Proteasome_A_N:  Prote  44.9     2.6 5.7E-05   20.2  -1.5   11   45-55      5-15  (23)
 17 cd00106 KISc Kinesin motor dom  42.4      33 0.00072   25.5   3.2   26   36-61     73-101 (328)
 18 TIGR01916 F420_cofE F420-0:gam  40.6      28  0.0006   25.9   2.5   27   33-59    133-159 (243)
 19 cd01368 KISc_KIF23_like Kinesi  36.7      45 0.00097   25.4   3.2   31   36-66     83-116 (345)
 20 cd01371 KISc_KIF3 Kinesin moto  36.2      43 0.00094   25.3   3.1   25   36-60     76-103 (333)
 21 PF09941 DUF2173:  Uncharacteri  35.9      65  0.0014   21.0   3.4   27   32-59      3-29  (108)
 22 PF13082 DUF3931:  Protein of u  35.8     9.8 0.00021   22.1  -0.4   34    4-37      6-39  (66)
 23 cd01376 KISc_KID_like Kinesin   35.4      51  0.0011   24.7   3.3   24   36-59     75-101 (319)
 24 smart00129 KISc Kinesin motor,  34.8      50  0.0011   24.7   3.2   23   37-59     75-100 (335)
 25 PF01502 PRA-CH:  Phosphoribosy  34.4      10 0.00022   23.3  -0.5   33   21-53     22-63  (75)
 26 PF14009 DUF4228:  Domain of un  34.1      69  0.0015   21.1   3.5   34   39-72     12-46  (181)
 27 PRK13293 F420-0--gamma-glutamy  33.9      40 0.00087   25.1   2.5   27   33-59    134-160 (245)
 28 cd01370 KISc_KIP3_like Kinesin  33.8      49  0.0011   25.1   3.0   33   36-68     82-117 (338)
 29 PF00225 Kinesin:  Kinesin moto  33.5      24 0.00052   26.3   1.3   24   36-59     69-95  (335)
 30 cd01366 KISc_C_terminal Kinesi  33.4      48   0.001   24.8   2.9   24   36-59     72-98  (329)
 31 cd01363 Motor_domain Myosin an  32.8      38 0.00083   23.2   2.1   24   36-59     18-44  (186)
 32 PF15119 APOC4:  Apolipoprotein  32.8      21 0.00046   22.7   0.8   19   22-40     76-96  (99)
 33 cd01369 KISc_KHC_KIF5 Kinesin   32.3      50  0.0011   24.7   2.8   24   37-60     72-98  (325)
 34 PRK09555 feoA ferrous iron tra  32.2      78  0.0017   18.9   3.2   33   26-58     20-52  (74)
 35 cd01367 KISc_KIF2_like Kinesin  31.3      50  0.0011   24.8   2.7   25   36-60     79-106 (322)
 36 cd01374 KISc_CENP_E Kinesin mo  30.7      57  0.0012   24.4   2.9   24   37-60     69-95  (321)
 37 cd03063 TRX_Fd_FDH_beta TRX-li  30.7      85  0.0018   19.7   3.3   36   38-73     44-81  (92)
 38 PF00383 dCMP_cyt_deam_1:  Cyti  30.3      86  0.0019   18.9   3.3   29   27-55      6-38  (102)
 39 PF13540 RCC1_2:  Regulator of   29.7      49  0.0011   16.1   1.7   23   36-59      3-25  (30)
 40 PF15208 Rab15_effector:  Rab15  29.1      51  0.0011   24.3   2.3   34   21-54    137-172 (236)
 41 PF02824 TGS:  TGS domain;  Int  28.3 1.1E+02  0.0023   17.3   3.2   24   45-68      1-25  (60)
 42 smart00782 PhnA_Zn_Ribbon PhnA  26.1      30 0.00066   19.2   0.6   22   28-49      2-23  (47)
 43 PF03850 Tfb4:  Transcription f  25.2 1.3E+02  0.0028   22.5   4.0   27   35-61     39-65  (276)
 44 COG5068 ARG80 Regulator of arg  24.1      45 0.00097   26.7   1.3   46    8-59     18-63  (412)
 45 cd01668 TGS_RelA_SpoT TGS_RelA  24.0 1.3E+02  0.0028   16.0   2.9   24   46-69      2-26  (60)
 46 PF07676 PD40:  WD40-like Beta   23.4      93   0.002   15.4   2.1   18   42-59     10-27  (39)
 47 PRK09732 hypothetical protein;  23.2 1.4E+02  0.0031   19.9   3.5   31   28-58     15-45  (134)
 48 cd01284 Riboflavin_deaminase-r  21.9 1.3E+02  0.0029   19.3   3.1   28   29-56      1-34  (115)
 49 PTZ00366 Surface antigen  (SAG  21.1      51  0.0011   26.2   1.1   28   17-44      3-30  (392)
 50 PF01996 F420_ligase:  F420-0:G  20.8      25 0.00055   25.5  -0.6   27   33-59    141-167 (228)
 51 PRK13294 F420-0--gamma-glutamy  20.7      89  0.0019   25.1   2.4   27   33-59    134-160 (448)
 52 COG3411 Ferredoxin [Energy pro  20.4 1.4E+02  0.0029   17.8   2.6   28   45-72     19-47  (64)
 53 cd06397 PB1_UP1 Uncharacterize  20.2 2.3E+02  0.0051   17.6   3.9   43   26-68     23-66  (82)
 54 PF06020 Roughex:  Drosophila r  20.0      52  0.0011   25.4   0.9   15   36-50    183-197 (334)

No 1  
>cd00265 MADS_MEF2_like MEF2 (myocyte enhancer factor 2)-like/Type II subfamily of MADS ( MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.98  E-value=1.5e-33  Score=174.74  Aligned_cols=74  Identities=64%  Similarity=0.967  Sum_probs=71.7

Q ss_pred             CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCchHHHHHHhhhcccc
Q 034367            2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKN   75 (96)
Q Consensus         2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~~~~vl~ry~~~s~~   75 (96)
                      ||+||+|++|+|+..|++||+||+.||||||.|||+||||+||||||+|+|++++|+++++++||+||+..+..
T Consensus         1 gr~ki~i~~i~~~~~r~~tf~kR~~gl~kKa~Els~Lc~~~v~lvv~sp~gk~~~f~s~s~~~vl~ry~~~~~~   74 (77)
T cd00265           1 GRGKIEIKRIENSTNRQVTFSKRRNGLLKKAHELSVLCDAEVALIIFSSSGKLYEFSSPSMEKIIERYQKTSGS   74 (77)
T ss_pred             CCCcceeEEecCccHHHHHHHHhhhhhhhcceeheeccCCceeEEEEcCCCceEEecCCCHHHHHHHHHhcccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999988654


No 2  
>KOG0014 consensus MADS box transcription factor [Transcription]
Probab=99.98  E-value=3.3e-33  Score=195.69  Aligned_cols=86  Identities=48%  Similarity=0.813  Sum_probs=78.1

Q ss_pred             CCcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCc--hHHHHHHhhhccccccc
Q 034367            1 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS--MKEILEKHRVHSKNLER   78 (96)
Q Consensus         1 MgR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~--~~~vl~ry~~~s~~~~~   78 (96)
                      |||+||+|++|+|++.|++||+|||.||||||+||||||||+||+|||+|+|++|.|++++  +++++++|.........
T Consensus         1 M~R~ki~i~~Ien~~~RqvTFsKRr~GL~KKA~ELsvLCd~eiavIifsp~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~   80 (195)
T KOG0014|consen    1 MGRGKIEIKRIENESSRQVTFSKRRNGLFKKASELSVLCDAEIAVIVFSPSGKLYEFGSSDESVDAVVDRFLNLTEPSRK   80 (195)
T ss_pred             CCCCccceeeccccchhhhhhHHHHhhHHHHHHHHHHhcCCeEEEEEECCCCCccccCCcchhHHHHHHHHHhhhhhhhc
Confidence            9999999999999999999999999999999999999999999999999999999998866  99999999998877655


Q ss_pred             CCCCChhh
Q 034367           79 VDQPSVEL   86 (96)
Q Consensus        79 ~~~~~~e~   86 (96)
                      ....+.+.
T Consensus        81 ~~~~~~~~   88 (195)
T KOG0014|consen   81 KKRVNLES   88 (195)
T ss_pred             ccccchhh
Confidence            44444443


No 3  
>cd00266 MADS_SRF_like SRF-like/Type I subfamily of MADS (MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero- and homo-dimers. Differs from the MEF-like/Type II subgroup mainly in position of the alpha 2 helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.97  E-value=8.7e-32  Score=168.92  Aligned_cols=81  Identities=46%  Similarity=0.742  Sum_probs=75.1

Q ss_pred             CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCc-hHHHHHHhhhcccccccCC
Q 034367            2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS-MKEILEKHRVHSKNLERVD   80 (96)
Q Consensus         2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~-~~~vl~ry~~~s~~~~~~~   80 (96)
                      ||+||+|++|+|+..|++||+||+.||+|||+|||+|||++||+|||+|+|+.++|++++ ++++|++|..++..+++..
T Consensus         1 gr~Ki~i~~I~~~~~R~~tf~KRk~gl~kKa~ELs~Lc~~~v~~iv~sp~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~   80 (83)
T cd00266           1 GRKKIKIKRIENKKKRAVTFSKRRQGLFKKASELSTLCGAEVAVIVYSPSGKLYVFWPSSEVEGVISRFEVLSALERKKK   80 (83)
T ss_pred             CCccceeEEeeccchhhhhHHHhhhhHHHHHHHHHHhhCCcEEEEEECCCCCcceecCcHHHHHHHHHHhhcCHhhhhcc
Confidence            899999999999999999999999999999999999999999999999999999887755 9999999999998877655


Q ss_pred             CC
Q 034367           81 QP   82 (96)
Q Consensus        81 ~~   82 (96)
                      .+
T Consensus        81 ~~   82 (83)
T cd00266          81 AV   82 (83)
T ss_pred             CC
Confidence            43


No 4  
>smart00432 MADS MADS domain.
Probab=99.96  E-value=1e-29  Score=150.63  Aligned_cols=59  Identities=71%  Similarity=1.108  Sum_probs=57.3

Q ss_pred             CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCC
Q 034367            2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS   60 (96)
Q Consensus         2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~   60 (96)
                      ||+||+|++|+|++.|++||+||+.||+|||+|||+||||+||+|||+|+|++++|++|
T Consensus         1 gR~Ki~i~~I~~~~~R~~tf~kRk~gl~kKa~Els~Lc~~~v~~iv~sp~g~~~~~~~p   59 (59)
T smart00432        1 GRRKIEIKRIENKTNRQVTFSKRRNGLFKKAHELSVLCDAEVALIVFSPTGKLYEFASP   59 (59)
T ss_pred             CCCcceeEEeeCcchhhhhhHhhhhhHHHHHHHHhhccCCeEEEEEECCCCCeeeccCC
Confidence            89999999999999999999999999999999999999999999999999999998764


No 5  
>cd00120 MADS MADS: MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptonal regulators. Binds DNA and exists as hetero and homo-dimers.  Composed of 2 main subgroups: SRF-like/Type I and MEF2-like (myocyte enhancer factor 2)/ Type II. These subgroups differ mainly in position of the alpha 2 helix responsible for the dimerization interface; Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.95  E-value=4.6e-29  Score=147.81  Aligned_cols=59  Identities=69%  Similarity=1.076  Sum_probs=57.1

Q ss_pred             CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCC
Q 034367            2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS   60 (96)
Q Consensus         2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~   60 (96)
                      ||+||+|++|+|+..|++||+||+.||+|||+|||+|||++||+|||+|+|++++|+++
T Consensus         1 gr~Ki~i~~I~~~~~R~~tf~kR~~gl~kKa~Els~Lc~~~v~~iv~sp~g~~~~~~~~   59 (59)
T cd00120           1 GRGKIEIKRIENKTSRQVTFSKRRNGLFKKASELSVLCDAEVAVIVFSPSGKLYEFWSS   59 (59)
T ss_pred             CCccceeEEeeCcchhhhhHHHHhchHHHhhhhheeccCCcEEEEEECCCCCcccccCC
Confidence            79999999999999999999999999999999999999999999999999999998763


No 6  
>PF00319 SRF-TF:  SRF-type transcription factor (DNA-binding and dimerisation domain);  InterPro: IPR002100 Human serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation []. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic alpha-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel beta-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see IPR002487 from INTERPRO ; GO: 0003677 DNA binding, 0046983 protein dimerization activity; PDB: 1MNM_B 1N6J_A 1TQE_S 3MU6_D 3P57_I 1EGW_A 1C7U_B 3KOV_A 1HBX_A 1K6O_C ....
Probab=99.93  E-value=1.7e-27  Score=137.30  Aligned_cols=51  Identities=61%  Similarity=1.045  Sum_probs=46.9

Q ss_pred             EEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccC
Q 034367            9 KKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus         9 ~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      ++|+|+..|++||+||+.||+|||.|||+|||++||||||+|+|++++|+|
T Consensus         1 K~I~n~~~R~~tf~KRk~gL~KKa~ELs~LC~~~v~~iv~~~~g~~~~f~s   51 (51)
T PF00319_consen    1 KRIENKSRRKVTFSKRKKGLFKKASELSTLCGVDVALIVFSPDGKLYTFPS   51 (51)
T ss_dssp             S--SSHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEEETTSEEEEEES
T ss_pred             CCccchhHhHhHHHHHHhhhhhccceeeeecCCeEEEEEECCCCCEEEecC
Confidence            589999999999999999999999999999999999999999999999986


No 7  
>KOG0015 consensus Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
Probab=99.86  E-value=8.9e-23  Score=152.19  Aligned_cols=84  Identities=32%  Similarity=0.520  Sum_probs=70.9

Q ss_pred             CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCchHHHHHHhhhcccccccCCC
Q 034367            2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQ   81 (96)
Q Consensus         2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~~~~vl~ry~~~s~~~~~~~~   81 (96)
                      ||+||+|++|+|+.+|.+||+|||.||||||+|||+|+|.+|.|+|.+++|.+|+|..+.++.||..-....-...+.+.
T Consensus        63 gr~kik~eyIenK~rR~~tFSKRK~GImKKAyELs~LTGtqVllLVaSEtGhVyTFaTpKLep~i~s~~Gk~lIq~cLn~  142 (338)
T KOG0015|consen   63 GRVKIKMEYIENKLRRYVTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATPKLEPMITSDEGKALIQACLNA  142 (338)
T ss_pred             ceeeccchhhcccceeeeeehhhhhhhHHHHHHhhhcccceEEEEEEecCcceEEeccccccccccchhhHHHHHHHhcC
Confidence            79999999999999999999999999999999999999999999999999999999999888887654322222334444


Q ss_pred             CChh
Q 034367           82 PSVE   85 (96)
Q Consensus        82 ~~~e   85 (96)
                      |+.+
T Consensus       143 pd~~  146 (338)
T KOG0015|consen  143 PDTP  146 (338)
T ss_pred             CCCC
Confidence            4433


No 8  
>COG5068 ARG80 Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
Probab=99.57  E-value=1.2e-15  Score=117.92  Aligned_cols=69  Identities=39%  Similarity=0.590  Sum_probs=64.8

