Citrus Sinensis ID: 034390


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQVSGLGFAYF
cccccEEEEEEcccccccEEEEcccccHHHHHHHHHEEEccEEEEEEEcccccEEEEcccHHHHHHHHHHHccHHccccccccccccccccccccc
***EKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHR********************L*FAYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQVSGLGFAYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box protein SVP Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes.probableQ9FVC1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL