Query         034394
Match_columns 96
No_of_seqs    15 out of 17
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 12:59:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034394.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034394hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK05886 yajC preprotein trans  79.8    0.76 1.6E-05   32.5   0.6   28   27-54      5-32  (109)
  2 PF15141 DUF4574:  Domain of un  77.0     1.4 3.1E-05   30.5   1.3   34   20-53      1-36  (84)
  3 PF05057 DUF676:  Putative seri  75.0    0.68 1.5E-05   33.6  -0.7   12   14-25     81-92  (217)
  4 COG1862 YajC Preprotein transl  69.1     2.8 6.1E-05   29.1   1.3   33   25-57      8-40  (97)
  5 TIGR00739 yajC preprotein tran  67.0     5.2 0.00011   26.5   2.2   27   28-54      5-31  (84)
  6 PRK05585 yajC preprotein trans  62.3     4.1 8.9E-05   28.2   1.0   30   27-56     19-48  (106)
  7 smart00318 SNc Staphylococcal   59.8      21 0.00046   23.4   4.1   24   25-48     90-113 (138)
  8 PF02699 YajC:  Preprotein tran  56.7     1.7 3.7E-05   28.4  -1.5   28   27-54      3-30  (82)
  9 PF04612 T2SM:  Type II secreti  52.0     4.8  0.0001   27.3   0.0   29   29-57     21-49  (160)
 10 PRK06518 hypothetical protein;  50.4      24 0.00052   26.2   3.5   22   25-46    110-131 (177)
 11 PRK06531 yajC preprotein trans  47.7      16 0.00034   25.9   2.1   26   28-54      5-30  (113)
 12 PF14283 DUF4366:  Domain of un  45.1      16 0.00035   28.2   1.9   18   34-51    172-190 (218)
 13 cd00175 SNc Staphylococcal nuc  41.0      65  0.0014   20.7   4.1   22   26-47     83-104 (129)
 14 PTZ00046 rifin; Provisional     39.4     8.2 0.00018   32.4  -0.5   36   17-54    141-176 (358)
 15 PF05728 UPF0227:  Uncharacteri  37.3     7.1 0.00015   28.7  -1.0   30   14-50     62-93  (187)
 16 PF11760 CbiG_N:  Cobalamin syn  36.0      20 0.00044   24.3   1.1   27   13-39     48-74  (84)
 17 PF07819 PGAP1:  PGAP1-like pro  36.0     8.7 0.00019   28.4  -0.7   12   15-26     89-100 (225)
 18 PRK09697 protein secretion pro  35.9     3.6 7.7E-05   31.0  -2.8   44   33-81     45-93  (139)
 19 PF13132 DUF3950:  Domain of un  35.8      20 0.00044   21.0   0.9   10   25-34     13-22  (30)
 20 COG3389 Uncharacterized protei  32.2      18 0.00039   29.9   0.4   24   25-48     89-112 (277)
 21 PLN02965 Probable pheophorbida  32.0      12 0.00027   26.2  -0.5   11   14-24     75-85  (255)
 22 PF07225 NDUF_B4:  NADH-ubiquin  30.2      24 0.00052   25.5   0.7   34   48-85     23-57  (125)
 23 PF09819 ABC_cobalt:  ABC-type   27.3      16 0.00035   26.1  -0.5   25   29-53     44-68  (129)
 24 PRK07718 fliL flagellar basal   27.1      15 0.00033   25.8  -0.7   23   30-52     14-36  (142)
 25 PRK11126 2-succinyl-6-hydroxy-  27.1      12 0.00027   25.2  -1.1   10   14-23     69-78  (242)
 26 PF14960 ATP_synth_reg:  ATP sy  27.0      25 0.00055   22.3   0.4   25   23-47     22-48  (49)
 27 PRK08775 homoserine O-acetyltr  26.8      13 0.00029   27.8  -1.1   10   14-23    141-150 (343)
 28 PLN02211 methyl indole-3-aceta  26.2      16 0.00034   26.8  -0.8   11   14-24     90-100 (273)
 29 PF13906 AA_permease_C:  C-term  26.1      28  0.0006   21.4   0.4   15   29-43     32-46  (51)
 30 KOG4040 NADH:ubiquinone oxidor  25.1      41 0.00089   26.5   1.3   41   45-90     37-77  (186)
 31 COG1565 Uncharacterized conser  24.6      72  0.0016   27.1   2.7   47   40-88    111-157 (370)
 32 PF13706 PepSY_TM_3:  PepSY-ass  24.0      26 0.00057   19.9   0.0   18   29-49     19-36  (37)
 33 PF11943 DUF3460:  Protein of u  23.8      46 0.00099   21.8   1.1   26   42-68     32-57  (60)
 34 PF13396 PLDc_N:  Phospholipase  23.4      93   0.002   17.5   2.3   23   24-46     17-46  (46)
 35 PF11167 DUF2953:  Protein of u  23.2      11 0.00025   22.2  -1.7   11   76-86      6-16  (53)
 36 COG1525 Micrococcal nuclease (  22.8 2.3E+02   0.005   20.0   4.6   20   24-43    127-146 (192)
 37 PHA00431 internal virion prote  21.3      53  0.0012   30.4   1.4   54    1-54      1-72  (746)
 38 PRK07581 hypothetical protein;  21.0      19 0.00041   26.5  -1.2   12   14-25    127-138 (339)
 39 PRK09689 prophage protein NinE  20.3      45 0.00097   22.0   0.6   12   70-81     20-31  (56)