Q ss_pred             CCcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCchHHHHHHh
Q 034367            1 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKH   69 (96)
Q Consensus         1 MgR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~~~~vl~ry   69 (96)
                      |||+||.|.+|+|+.+|.+||+||+.||+|||.||++|.|.+|.|+|.+.+|.+++|..++.+.|+..-
T Consensus        81 ~~~~~~~is~i~nk~~r~vtf~Krk~gI~kka~ElsvLt~~~vl~lvise~g~v~tf~tp~~e~v~~~~  149 (412)
T COG5068          81 VTGRKIGISYITNKTKRSVTFSKRKHGINKKAFELSVLTGTEVLLLVISENGLVHTFTTPKLESVVKSL  149 (412)
T ss_pred             cccccCCcccccCcccccchhhhhhhhhhhhhhhhhhccCCceEEEEecCCCceeeecCCccccccccc
Confidence            789999999999999999999999999999999999999999999999999999999998777776443


No 9  
>PF10491 Nrf1_DNA-bind:  NLS-binding and DNA-binding and dimerisation domains of Nrf1;  InterPro: IPR019525  Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila [].  In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human []. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Q8C4C0 from SWISSPROT, there is also an NLS domain at 88-116, and a DNA binding and dimerisation domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity []. 
Probab=78.75  E-value=3.2  Score=30.29  Aligned_cols=47  Identities=4%  Similarity=0.222  Sum_probs=37.2

Q ss_pred             chhhhhh----HhhhhccccceEEEEecCCC---ceeeccCCchHHHHHHhhhc
Q 034367           26 RGIFKKA----EELSVLCDADVALIIFSATG---KLFEYSSSSMKEILEKHRVH   72 (96)
Q Consensus        26 ~gL~kKa----~Els~LC~~~v~liv~~~~g---~~~~~~s~~~~~vl~ry~~~   72 (96)
                      .-|+.|-    .|+++-+|-++.|+|++|+.   ..-+|+...++.||..|...
T Consensus        35 ~rllrkl~~~~de~~trvGqqavvl~~~p~kp~~~f~vfGa~pL~~vv~~~~~~   88 (214)
T PF10491_consen   35 TRLLRKLRQTIDEYTTRVGQQAVVLCCTPSKPNPVFKVFGAAPLENVVRNLKPV   88 (214)
T ss_pred             HHHHHHHHHHHHHHHHhhhceeEEEEecCCCCCCceeeecchhHHHHHHHHHHH
Confidence            3455554    79999999999999999853   35579998999998888765


No 10 
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=75.34  E-value=3.8  Score=21.27  Aligned_cols=25  Identities=16%  Similarity=0.381  Sum_probs=17.7

Q ss_pred             hhhhccccceEEEEecCCCceeecc
Q 034367           34 ELSVLCDADVALIIFSATGKLFEYS   58 (96)
Q Consensus        34 Els~LC~~~v~liv~~~~g~~~~~~   58 (96)
                      .|+--||+-|.+.||+..|..-+|-
T Consensus         2 hlcpkcgvgvl~pvy~~kgeikvfr   26 (36)
T PF09151_consen    2 HLCPKCGVGVLEPVYNQKGEIKVFR   26 (36)
T ss_dssp             -B-TTTSSSBEEEEE-TTS-EEEEE
T ss_pred             ccCCccCceEEEEeecCCCcEEEEE
Confidence            4677799999999999999876653


No 11 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=57.31  E-value=8.8  Score=25.00  Aligned_cols=54  Identities=20%  Similarity=0.236  Sum_probs=31.1

Q ss_pred             CCcccceeEEecCCCCcccccccccchhhhhhHhhhhcccc----ceEEEEecCCCceeec
Q 034367            1 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDA----DVALIIFSATGKLFEY   57 (96)
Q Consensus         1 MgR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~----~v~liv~~~~g~~~~~   57 (96)
                      |||++...+.|-.  .|+..+.|+-..++ =-+|.++.|-+    .+++++.+-.|.-+..
T Consensus         1 MG~rr~krr~~ik--~~~~~L~k~FtCp~-Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888           1 MGRRRRKRRKIIK--RRPQVLPKTFTCPR-CGHEKVSSCTVKKTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             CCcccccccccCc--ccCccCCceEecCc-cCCeeeeEEEEEecCceeEEEcccCcceEEE
Confidence            9999988887653  22332344333332 12455555544    4677777777876654


No 12 
>PF11232 Med25:  Mediator complex subunit 25 PTOV activation and synapsin 2;  InterPro: IPR021394  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species [],[]. It is arranged into four different sections, a core, a head, a tail and a kinase-active part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain, an SD1 - synapsin 1 - domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This family is the combined PTOV and SD2 domains. the PTOV domain being the domain through which Med25 co-operates with the histone acetyltransferase CBP, but the function of the SD2 domain is unclear []. ; PDB: 2KY6_A 2L23_A 2XNF_A 2L6U_A.
Probab=50.56  E-value=27  Score=24.22  Aligned_cols=36  Identities=17%  Similarity=0.403  Sum_probs=24.5

Q ss_pred             hccccceEEEEecCCCceee-ccCCchHHHHHHhhhc
Q 034367           37 VLCDADVALIIFSATGKLFE-YSSSSMKEILEKHRVH   72 (96)
Q Consensus        37 ~LC~~~v~liv~~~~g~~~~-~~s~~~~~vl~ry~~~   72 (96)
                      .-|++.|.+++|+++.+.|. |-.-+-...+.+++..
T Consensus       109 p~c~iKvL~LlYs~kk~~flG~IP~DQ~~Fv~~lr~V  145 (152)
T PF11232_consen  109 PPCEIKVLMLLYSPKKKAFLGFIPNDQEGFVNRLRQV  145 (152)
T ss_dssp             SSSS-SEEEEEEETTTTEEEEEEESTHHHHHHHHHHH
T ss_pred             CCCceEEEEEEEcCCCceEEEEcCCCHHHHHHHHHHH
Confidence            46889999999999988664 6555555555555443


No 13 
>PF14263 DUF4354:  Domain of unknown function (DUF4354); PDB: 3NRF_B 3SB3_A.
Probab=49.74  E-value=5.7  Score=26.65  Aligned_cols=44  Identities=23%  Similarity=0.387  Sum_probs=31.7

Q ss_pred             ecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccC
Q 034367           11 IDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        11 I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      +.++.....||.=.-..+..+.-+|+.+|     ++.|+|+|+-+...+
T Consensus        41 v~~k~~ytktF~V~vaN~s~~~idLsk~C-----f~a~~~~gk~f~ldT   84 (124)
T PF14263_consen   41 VGGKSFYTKTFDVTVANLSDKDIDLSKMC-----FKAYSPDGKEFKLDT   84 (124)
T ss_dssp             ETTEEEEEEEEEEEEEE-SSS-EE-TT-E-----EEEEETTS-EEEEEE
T ss_pred             ecCccceEEEEEEEEecCCCCccccccch-----hhhccccCCEEEecc
Confidence            45677778888888899999999999986     999999998775543


No 14 
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=47.92  E-value=24  Score=26.94  Aligned_cols=33  Identities=18%  Similarity=0.351  Sum_probs=23.5

Q ss_pred             hhccccceEEEEecC--CCceee-ccCCchHHHHHH
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSSSMKEILEK   68 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~~~~~vl~r   68 (96)
                      +++-|..++|++|++  +||.|+ |+...-..|+.|
T Consensus        83 ~~l~G~n~~i~ayGqtGSGKT~Tm~G~~~~~Gli~r  118 (356)
T cd01365          83 HAFEGYNVCLFAYGQTGSGKSYTMMGYKEEKGIIPR  118 (356)
T ss_pred             HHhCCCceEEEEecCCCCCCeEEecCCCCCCchHHH
Confidence            468899999999998  578886 666443344433


