Citrus Sinensis ID: 034382

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MASIVNMQTRIARRLSNTSLRYWIIEFLRRQPKERQYRALVLRFIKDRTAALLLVEVGLQATAWVSVGAQIGDEVEVKVEEAHPRDDIIYLKEVVR
cccEEHHHHHHHHHHHHccccHHHHHHHHHcccccEEEEEEEEEEEcccEEEEEEEcEEEEEEEEEcccccccEEEEEEEECcccccEEEEEEEcc
*********RIARRLSNTSLRYWIIEFLRRQPKERQYRALVLRFIKDRTAALLLVEVGLQATAWVSVGAQIGDEVEVKVEEAHPRDDIIYLKEVVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIVNMQTRIARRLSNTSLRYWIIEFLRRQPKERQYRALVLRFIKDRTAALLLVEVGLQATAWVSVGAQIGDEVEVKVEEAHPRDDIIYLKEVVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonuclease II, chloroplastic/mitochondrial 3'-5' exoribonuclease that catalyzes 3' maturation of chloroplast and mitochondrion ribosomal RNAs; degrades short nucleotidic extensions to generate the mature 3'-ends. Involved in the maturation of 23S, 16S and 5S rRNAs.probableQ6NQJ6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R7D, chain A
Confidence level:very confident
Coverage over the Query: 2-95
View the alignment between query and template
View the model in PyMOL