No 1  
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=79.81  E-value=0.76  Score=32.50  Aligned_cols=28  Identities=4%  Similarity=0.018  Sum_probs=21.3

Q ss_pred             chHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394           27 ANLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      ..+.-+++..++-|||.++|.|.+++|+
T Consensus         5 ~~ll~lv~i~~i~yF~~iRPQkKr~K~~   32 (109)
T PRK05886          5 VLFLPFLLIMGGFMYFASRRQRKAMQAT   32 (109)
T ss_pred             HHHHHHHHHHHHHHHHHccHHHHHHHHH
Confidence            4566677778888999999986665554


No 2  
>PF15141 DUF4574:  Domain of unknown function (DUF4574)
Probab=76.99  E-value=1.4  Score=30.52  Aligned_cols=34  Identities=26%  Similarity=0.513  Sum_probs=21.9

Q ss_pred             ccccCCcchHHHHHHhhhheeeEEE--cCchhhHHH
Q 034394           20 MGGVRGGANLASWVVAGTLAYYLWV--KPSQDLKRE   53 (96)
Q Consensus        20 mgG~RG~~nlAaW~VAG~lAYylwv--kPe~~~~~e   53 (96)
                      |+++|=--+..+=+-+||++|.||+  .|..+.++|
T Consensus         1 M~~~r~~~~~~~llG~GGvG~~L~~LvtPgeerK~e   36 (84)
T PF15141_consen    1 MSSLRKALSVVALLGFGGVGYALFVLVTPGEERKQE   36 (84)
T ss_pred             CchHHHHHHHHHHHHccchhheeeeEeCCcHHHHHH
Confidence            4455544555666678999999986  466654433


No 3  
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=74.95  E-value=0.68  Score=33.55  Aligned_cols=12  Identities=50%  Similarity=1.060  Sum_probs=10.4

Q ss_pred             hhhhhcccccCC
Q 034394           14 SFVGNSMGGVRG   25 (96)
Q Consensus        14 sfi~n~mgG~RG   25 (96)
                      ||||.||||+--
T Consensus        81 sfIgHSLGGli~   92 (217)
T PF05057_consen   81 SFIGHSLGGLIA   92 (217)
T ss_pred             eEEEecccHHHH
Confidence            899999999843


No 4  
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=69.14  E-value=2.8  Score=29.10  Aligned_cols=33  Identities=24%  Similarity=0.403  Sum_probs=25.9