No 15 
>COG0139 HisI Phosphoribosyl-AMP cyclohydrolase [Amino acid transport and metabolism]
Probab=46.27  E-value=6.2  Score=26.03  Aligned_cols=28  Identities=29%  Similarity=0.497  Sum_probs=22.2

Q ss_pred             hhhhhhHhhhhccccceEEEEecCCCce
Q 034367           27 GIFKKAEELSVLCDADVALIIFSATGKL   54 (96)
Q Consensus        27 gL~kKa~Els~LC~~~v~liv~~~~g~~   54 (96)
                      |=+-|..|+.+-||.|..++++.+.|.+
T Consensus        69 G~~q~v~~i~~DCD~Dall~~V~q~gg~   96 (111)
T COG0139          69 GHTQKVVEIRLDCDGDALLLLVEQIGGP   96 (111)
T ss_pred             CceEEEEEEEcCCCCCEEEEEEEeCCCC
Confidence            3445567899999999999999986643


No 16 
>PF10584 Proteasome_A_N:  Proteasome subunit A N-terminal signature;  InterPro: IPR000426 The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). This family contains the alpha subunit sequences which range from 210 to 290 amino acids. These sequences are classified as non-peptidase homologues in MEROPS peptidase family T1 (clan PB(T)). ; GO: 0004175 endopeptidase activity, 0006511 ubiquitin-dependent protein catabolic process, 0019773 proteasome core complex, alpha-subunit complex; PDB: 3H4P_M 1IRU_O 3UN4_U 1FNT_A 3OEV_G 3OEU_U 3SDK_U 3DY3_G 3MG7_G 3L5Q_C ....
Probab=44.86  E-value=2.6  Score=20.22  Aligned_cols=11  Identities=45%  Similarity=0.951  Sum_probs=8.4

Q ss_pred             EEEecCCCcee
Q 034367           45 LIIFSATGKLF   55 (96)
Q Consensus        45 liv~~~~g~~~   55 (96)
                      +.+|||+|+++
T Consensus         5 ~t~FSp~Grl~   15 (23)
T PF10584_consen    5 ITTFSPDGRLF   15 (23)
T ss_dssp             TTSBBTTSSBH
T ss_pred             ceeECCCCeEE
Confidence            44789999875


No 17 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=42.36  E-value=33  Score=25.51  Aligned_cols=26  Identities=23%  Similarity=0.456  Sum_probs=19.7

Q ss_pred             hhccccceEEEEecC--CCceee-ccCCc
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSSS   61 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~~   61 (96)
                      +++.|.++++++|++  +||.|+ +++..
T Consensus        73 ~~~~G~~~~i~~yG~tgSGKT~tl~G~~~  101 (328)
T cd00106          73 SVLEGYNGTIFAYGQTGSGKTYTMFGSPK  101 (328)
T ss_pred             HHhCCCceeEEEecCCCCCCeEEecCCCC
Confidence            346799999999998  578886 66543


No 18 
>TIGR01916 F420_cofE F420-0:gamma-glutamyl ligase. This model represents an enzyme of coenzyme F(420) biosynthesis, as catalyzed by MJ0768 of Methanococcus jannaschii and by the N-terminal half of FbiB of Mycobacterium bovis strain BCG. Note that only two glutamates are ligated in M. jannaschii, but five to six in the Mycobacterium lineage. In M. jannaschii, CofE catalyzes the GTP-dependent addition of two L-glutamates.
Probab=40.60  E-value=28  Score=25.92  Aligned_cols=27  Identities=30%  Similarity=0.437  Sum_probs=22.3

Q ss_pred             HhhhhccccceEEEEecCCCceeeccC
Q 034367           33 EELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        33 ~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      .+|.-.+|++|++||.+..|.++.-+.
T Consensus       133 ~~l~~~~g~~v~VIItDt~gr~~R~G~  159 (243)
T TIGR01916       133 RGLRELTGVDVGVIITDTNGRPFREGQ  159 (243)
T ss_pred             HHHHHHHCCCEEEEEECCCCCccccCC
Confidence            457778999999999999998876555


No 19 
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=36.73  E-value=45  Score=25.41  Aligned_cols=31  Identities=23%  Similarity=0.356  Sum_probs=22.1

Q ss_pred             hhccccceEEEEecC--CCceee-ccCCchHHHH
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSSSMKEIL   66 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~~~~~vl   66 (96)
                      +++-|..+++++|+.  +||.|+ ++.+.-..|+
T Consensus        83 ~~l~G~n~ti~aYGqtGSGKTyTm~G~~~~~Gli  116 (345)
T cd01368          83 DLLKGKNSLLFTYGVTNSGKTYTMQGSPGDGGIL  116 (345)
T ss_pred             HHhCCCceEEEEeCCCCCCCeEEecCCCCCCchH
Confidence            467899999999998  578887 5554333333


No 20 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=36.24  E-value=43  Score=25.26  Aligned_cols=25  Identities=28%  Similarity=0.357  Sum_probs=19.9

Q ss_pred             hhccccceEEEEecC--CCceee-ccCC
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSS   60 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~   60 (96)
                      +++-|.++++++|+.  +||.|+ ++..
T Consensus        76 ~~~~G~n~~i~ayG~tgSGKTyTm~G~~  103 (333)
T cd01371          76 SVLEGYNGTIFAYGQTGTGKTFTMEGVR  103 (333)
T ss_pred             HHhCCCceeEEecCCCCCCCcEeecCCC
Confidence            677899999999998  578887 5543


No 21 
>PF09941 DUF2173:  Uncharacterized conserved protein (DUF2173);  InterPro: IPR018685 This family of various hypothetical prokaryotic proteins has no known function.
Probab=35.88  E-value=65  Score=21.04  Aligned_cols=27  Identities=33%  Similarity=0.349  Sum_probs=20.5

Q ss_pred             hHhhhhccccceEEEEecCCCceeeccC
Q 034367           32 AEELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        32 a~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      -.||..|-||-+ ...|+++|++.+|-.
T Consensus         3 l~~Lm~lpGv~A-Ag~Fs~~G~l~e~~G   29 (108)
T PF09941_consen    3 LDKLMKLPGVVA-AGEFSDDGKLVEYKG   29 (108)
T ss_pred             HHHhhcCCCeEE-EEEECCCCeEEeeec
Confidence            356777777754 467899999998876


No 22 
>PF13082 DUF3931:  Protein of unknown function (DUF3931)
Probab=35.76  E-value=9.8  Score=22.10  Aligned_cols=34  Identities=24%  Similarity=0.251  Sum_probs=27.2

Q ss_pred             ccceeEEecCCCCcccccccccchhhhhhHhhhh
Q 034367            4 EKIQIKKIDNATARQVTFSKRRRGIFKKAEELSV   37 (96)
Q Consensus         4 ~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~   37 (96)
                      +|-++--|+.+++..-||+--+--.-.|.+|+|.
T Consensus         6 kkcnvisidgkkkksdtysypklvvenktyefss   39 (66)
T PF13082_consen    6 KKCNVISIDGKKKKSDTYSYPKLVVENKTYEFSS   39 (66)
T ss_pred             ccccEEEeccccccCCcccCceEEEeCceEEEEE
Confidence            4556667788888888998888888889999874


No 23 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=35.37  E-value=51  Score=24.73  Aligned_cols=24  Identities=13%  Similarity=0.375  Sum_probs=18.9

