BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034370
(96 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From
Arabidopsis Thaliana
pdb|2XTZ|B Chain B, Crystal Structure Of The G Alpha Protein Atgpa1 From
Arabidopsis Thaliana
pdb|2XTZ|C Chain C, Crystal Structure Of The G Alpha Protein Atgpa1 From
Arabidopsis Thaliana
Length = 354
Score = 26.2 bits (56), Expect = 5.1, Method: Composition-based stats.
Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 5/58 (8%)
Query: 44 LRCLSPTCYEFVYES-DPLEEGEKDFVR----SQEFKYCMHKLSLGESLEGIRGSFDY 96
L+ P + VY++ L +G K+F + S ++ +++GE L I G DY
Sbjct: 42 LKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDY 99
>pdb|4HPQ|C Chain C, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
pdb|4HPQ|F Chain F, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
Length = 413
Score = 25.4 bits (54), Expect = 8.4, Method: Composition-based stats.
Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 12/50 (24%)
Query: 22 DWISGLWGPQCKSSMIAKENCALRCLSPTCYEFVYESDPLEEGEKDFVRS 71
D S +G QC+ ++ E EF E+D LE+ DF++S
Sbjct: 175 DEFSSKFGDQCRENLKLNE------------EFTNEADQLEQELADFLKS 212
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.142 0.478
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,941,572
Number of Sequences: 62578
Number of extensions: 98273
Number of successful extensions: 253
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 252
Number of HSP's gapped (non-prelim): 3
length of query: 96
length of database: 14,973,337
effective HSP length: 62
effective length of query: 34
effective length of database: 11,093,501
effective search space: 377179034
effective search space used: 377179034
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)