BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034382
         (96 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DNS|A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60
           Provides Insight Into The Various Cross-Allergenicity Of
           The Pollen Group 4 Allergens
 pdb|4DNS|B Chain B, Crystal Structure Of Bermuda Grass Isoallergen Bg60
           Provides Insight Into The Various Cross-Allergenicity Of
           The Pollen Group 4 Allergens
          Length = 497

 Score = 27.3 bits (59), Expect = 2.1,   Method: Composition-based stats.
 Identities = 11/16 (68%), Positives = 12/16 (75%)

Query: 58  GLQATAWVSVGAQIGD 73
           G  ATAWV  GAQ+GD
Sbjct: 118 GKAATAWVDSGAQLGD 133


>pdb|3BXJ|A Chain A, Crystal Structure Of The C2-Gap Fragment Of Syngap
 pdb|3BXJ|B Chain B, Crystal Structure Of The C2-Gap Fragment Of Syngap
          Length = 483

 Score = 25.8 bits (55), Expect = 5.8,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 12 ARRLSNTSLRYWIIEFLRRQPKERQYRALVL 42
          +RR+ N  L+ WIIE     PK+R Y  L L
Sbjct: 6  SRRVDNV-LKLWIIEARELPPKKRYYCELCL 35


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,319,153
Number of Sequences: 62578
Number of extensions: 68087
Number of successful extensions: 328
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 325
Number of HSP's gapped (non-prelim): 4
length of query: 96
length of database: 14,973,337
effective HSP length: 62
effective length of query: 34
effective length of database: 11,093,501
effective search space: 377179034
effective search space used: 377179034
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)