BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034370
         (96 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From
          Arabidopsis Thaliana
 pdb|2XTZ|B Chain B, Crystal Structure Of The G Alpha Protein Atgpa1 From
          Arabidopsis Thaliana
 pdb|2XTZ|C Chain C, Crystal Structure Of The G Alpha Protein Atgpa1 From
          Arabidopsis Thaliana
          Length = 354

 Score = 26.2 bits (56), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 44 LRCLSPTCYEFVYES-DPLEEGEKDFVR----SQEFKYCMHKLSLGESLEGIRGSFDY 96
          L+   P  +  VY++   L +G K+F +    S ++      +++GE L  I G  DY
Sbjct: 42 LKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDY 99


>pdb|4HPQ|C Chain C, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
 pdb|4HPQ|F Chain F, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
          Length = 413

 Score = 25.4 bits (54), Expect = 8.4,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 12/50 (24%)

Query: 22  DWISGLWGPQCKSSMIAKENCALRCLSPTCYEFVYESDPLEEGEKDFVRS 71
           D  S  +G QC+ ++   E            EF  E+D LE+   DF++S
Sbjct: 175 DEFSSKFGDQCRENLKLNE------------EFTNEADQLEQELADFLKS 212


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.142    0.478 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,941,572
Number of Sequences: 62578
Number of extensions: 98273
Number of successful extensions: 253
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 252
Number of HSP's gapped (non-prelim): 3
length of query: 96
length of database: 14,973,337
effective HSP length: 62
effective length of query: 34
effective length of database: 11,093,501
effective search space: 377179034
effective search space used: 377179034
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)