Q ss_pred             hhccccceEEEEecC--CCceee-ccC
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSS   59 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s   59 (96)
                      +++-|.++++++|++  +||.|+ ++.
T Consensus        75 ~~~~G~n~~i~ayG~tgSGKTyTm~G~  101 (319)
T cd01376          75 HLLSGQNATVFAYGSTGAGKTHTMLGD  101 (319)
T ss_pred             HHhCCCceEEEEECCCCCCCcEEEeCC
Confidence            466799999999998  578887 544


No 24 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=34.77  E-value=50  Score=24.72  Aligned_cols=23  Identities=17%  Similarity=0.414  Sum_probs=18.3

Q ss_pred             hccccceEEEEecC--CCceee-ccC
Q 034367           37 VLCDADVALIIFSA--TGKLFE-YSS   59 (96)
Q Consensus        37 ~LC~~~v~liv~~~--~g~~~~-~~s   59 (96)
                      ++-|.++++++|++  +||.|+ +++
T Consensus        75 ~~~G~~~~i~~yG~tgSGKT~tl~G~  100 (335)
T smart00129       75 VLEGYNATIFAYGQTGSGKTYTMSGT  100 (335)
T ss_pred             HhcCCceeEEEeCCCCCCCceEecCC
Confidence            57799999999998  577776 555


No 25 
>PF01502 PRA-CH:  Phosphoribosyl-AMP cyclohydrolase;  InterPro: IPR002496 Phosphoribosyl-AMP cyclohydrolase 3.5.4.19 from EC catalyses the third step in the histidine biosynthetic pathway:  5-phosphoribosyl-AMP + H2O = 5-(5-phospho-D-ribosylaminoformimino)-1-(5-phospho-ribosyl) imidazole-4-carboxamide  It requires Zn2+ ions for activity [].; GO: 0004635 phosphoribosyl-AMP cyclohydrolase activity, 0000105 histidine biosynthetic process; PDB: 1ZPS_B.
Probab=34.45  E-value=10  Score=23.27  Aligned_cols=33  Identities=27%  Similarity=0.570  Sum_probs=23.8

Q ss_pred             cccccchhh---------hhhHhhhhccccceEEEEecCCCc
Q 034367           21 FSKRRRGIF---------KKAEELSVLCDADVALIIFSATGK   53 (96)
Q Consensus        21 f~kRk~gL~---------kKa~Els~LC~~~v~liv~~~~g~   53 (96)
                      |++-|++|-         -++.|+.+-||.|..|+.+.|.|.
T Consensus        22 ~SRSR~~lW~KGetSG~~q~v~~i~~DCD~D~ll~~V~~~G~   63 (75)
T PF01502_consen   22 YSRSRNRLWRKGETSGNTQKVVEIRLDCDGDALLFKVEQVGP   63 (75)
T ss_dssp             EETTTTEEEETTTTTS--EEEEEEEE-TTSSEEEEEEEESS-
T ss_pred             EEccCCcEeeEECCCCCEEEEEEEEecCCCCeEEEEEEeCCC
Confidence            455555554         445789999999999999988776


No 26 
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=34.10  E-value=69  Score=21.11  Aligned_cols=34  Identities=15%  Similarity=0.312  Sum_probs=25.1

Q ss_pred             cccceEEEEecCCCceeeccC-CchHHHHHHhhhc
Q 034367           39 CDADVALIIFSATGKLFEYSS-SSMKEILEKHRVH   72 (96)
Q Consensus        39 C~~~v~liv~~~~g~~~~~~s-~~~~~vl~ry~~~   72 (96)
                      ++...++-|..++|.+..|.. -.+.+|+..|=.+
T Consensus        12 ~~~~~~vkvv~~~G~v~~~~~pv~a~evm~~~P~h   46 (181)
T PF14009_consen   12 SSSAATVKVVHPDGKVEEFKRPVTAAEVMLENPGH   46 (181)
T ss_pred             cCCCceEEEEcCCCcEEEeCCCcCHHHHHHHCCCC
Confidence            344455555568999999887 5899999887666


No 27 
>PRK13293 F420-0--gamma-glutamyl ligase; Reviewed
Probab=33.94  E-value=40  Score=25.09  Aligned_cols=27  Identities=30%  Similarity=0.431  Sum_probs=22.1

Q ss_pred             HhhhhccccceEEEEecCCCceeeccC
Q 034367           33 EELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        33 ~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      .+|.-.+|++|++||.+..|.++-.+.
T Consensus       134 ~~l~~~~g~~v~VIItDt~gr~~R~G~  160 (245)
T PRK13293        134 EGLEELTGKKVGVIITDTNGRPFRKGQ  160 (245)
T ss_pred             HHHHHHHCCCEEEEEEcCCCcccccCC
Confidence            456778999999999999898876655


No 28 
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=33.82  E-value=49  Score=25.11  Aligned_cols=33  Identities=18%  Similarity=0.278  Sum_probs=22.9

Q ss_pred             hhccccceEEEEecC--CCceee-ccCCchHHHHHH
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSSSMKEILEK   68 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~~~~~vl~r   68 (96)
                      +++-|..+++++|++  +||.|+ ++.+.-..|+.+
T Consensus        82 ~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Giipr  117 (338)
T cd01370          82 GVLNGYNATVFAYGATGAGKTHTMLGTDSDPGLMVL  117 (338)
T ss_pred             HHHCCCCceEEeeCCCCCCCeEEEcCCCCCCchHHH
Confidence            457899999999998  578887 555433344433


No 29 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=33.54  E-value=24  Score=26.33  Aligned_cols=24  Identities=25%  Similarity=0.531  Sum_probs=18.0

Q ss_pred             hhccccceEEEEecC--CCceee-ccC
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSS   59 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s   59 (96)
                      +++-|.+++|++|++  +||.|+ +++
T Consensus        69 ~~l~G~n~~i~ayG~tgSGKT~Tm~G~   95 (335)
T PF00225_consen   69 SVLDGYNATIFAYGQTGSGKTYTMFGS   95 (335)
T ss_dssp             HHHTT-EEEEEEEESTTSSHHHHHTBS
T ss_pred             HhhcCCceEEEeecccccccccccccc
Confidence            567899999999997  567775 554


No 30 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=33.36  E-value=48  Score=24.82  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=18.9

Q ss_pred             hhccccceEEEEecC--CCceee-ccC
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSS   59 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s   59 (96)
                      +++-|.+++++.|++  +||.|+ ++.
T Consensus        72 ~~~~G~~~~i~ayG~tgSGKT~tl~G~   98 (329)
T cd01366          72 SALDGYNVCIFAYGQTGSGKTYTMEGP   98 (329)
T ss_pred             HHhCCCceEEEEeCCCCCCCcEEecCC
Confidence            456799999999998  578886 454


No 31 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=32.82  E-value=38  Score=23.23  Aligned_cols=24  Identities=25%  Similarity=0.407  Sum_probs=18.2

Q ss_pred             hhccccceEEEEecCC--Cceee-ccC
Q 034367           36 SVLCDADVALIIFSAT--GKLFE-YSS   59 (96)
Q Consensus        36 s~LC~~~v~liv~~~~--g~~~~-~~s   59 (96)
                      .++.|-++++++|+++  ||.|+ ++.
T Consensus        18 ~~~~G~n~~i~~yG~tGsGKT~Tm~G~   44 (186)
T cd01363          18 SALDGYNVCIFAYGQTGSGKTYTMEGK   44 (186)
T ss_pred             HHhCCcceeEEEECCCCCcceEecCCC
Confidence            3467899999999985  77776 443


No 32 
>PF15119 APOC4:  Apolipoprotein C4
Probab=32.81  E-value=21  Score=22.75  Aligned_cols=19  Identities=21%  Similarity=0.597  Sum_probs=14.6

Q ss_pred             ccccchhhhhhHhhh--hccc
Q 034367           22 SKRRRGIFKKAEELS--VLCD   40 (96)
Q Consensus        22 ~kRk~gL~kKa~Els--~LC~   40 (96)
                      ..-|.+|++||+.||  +||+
T Consensus        76 ~sSkd~llnk~~sLCPrllC~   96 (99)
T PF15119_consen   76 RSSKDSLLNKTHSLCPRLLCG   96 (99)
T ss_pred             HHhHHHHHHHHHhhCchhhcc
Confidence            345789999999987  5664


No 33 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=32.32  E-value=50  Score=24.70  Aligned_cols=24  Identities=17%  Similarity=0.346  Sum_probs=19.0

Q ss_pred             hccccceEEEEecC--CCceee-ccCC
Q 034367           37 VLCDADVALIIFSA--TGKLFE-YSSS   60 (96)
Q Consensus        37 ~LC~~~v~liv~~~--~g~~~~-~~s~   60 (96)
                      ++-|.++++++|++  +||.|+ ++.+
T Consensus        72 ~~~G~n~~i~ayG~tgSGKT~Tm~G~~   98 (325)
T cd01369          72 VLNGYNGTIFAYGQTGSGKTYTMEGPP   98 (325)
T ss_pred             HHcCccceEEEeCCCCCCceEEecCCC
Confidence            57899999999997  578887 4543


No 34 
>PRK09555 feoA ferrous iron transport protein A; Reviewed
Probab=32.16  E-value=78  Score=18.92  Aligned_cols=33  Identities=12%  Similarity=0.137  Sum_probs=28.3

Q ss_pred             chhhhhhHhhhhccccceEEEEecCCCceeecc
Q 034367           26 RGIFKKAEELSVLCDADVALIIFSATGKLFEYS   58 (96)
Q Consensus        26 ~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~   58 (96)
                      ..+..+-.++-++.|++|-++-..|-|.|..+.
T Consensus        20 ~~~~~rL~~mGl~pG~~V~v~~~aP~gdPi~i~   52 (74)
T PRK09555         20 PAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIE   52 (74)
T ss_pred             hHHHHHHHHcCCCCCCEEEEEEECCCCCCEEEE
Confidence            557888999999999999999999988876653


No 35 
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=31.27  E-value=50  Score=24.82  Aligned_cols=25  Identities=12%  Similarity=0.278  Sum_probs=19.5

Q ss_pred             hhccccceEEEEecC--CCceee-ccCC
Q 034367           36 SVLCDADVALIIFSA--TGKLFE-YSSS   60 (96)
Q Consensus        36 s~LC~~~v~liv~~~--~g~~~~-~~s~   60 (96)
                      +++-|..++++.|++  +||.|+ ++..
T Consensus        79 ~~~~G~n~~i~ayGqtGSGKTyTm~G~~  106 (322)
T cd01367          79 HVFEGGVATCFAYGQTGSGKTYTMLGDE  106 (322)
T ss_pred             HHhCCCceEEEeccCCCCCCceEecCcC
Confidence            467799999999997  578887 5443


No 36 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=30.74  E-value=57  Score=24.38  Aligned_cols=24  Identities=17%  Similarity=0.320  Sum_probs=18.8

Q ss_pred             hccccceEEEEecC--CCceee-ccCC
Q 034367           37 VLCDADVALIIFSA--TGKLFE-YSSS   60 (96)
Q Consensus        37 ~LC~~~v~liv~~~--~g~~~~-~~s~   60 (96)
                      ++-|.++++++|++  +||.|+ ++..
T Consensus        69 ~l~G~n~~i~ayG~tgSGKT~T~~G~~   95 (321)
T cd01374          69 ALEGYNGTIFAYGQTSSGKTFTMSGDE   95 (321)
T ss_pred             HHCCCceeEEeecCCCCCCceeccCCC
Confidence            57799999999997  678887 5443


No 37 
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=30.69  E-value=85  Score=19.71  Aligned_cols=36  Identities=6%  Similarity=0.160  Sum_probs=24.8

Q ss_pred             ccccceEEEEecCCCc-eeeccC-CchHHHHHHhhhcc
Q 034367           38 LCDADVALIIFSATGK-LFEYSS-SSMKEILEKHRVHS   73 (96)
Q Consensus        38 LC~~~v~liv~~~~g~-~~~~~s-~~~~~vl~ry~~~s   73 (96)
                      +|..+-.+.|..|+|. .|..-. .++.+|++.+...+
T Consensus        44 ~C~~ePlV~V~~p~g~v~Y~~V~~edv~~Iv~~~~~~~   81 (92)
T cd03063          44 MYWLEPLVEVETPGGRVAYGPVTPADVASLLDAGALEG   81 (92)
T ss_pred             ecCCCCEEEEEeCCCcEEEEeCCHHHHHHHHHHHhhcC
Confidence            4777777778778774 344334 68888998877643


No 38 
>PF00383 dCMP_cyt_deam_1:  Cytidine and deoxycytidylate deaminase zinc-binding region;  InterPro: IPR002125 Cytidine deaminase (3.5.4.5 from EC) (cytidine aminohydrolase) catalyzes the hydrolysis of cytidine into uridine and ammonia while deoxycytidylate deaminase (3.5.4.12 from EC) (dCMP deaminase) hydrolyzes dCMP into dUMP. Both enzymes are known to bind zinc and to require it for their catalytic activity [, ]. These two enzymes do not share any sequence similarity with the exception of a region that contains three conserved histidine and cysteine residues which are thought to be involved in the binding of the catalytic zinc ion. Such a region is also found in other proteins [, ]:  Yeast cytosine deaminase (3.5.4.1 from EC) (gene FCY1) which transforms cytosine into uracil. Mammalian apolipoprotein B mRNA editing protein, responsible for the postranscriptional editing of a CAA codon into a UAA (stop) codon in the APOB mRNA. Riboflavin biosynthesis protein ribG, which converts 2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1H,3H)-pyrimidinedione 5'-phosphate.  Bacillus cereus blasticidin-S deaminase (3.5.4.23 from EC), which catalyzes the deamination of the cytosine moiety of the antibiotics blasticidin S, cytomycin and acetylblasticidin S.  Bacillus subtilis protein comEB. This protein is required for the binding and uptake of transforming DNA. B. subtilis hypothetical protein yaaJ.  Escherichia coli hypothetical protein yfhC. Yeast hypothetical protein YJL035c. ; GO: 0008270 zinc ion binding, 0016787 hydrolase activity; PDB: 3MPZ_C 3R2N_C 1WKQ_A 1TIY_B 2B3J_C 2O7P_B 2OBC_A 2G6V_B 2D30_B 2D5N_B ....
Probab=30.28  E-value=86  Score=18.91  Aligned_cols=29  Identities=24%  Similarity=0.352  Sum_probs=21.1

Q ss_pred             hhhhhhHhhhhcc----ccceEEEEecCCCcee
Q 034367           27 GIFKKAEELSVLC----DADVALIIFSATGKLF   55 (96)
Q Consensus        27 gL~kKa~Els~LC----~~~v~liv~~~~g~~~   55 (96)
                      -+++.|.+++...    +..|+-++++++|+..
T Consensus         6 ~~m~~a~~~a~~s~~~~~~~vgaviv~~~~~~i   38 (102)
T PF00383_consen    6 EFMRIAIELAKRSRPCGNFPVGAVIVDPDGKII   38 (102)
T ss_dssp             HHHHHHHHHHHTHBTTTSSSEEEEEEETTTEEE
T ss_pred             HHHHHHHHHHHhccccCCCCEEEEEEeccCccE
Confidence            3567777776666    7789999999776644


No 39 
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=29.68  E-value=49  Score=16.07  Aligned_cols=23  Identities=13%  Similarity=0.395  Sum_probs=16.2

Q ss_pred             hhccccceEEEEecCCCceeeccC
Q 034367           36 SVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        36 s~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      +|-||....+++.+ +|.++.|..
T Consensus         3 ~ia~G~~ht~al~~-~g~v~~wG~   25 (30)
T PF13540_consen    3 QIACGGYHTCALTS-DGEVYCWGD   25 (30)
T ss_dssp             EEEEESSEEEEEE--TTEEEEEE-
T ss_pred             EEEecCCEEEEEEc-CCCEEEEcC
Confidence            45678777777755 699999986


No 40 
>PF15208 Rab15_effector:  Rab15 effector
Probab=29.05  E-value=51  Score=24.29  Aligned_cols=34  Identities=38%  Similarity=0.555  Sum_probs=26.0

Q ss_pred             cccccchhhhhhHhhhhccccc-eE-EEEecCCCce
Q 034367           21 FSKRRRGIFKKAEELSVLCDAD-VA-LIIFSATGKL   54 (96)
Q Consensus        21 f~kRk~gL~kKa~Els~LC~~~-v~-liv~~~~g~~   54 (96)
                      =.-|+++.+.|-.|+|.|-|-| .+ .|+|+--|++
T Consensus       137 ~~s~~k~rfeKLeEFC~lIG~DClgLFiiFGvpgkp  172 (236)
T PF15208_consen  137 ESSRNKNRFEKLEEFCNLIGEDCLGLFIIFGVPGKP  172 (236)
T ss_pred             hhhccccHHHHHHHHHHhhchhhheeeeEecCCCCc
Confidence            3458899999999999999887 44 4557755554


No 41 
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=28.31  E-value=1.1e+02  Score=17.27  Aligned_cols=24  Identities=13%  Similarity=0.313  Sum_probs=17.8

Q ss_pred             EEEecCCCceeeccC-CchHHHHHH
Q 034367           45 LIIFSATGKLFEYSS-SSMKEILEK   68 (96)
Q Consensus        45 liv~~~~g~~~~~~s-~~~~~vl~r   68 (96)
                      +.||-|+|+...++. .++.++...
T Consensus         1 I~v~lpdG~~~~~~~g~T~~d~A~~   25 (60)
T PF02824_consen    1 IRVYLPDGSIKELPEGSTVLDVAYS   25 (60)
T ss_dssp             EEEEETTSCEEEEETTBBHHHHHHH
T ss_pred             CEEECCCCCeeeCCCCCCHHHHHHH
Confidence            346669999999888 667777644


No 42 
>smart00782 PhnA_Zn_Ribbon PhnA Zinc-Ribbon. This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Probab=26.14  E-value=30  Score=19.20  Aligned_cols=22  Identities=23%  Similarity=0.676  Sum_probs=17.0

Q ss_pred             hhhhhHhhhhccccceEEEEec
Q 034367           28 IFKKAEELSVLCDADVALIIFS   49 (96)
Q Consensus        28 L~kKa~Els~LC~~~v~liv~~   49 (96)
                      |.+.+..-+-||+++..|.+|.
T Consensus         2 L~~Rs~~kCELC~a~~~L~vy~   23 (47)
T smart00782        2 LLARCESKCELCGSDSPLVVYA   23 (47)
T ss_pred             hhHHcCCcccCcCCCCCceEEe
Confidence            4556666788999999888865


No 43 
>PF03850 Tfb4:  Transcription factor Tfb4;  InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. The core-TFIIH basal transcription factor complex has six subunits, this is the p34 subunit.; GO: 0006281 DNA repair, 0006355 regulation of transcription, DNA-dependent, 0000439 core TFIIH complex
Probab=25.22  E-value=1.3e+02  Score=22.54  Aligned_cols=27  Identities=30%  Similarity=0.356  Sum_probs=21.8

Q ss_pred             hhhccccceEEEEecCCCceeeccCCc
Q 034367           35 LSVLCDADVALIIFSATGKLFEYSSSS   61 (96)
Q Consensus        35 ls~LC~~~v~liv~~~~g~~~~~~s~~   61 (96)
                      |+.-...+||||..++++.-+.||++.
T Consensus        39 L~l~~~N~vaVIAs~~~~s~~LYP~~~   65 (276)
T PF03850_consen   39 LALNHSNQVAVIASHSNSSKFLYPSPS   65 (276)
T ss_pred             HhhCccCCEEEEEEcCCccEEEeCCCc
Confidence            555567789999999999888898855


No 44 
>COG5068 ARG80 Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
Probab=24.07  E-value=45  Score=26.72  Aligned_cols=46  Identities=26%  Similarity=0.339  Sum_probs=37.3

Q ss_pred             eEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccC
Q 034367            8 IKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus         8 i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      |+.+-|...-..+|++|..|      |++.+|+.++-..++...--..+|+.
T Consensus        18 i~~~~d~~~ps~~~~~~~~~------~~~~~~~g~~~~~~~~~~~~~~~~~~   63 (412)
T COG5068          18 IQGDSDANIPSNTINRLSPG------ELSQQNDGKFDVMIFDSKHSVRVYSN   63 (412)
T ss_pred             cccccccCCccccccccCcc------cchhhccCCcccccccccccccccCC
Confidence            77788888889999999999      99999999888777665545555555


No 45 
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after the Threonyl-tRNA Synthetase, GTPase, and SpoT proteins where it occurs.  The function of the TGS domain is unknown.
Probab=24.04  E-value=1.3e+02  Score=16.04  Aligned_cols=24  Identities=13%  Similarity=0.380  Sum_probs=18.3

Q ss_pred             EEecCCCceeeccC-CchHHHHHHh
Q 034367           46 IIFSATGKLFEYSS-SSMKEILEKH   69 (96)
Q Consensus        46 iv~~~~g~~~~~~s-~~~~~vl~ry   69 (96)
                      .||-|+|..+.++. .++.+++...
T Consensus         2 ~~~~~~g~~~~~~~~~t~~~~~~~~   26 (60)
T cd01668           2 YVFTPKGEIIELPAGATVLDFAYAI   26 (60)
T ss_pred             EEECCCCCEEEcCCCCCHHHHHHHH
Confidence            57888899999887 6777777643


No 46 
>PF07676 PD40:  WD40-like Beta Propeller Repeat;  InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This region appears to be related to the IPR001680 from INTERPRO repeat. This model is likely to miss copies within a sequence.; PDB: 2HQS_D 1C5K_A 2IVZ_A 2W8B_D 3IAX_A 1CRZ_A 1N6F_D 1N6D_C 1N6E_C 1K32_A ....
Probab=23.40  E-value=93  Score=15.35  Aligned_cols=18  Identities=28%  Similarity=0.368  Sum_probs=12.8

Q ss_pred             ceEEEEecCCCceeeccC
Q 034367           42 DVALIIFSATGKLFEYSS   59 (96)
Q Consensus        42 ~v~liv~~~~g~~~~~~s   59 (96)
                      .-.-..++|+|+-..|.+
T Consensus        10 ~~~~p~~SpDGk~i~f~s   27 (39)
T PF07676_consen   10 DDGSPAWSPDGKYIYFTS   27 (39)
T ss_dssp             SEEEEEE-TTSSEEEEEE
T ss_pred             cccCEEEecCCCEEEEEe
Confidence            445567899999888876


No 47 
>PRK09732 hypothetical protein; Provisional
Probab=23.22  E-value=1.4e+02  Score=19.92  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=23.4