Q ss_pred             CcchHHHHHHhhhheeeEEEcCchhhHHHHHHH
Q 034394           25 GGANLASWVVAGTLAYYLWVKPSQDLKREQEER   57 (96)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~R   57 (96)
                      +.+.+.--++..++-|||.++|.|...+|.++.
T Consensus         8 ~~~~ll~~vl~~~ifyFli~RPQrKr~K~~~~m   40 (97)
T COG1862           8 GLVLLLPLVLIFAIFYFLIIRPQRKRMKEHQEL   40 (97)
T ss_pred             cHHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHH
Confidence            345677788899999999999988777666554


No 5  
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=67.02  E-value=5.2  Score=26.51  Aligned_cols=27  Identities=19%  Similarity=0.452  Sum_probs=19.2

Q ss_pred             hHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394           28 NLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      .|.-.++...+-|||.++|.+.+++++
T Consensus         5 ~l~~~vv~~~i~yf~~~rpqkK~~k~~   31 (84)
T TIGR00739         5 TLLPLVLIFLIFYFLIIRPQRKRRKAH   31 (84)
T ss_pred             HHHHHHHHHHHHHHheechHHHHHHHH
Confidence            345556667778999999987665555


No 6  
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=62.34  E-value=4.1  Score=28.18  Aligned_cols=30  Identities=27%  Similarity=0.512  Sum_probs=22.1

Q ss_pred             chHHHHHHhhhheeeEEEcCchhhHHHHHH
Q 034394           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEE   56 (96)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (96)
                      ..+.-+++...+-|||-++|.+.+++++++
T Consensus        19 ~~ll~lvii~~i~yf~~~RpqkK~~k~~~~   48 (106)
T PRK05585         19 SSLLPLVVFFAIFYFLIIRPQQKRQKEHKK   48 (106)
T ss_pred             HHHHHHHHHHHHHHHHhccHHHHHHHHHHH
Confidence            456667777778899999998877766533


No 7  
>smart00318 SNc Staphylococcal nuclease homologues.
Probab=59.76  E-value=21  Score=23.38  Aligned_cols=24  Identities=29%  Similarity=0.295  Sum_probs=19.7

Q ss_pred             CcchHHHHHHhhhheeeEEEcCch
Q 034394           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (96)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (96)
                      ++.|++.++|.-|+|+.....+..
T Consensus        90 ~~~~l~~~Lv~~G~A~~~~~~~~~  113 (138)
T smart00318       90 GGNNIAEELVKEGLAKVYRYADKD  113 (138)
T ss_pred             CCCcHHHHHHhcCCEEEEEecCcc
Confidence            457899999999999988776553


No 8  
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=56.69  E-value=1.7  Score=28.38  Aligned_cols=28  Identities=21%  Similarity=0.497  Sum_probs=20.3

Q ss_pred             chHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394           27 ANLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      ..+.-.++...+-|||.++|.+.+++|+
T Consensus         3 ~~li~lv~~~~i~yf~~~rpqkk~~k~~   30 (82)
T PF02699_consen    3 SMLIPLVIIFVIFYFLMIRPQKKQQKEH   30 (82)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhheecHHHHHHHHH
Confidence            3566677778888999999987555544


No 9  
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=52.04  E-value=4.8  Score=27.32  Aligned_cols=29  Identities=17%  Similarity=0.268  Sum_probs=0.0

Q ss_pred             HHHHHHhhhheeeEEEcCchhhHHHHHHH
Q 034394           29 LASWVVAGTLAYYLWVKPSQDLKREQEER   57 (96)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eqe~R   57 (96)
                      +++.+++..+.|++.+.|-.+..+..+++
T Consensus        21 ~~~~~l~~~l~~~~~~~P~~~~~~~~~~~   49 (160)
T PF04612_consen   21 VLGVVLLLALLYLLLWQPLLERRDQLQQQ   49 (160)
T ss_dssp             -----------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35678888999999999988777665443


No 10 
>PRK06518 hypothetical protein; Provisional
Probab=50.38  E-value=24  Score=26.24  Aligned_cols=22  Identities=18%  Similarity=0.133  Sum_probs=18.1

Q ss_pred             CcchHHHHHHhhhheeeEEEcC
Q 034394           25 GGANLASWVVAGTLAYYLWVKP   46 (96)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkP   46 (96)
                      ++.+|..++|.-|+|+.....+
T Consensus       110 ~g~dln~~mV~~G~A~ay~~~~  131 (177)
T PRK06518        110 DGVDIAALGLAEGMAVLSKDDH  131 (177)
T ss_pred             CCEEHHHHHHhCCCEEEEeecc
Confidence            4679999999999998766544


No 11 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=47.71  E-value=16  Score=25.94  Aligned_cols=26  Identities=15%  Similarity=0.289  Sum_probs=15.3

Q ss_pred             hHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394           28 NLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      .+.-.++..++-| |.++|.|.+++++
T Consensus         5 ~il~~vv~~~i~y-f~iRPQkKr~Ke~   30 (113)
T PRK06531          5 TIIMFVVMLGLIF-FMQRQQKKQAQER   30 (113)
T ss_pred             HHHHHHHHHHHHH-heechHHHHHHHH
Confidence            3444455555655 4689976665554


No 12 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=45.09  E-value=16  Score=28.18  Aligned_cols=18  Identities=39%  Similarity=0.787  Sum_probs=10.7

Q ss_pred             HhhhheeeE-EEcCchhhH
Q 034394           34 VAGTLAYYL-WVKPSQDLK   51 (96)
Q Consensus        34 VAG~lAYyl-wvkPe~~~~   51 (96)
                      .+||.+||| ++||-++.+
T Consensus       172 ~gGGa~yYfK~~K~K~~~~  190 (218)
T PF14283_consen  172 IGGGAYYYFKFYKPKQEEK  190 (218)
T ss_pred             hhcceEEEEEEeccccccc
Confidence            445555555 778866544


No 13 
>cd00175 SNc Staphylococcal nuclease homologues. SNase homologues are found in bacteria, archaea, and eukaryotes. They contain no disufide bonds.
Probab=40.97  E-value=65  Score=20.74  Aligned_cols=22  Identities=32%  Similarity=0.323  Sum_probs=19.2

Q ss_pred             cchHHHHHHhhhheeeEEEcCc
Q 034394           26 GANLASWVVAGTLAYYLWVKPS   47 (96)
Q Consensus        26 ~~nlAaW~VAG~lAYylwvkPe   47 (96)
                      +.|++.++|.-|+|...-..+.
T Consensus        83 ~~~v~~~Lv~~G~A~~~~~~~~  104 (129)
T cd00175          83 GENIAEELVKEGLARVYRYYPD  104 (129)
T ss_pred             CCcHHHHHHhcCCEEEEEECCC
Confidence            5799999999999998877764


No 14 
>PTZ00046 rifin; Provisional
Probab=39.39  E-value=8.2  Score=32.37  Aligned_cols=36  Identities=22%  Similarity=0.337  Sum_probs=25.5

Q ss_pred             hhcccccCCcchHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394           17 GNSMGGVRGGANLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus        17 ~n~mgG~RG~~nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      -++-+|| | .=..+|++-||+||+-|..-......+.
T Consensus       141 LkCG~~L-G-gVaP~~Gliggi~~~~Wk~~a~~aA~~a  176 (358)
T PTZ00046        141 LRCGCGL-G-GVAPSWGLIGGIAVNAWKKAALAAAIKA  176 (358)
T ss_pred             HhcCCcc-c-cccccccccchHHHHHHHHHHHHHHHHH
Confidence            3555666 5 4678999999999999976555544443


No 15 
>PF05728 UPF0227:  Uncharacterised protein family (UPF0227);  InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO. One of the members of this family YqiA has been shown to be a esterase []. Other members, which include the Escherichia coli (strain K12) YcfP protein are uncharacterised.
Probab=37.31  E-value=7.1  Score=28.66  Aligned_cols=30  Identities=27%  Similarity=0.609  Sum_probs=17.6

Q ss_pred             hhhhhcccccCCcchHHHHHHh--hhheeeEEEcCchhh
Q 034394           14 SFVGNSMGGVRGGANLASWVVA--GTLAYYLWVKPSQDL   50 (96)
Q Consensus        14 sfi~n~mgG~RG~~nlAaW~VA--G~lAYylwvkPe~~~   50 (96)
                      -+||.||||+     +|.|.-.  |.=+  +.+-|.-.-
T Consensus        62 ~liGSSlGG~-----~A~~La~~~~~~a--vLiNPav~p   93 (187)
T PF05728_consen   62 VLIGSSLGGF-----YATYLAERYGLPA--VLINPAVRP   93 (187)
T ss_pred             EEEEEChHHH-----HHHHHHHHhCCCE--EEEcCCCCH
Confidence            5799999998     4444421  2223  556665543


No 16 
>PF11760 CbiG_N:  Cobalamin synthesis G N-terminal;  InterPro: IPR021744  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. Within the cobalamin synthesis pathway CbiG catalyses the both the opening of the lactone ring and the extrusion of the two-carbon fragment of cobalt-precorrin-5A from C-20 and its associated methyl group (deacylation) to give cobalt-precorrin-5B. The N-terminal of the enzyme is conserved in this family, and the C-terminal and the mid-sections are conserved independently in other families, CbiG_C and CbiG_mid, although the distinct function of each region is unclear. ; PDB: 3EEQ_B.
Probab=36.00  E-value=20  Score=24.26  Aligned_cols=27  Identities=41%  Similarity=0.516  Sum_probs=20.0

Q ss_pred             hhhhhhcccccCCcchHHHHHHhhhhe
Q 034394           13 RSFVGNSMGGVRGGANLASWVVAGTLA   39 (96)
Q Consensus        13 rsfi~n~mgG~RG~~nlAaW~VAG~lA   39 (96)
                      -+|+.-.+||-+|+.|-.|.-+|-.|.
T Consensus        48 g~~vIplL~GH~GGan~lA~~iA~~lg   74 (84)
T PF11760_consen   48 GRFVIPLLGGHRGGANELARQIAELLG   74 (84)
T ss_dssp             --EEEEEE-TTTT-HHHHHHHHHHHTT
T ss_pred             CCEEEEeccCCcchHHHHHHHHHHHhC
Confidence            368888999999999999999887653


No 17 
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=35.99  E-value=8.7  Score=28.41  Aligned_cols=12  Identities=50%  Similarity=0.894  Sum_probs=9.7

Q ss_pred             hhhhcccccCCc
Q 034394           15 FVGNSMGGVRGG   26 (96)
Q Consensus        15 fi~n~mgG~RG~   26 (96)
                      +||.||||+--+
T Consensus        89 lVgHSmGGlvar  100 (225)
T PF07819_consen   89 LVGHSMGGLVAR  100 (225)
T ss_pred             EEEEchhhHHHH
Confidence            789999998544


No 18 
>PRK09697 protein secretion protein GspB; Provisional
Probab=35.86  E-value=3.6  Score=30.95  Aligned_cols=44  Identities=27%  Similarity=0.382  Sum_probs=27.7

Q ss_pred             HHhhhheeeEEEcCchhhHHHHHHHHHHHc-----cCCCcceeeccCCCCCccc
Q 034394           33 VVAGTLAYYLWVKPSQDLKREQEERAALAA-----LDPNRYVEKRKPIPDPQET   81 (96)
Q Consensus        33 ~VAG~lAYylwvkPe~~~~~eqe~RAAlA~-----~d~~rYVEkrkpipdpq~t   81 (96)
                      +|.||-||-||+.=--+     +++--.+.     ..+-.||=|.+|.|-|.+.
T Consensus        45 ~~~GGYA~Qlwvlw~~k-----~~~T~~~~tP~~~Qs~qH~~FKKqPLPV~E~V   93 (139)
T PRK09697         45 VLVGGYARQLWVLWIVK-----AEVTVEAETPAFKQSTQHYFFKKQPLPVVESV   93 (139)
T ss_pred             eeechhHHHHHHHHHHh-----hhheecCCCcchhhhhhheeeecCCCCCcccc
Confidence            56789999988753222     22222222     3345699999999988654


No 19 
>PF13132 DUF3950:  Domain of unknown function (DUF3950)
Probab=35.83  E-value=20  Score=21.03  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=8.6

Q ss_pred             CcchHHHHHH
Q 034394           25 GGANLASWVV   34 (96)
Q Consensus        25 G~~nlAaW~V   34 (96)
                      |..|+.|||.
T Consensus        13 ~~~NFSaWV~   22 (30)
T PF13132_consen   13 GSGNFSAWVK   22 (30)
T ss_pred             cCcChHHHHH
Confidence            5789999986


No 20 
>COG3389 Uncharacterized protein conserved in archaea [Function unknown]
Probab=32.22  E-value=18  Score=29.92  Aligned_cols=24  Identities=33%  Similarity=0.303  Sum_probs=21.0

Q ss_pred             CcchHHHHHHhhhheeeEEEcCch
Q 034394           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (96)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (96)
                      +.-|++||.+|-++-|-|+.+||=
T Consensus        89 ~~i~~~si~~aI~~~~lL~~~peW  112 (277)
T COG3389          89 YAINIASIGLAIGLVYLLYKYPEW  112 (277)
T ss_pred             HHHHHHHHHHHHHHHHhhhhccce
Confidence            346999999999999999999973


No 21 
>PLN02965 Probable pheophorbidase
Probab=32.04  E-value=12  Score=26.21  Aligned_cols=11  Identities=45%  Similarity=0.782  Sum_probs=9.0

Q ss_pred             hhhhhcccccC
Q 034394           14 SFVGNSMGGVR   24 (96)
Q Consensus        14 sfi~n~mgG~R   24 (96)
                      -+||+||||.-
T Consensus        75 ~lvGhSmGG~i   85 (255)
T PLN02965         75 ILVGHSIGGGS   85 (255)
T ss_pred             EEEecCcchHH
Confidence            57899999973


No 22 
>PF07225 NDUF_B4:  NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4);  InterPro: IPR009866  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family contains human NADH-ubiquinone oxidoreductase subunit NDUFB4 and related sequences.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=30.20  E-value=24  Score=25.55  Aligned_cols=34  Identities=41%  Similarity=0.635  Sum_probs=21.3

Q ss_pred             hhhHHHHHHHHHHHc-cCCCcceeeccCCCCCcccceee
Q 034394           48 QDLKREQEERAALAA-LDPNRYVEKRKPIPDPQETGLIY   85 (96)
Q Consensus        48 ~~~~~eqe~RAAlA~-~d~~rYVEkrkpipdpq~tgliy   85 (96)
                      -+.++.+++|+|+-+ ++.    |..|..-||-..|+|.
T Consensus        23 pE~r~a~~eR~a~Ra~Lk~----eYlkq~~nP~~~gli~   57 (125)
T PF07225_consen   23 PEERRAQQERAAIRARLKR----EYLKQYNNPHRKGLIF   57 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHH----HHHHHcCCCCCCCccC
Confidence            355666777777766 544    4456666776666663


No 23 
>PF09819 ABC_cobalt:  ABC-type cobalt transport system, permease component;  InterPro: IPR017195 This group represents a predicted ABC-type thiamin-related transport system, permease component 1. It is probably part of the ABC transporter complex ykoCDEF that could transport hydroxymethylpyrimidine (HMP) and/or thiamine. It could also transport other HMP-containing products. The complex is composed of two ATP-binding proteins (ykoD), two transmembrane proteins (ykoC and ykoE) and a solute-binding protein (ykoF).
Probab=27.30  E-value=16  Score=26.08  Aligned_cols=25  Identities=40%  Similarity=0.667  Sum_probs=20.1

Q ss_pred             HHHHHHhhhheeeEEEcCchhhHHH
Q 034394           29 LASWVVAGTLAYYLWVKPSQDLKRE   53 (96)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~e   53 (96)
                      ..-|..++.+|.|+..||--..--|
T Consensus        44 ~GlW~~a~~la~~iiRKPGaa~~~e   68 (129)
T PF09819_consen   44 YGLWFMAGPLAAYIIRKPGAALLAE   68 (129)
T ss_pred             HHHHHHHHHHHHHHhCCCcHHHHHH
Confidence            4579999999999999997655433


