BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034377
         (96 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3K4U|A Chain A, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
 pdb|3K4U|B Chain B, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
 pdb|3K4U|C Chain C, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
 pdb|3K4U|D Chain D, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
 pdb|3K4U|E Chain E, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
 pdb|3K4U|F Chain F, Crystal Structure Of Putative Binding Component Of Abc
          Transporter From Wolinella Succinogenes Dsm 1740
          Complexed With Lysine
          Length = 245

 Score = 26.2 bits (56), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 11 NLSPGMVTT--DLLMSGATTKQAKFFINVLAEPADVVAECLVPK 52
           L PG+VT   D+++SG T  Q +       EP  VV + L+ K
Sbjct: 55 GLIPGLVTEKFDIIISGXTISQERNLRVNFVEPYIVVGQSLLVK 98


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.134    0.375 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,435,699
Number of Sequences: 62578
Number of extensions: 74364
Number of successful extensions: 143
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 142
Number of HSP's gapped (non-prelim): 2
length of query: 96
length of database: 14,973,337
effective HSP length: 62
effective length of query: 34
effective length of database: 11,093,501
effective search space: 377179034
effective search space used: 377179034
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)