Q ss_pred             hhhhhHhhhhccccceEEEEecCCCceeecc
Q 034367           28 IFKKAEELSVLCDADVALIIFSATGKLFEYS   58 (96)
Q Consensus        28 L~kKa~Els~LC~~~v~liv~~~~g~~~~~~   58 (96)
                      +..-|.+.+.-=|..|++.|++.+|.+..|.
T Consensus        15 ~~~aA~~~A~~~g~~v~iaVvD~~G~l~a~~   45 (134)
T PRK09732         15 IIAAGQEEAQKNNWSVSIAVADDGGHLLALS   45 (134)
T ss_pred             HHHHHHHHHHHhCCCEEEEEEcCCCCEEEEE
Confidence            3445555666668899999999999987764


No 48 
>cd01284 Riboflavin_deaminase-reductase Riboflavin-specific deaminase. Riboflavin biosynthesis protein RibD (Diaminohydroxyphosphoribosylaminopyrimidine deaminase) catalyzes the deamination of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, which is an intermediate step in the biosynthesis of riboflavin.The ribG gene of Bacillus subtilis and the ribD gene of E. coli are bifunctional and contain this deaminase domain and a reductase domain which catalyzes the subsequent reduction of the ribosyl side chain.
Probab=21.86  E-value=1.3e+02  Score=19.34  Aligned_cols=28  Identities=21%  Similarity=0.368  Sum_probs=20.3

Q ss_pred             hhhhHhhhhcc------ccceEEEEecCCCceee
Q 034367           29 FKKAEELSVLC------DADVALIIFSATGKLFE   56 (96)
Q Consensus        29 ~kKa~Els~LC------~~~v~liv~~~~g~~~~   56 (96)
                      |+.|.|++-.+      +..|+-++++++|.+..
T Consensus         1 m~~al~~A~~~~~~~~~~~pvGaviv~~~g~iv~   34 (115)
T cd01284           1 MRRALELAEKGRGLTSPNPPVGCVIVDDDGEIVG   34 (115)
T ss_pred             CHHHHHHHHhcccccCCCCCEEEEEEeCCCeEEE
Confidence            45677777766      66888888887787654


No 49 
>PTZ00366 Surface antigen  (SAG) superfamily; Provisional
Probab=21.10  E-value=51  Score=26.18  Aligned_cols=28  Identities=32%  Similarity=0.482  Sum_probs=22.0

Q ss_pred             cccccccccchhhhhhHhhhhccccceE
Q 034367           17 RQVTFSKRRRGIFKKAEELSVLCDADVA   44 (96)
Q Consensus        17 R~~tf~kRk~gL~kKa~Els~LC~~~v~   44 (96)
                      |...-.+|+.|+--||++|.-.|=.-|.
T Consensus         3 r~~~~~~r~~g~~s~a~kl~avc~~gvl   30 (392)
T PTZ00366          3 RTGRMQQRRGGFRSKARKLMAVCMGGVL   30 (392)
T ss_pred             cccchhhcccccccchhhhheeeeeeEE
Confidence            4555678999999999999999944333


No 50 
>PF01996 F420_ligase:  F420-0:Gamma-glutamyl ligase;  InterPro: IPR002847 This entry contains F420-0:gamma-glutamyl ligase and related proteins. F420-0:gamma-glutamyl ligase catalyzes the GTP-dependent successive addition of multiple gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0) to form polyglutamated F420 derivatives [, , , ].; PDB: 2G9I_A 2PHN_A.
Probab=20.78  E-value=25  Score=25.52  Aligned_cols=27  Identities=30%  Similarity=0.443  Sum_probs=18.4

Q ss_pred             HhhhhccccceEEEEecCCCceeeccC
Q 034367           33 EELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        33 ~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      .+|.-.+|.+|++||.+++|.++..++
T Consensus       141 ~~l~~~~g~~v~ViI~Dt~gr~~r~G~  167 (228)
T PF01996_consen  141 EELKERTGKDVGVIITDTNGRPWRLGQ  167 (228)
T ss_dssp             HHHHHHHS---EEEEEEEEEETTEECE
T ss_pred             HHHHHHHCCceEEEEECCCCcEEecCC
Confidence            567778999999999998886655443


No 51 
>PRK13294 F420-0--gamma-glutamyl ligase; Provisional
Probab=20.67  E-value=89  Score=25.07  Aligned_cols=27  Identities=19%  Similarity=0.319  Sum_probs=22.0

Q ss_pred             HhhhhccccceEEEEecCCCceeeccC
Q 034367           33 EELSVLCDADVALIIFSATGKLFEYSS   59 (96)
Q Consensus        33 ~Els~LC~~~v~liv~~~~g~~~~~~s   59 (96)
                      .+|.-.+|++|+|||.+..|.++--+.
T Consensus       134 ~~l~~~~g~~v~vii~Dt~gr~~r~g~  160 (448)
T PRK13294        134 AGLRERLGVDVAVVVTDTMGRAWRNGQ  160 (448)
T ss_pred             HHHHHHHCCCEEEEEecCCCCccccCc
Confidence            457778999999999998888776554


No 52 
>COG3411 Ferredoxin [Energy production and conversion]
Probab=20.36  E-value=1.4e+02  Score=17.83  Aligned_cols=28  Identities=11%  Similarity=0.334  Sum_probs=19.9

Q ss_pred             EEEecCCCceeeccC-CchHHHHHHhhhc
Q 034367           45 LIIFSATGKLFEYSS-SSMKEILEKHRVH   72 (96)
Q Consensus        45 liv~~~~g~~~~~~s-~~~~~vl~ry~~~   72 (96)
                      ++++-|+|-.|..-+ ++++.|++....-
T Consensus        19 vl~vYpegvWY~~V~p~~a~rIv~~hl~~   47 (64)
T COG3411          19 VLVVYPEGVWYTRVDPEDARRIVQSHLLG   47 (64)
T ss_pred             EEEEecCCeeEeccCHHHHHHHHHHHHhC
Confidence            445567787777666 6899999877663


No 53 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=20.23  E-value=2.3e+02  Score=17.64  Aligned_cols=43  Identities=16%  Similarity=0.210  Sum_probs=31.5

Q ss_pred             chhhhhhHhhhhccccceEEEEecCCCceeeccC-CchHHHHHH
Q 034367           26 RGIFKKAEELSVLCDADVALIIFSATGKLFEYSS-SSMKEILEK   68 (96)
Q Consensus        26 ~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s-~~~~~vl~r   68 (96)
                      .+|..|-.+|--|....++|--.+.+|...+-+| .+++++...
T Consensus        23 ~~L~~kl~~Lf~lp~~~~~vtYiDeD~D~ITlssd~eL~d~~~~   66 (82)
T cd06397          23 EALASKLENLYNLPEIKVGVTYIDNDNDEITLSSNKELQDFYRL   66 (82)
T ss_pred             HHHHHHHHHHhCCChhHeEEEEEcCCCCEEEecchHHHHHHHHh
Confidence            5788888888888766566555777888888887 567766553


No 54 
>PF06020 Roughex:  Drosophila roughex protein;  InterPro: IPR009259 This family consists of several roughex (RUX) proteins specific to Drosophila species. Roughex can influence the intracellular distribution of cyclin A and is therefore defined as a distinct and specialised cell cycle inhibitor for cyclin A-dependent kinase activity []. Rux is though to regulate the metaphase to anaphase transition during development [].
Probab=20.03  E-value=52  Score=25.42  Aligned_cols=15  Identities=7%  Similarity=0.359  Sum_probs=12.6

Q ss_pred             hhccccceEEEEecC
Q 034367           36 SVLCDADVALIIFSA   50 (96)
Q Consensus        36 s~LC~~~v~liv~~~   50 (96)
                      .-+||.+|||+||..
T Consensus       183 ~~~~~~EICLavYek  197 (334)
T PF06020_consen  183 GQVSGFEICLAVYEK  197 (334)
T ss_pred             CccccceEEeeehhh
Confidence            357899999999985


Done!