No 24 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=27.11  E-value=15  Score=25.81  Aligned_cols=23  Identities=26%  Similarity=0.161  Sum_probs=17.3

Q ss_pred             HHHHHhhhheeeEEEcCchhhHH
Q 034394           30 ASWVVAGTLAYYLWVKPSQDLKR   52 (96)
Q Consensus        30 AaW~VAG~lAYylwvkPe~~~~~   52 (96)
                      .+=+++|+.||||+.++..+.+.
T Consensus        14 ~~l~~~g~~~~~~~~~~~~~~~~   36 (142)
T PRK07718         14 IVIALIGTAALVLVMGFSEAKKQ   36 (142)
T ss_pred             HHHHHHHHHHHhhhcccCCcccc
Confidence            34567889999999988766654


No 25 
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=27.07  E-value=12  Score=25.21  Aligned_cols=10  Identities=50%  Similarity=0.783  Sum_probs=7.9

Q ss_pred             hhhhhccccc
Q 034394           14 SFVGNSMGGV   23 (96)
Q Consensus        14 sfi~n~mgG~   23 (96)
                      .+||+||||.
T Consensus        69 ~lvG~S~Gg~   78 (242)
T PRK11126         69 WLVGYSLGGR   78 (242)
T ss_pred             EEEEECHHHH
Confidence            3689999985


No 26 
>PF14960 ATP_synth_reg:  ATP synthase regulation
Probab=27.01  E-value=25  Score=22.26  Aligned_cols=25  Identities=28%  Similarity=0.601  Sum_probs=16.9

Q ss_pred             cCCcchH--HHHHHhhhheeeEEEcCc
Q 034394           23 VRGGANL--ASWVVAGTLAYYLWVKPS   47 (96)
Q Consensus        23 ~RG~~nl--AaW~VAG~lAYylwvkPe   47 (96)
                      ++|+.|.  |.|+.-|.+..|+..+|.
T Consensus        22 ~~GR~N~~~ATya~i~li~~~~k~~~k   48 (49)
T PF14960_consen   22 IRGRANVAKATYASIGLIILYFKLRRK   48 (49)
T ss_pred             ccchhhhHHHHHHHHHHHHHHHhcccC
Confidence            6899996  567666666666666553


No 27 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=26.76  E-value=13  Score=27.76  Aligned_cols=10  Identities=50%  Similarity=0.919  Sum_probs=8.7

Q ss_pred             hhhhhccccc
Q 034394           14 SFVGNSMGGV   23 (96)
Q Consensus        14 sfi~n~mgG~   23 (96)
                      .+||+||||.
T Consensus       141 ~lvG~SmGG~  150 (343)
T PRK08775        141 AFVGYSYGAL  150 (343)
T ss_pred             EEEEECHHHH
Confidence            5899999995


No 28 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=26.22  E-value=16  Score=26.82  Aligned_cols=11  Identities=45%  Similarity=0.839  Sum_probs=9.0

Q ss_pred             hhhhhcccccC
Q 034394           14 SFVGNSMGGVR   24 (96)
Q Consensus        14 sfi~n~mgG~R   24 (96)
                      .+||+||||+-
T Consensus        90 ~lvGhS~GG~v  100 (273)
T PLN02211         90 ILVGHSAGGLS  100 (273)
T ss_pred             EEEEECchHHH
Confidence            37899999984


No 29 
>PF13906 AA_permease_C:  C-terminus of AA_permease
Probab=26.07  E-value=28  Score=21.43  Aligned_cols=15  Identities=20%  Similarity=0.775  Sum_probs=12.3

Q ss_pred             HHHHHHhhhheeeEE
Q 034394           29 LASWVVAGTLAYYLW   43 (96)
Q Consensus        29 lAaW~VAG~lAYylw   43 (96)
                      +..|+++|.+.|+.+
T Consensus        32 f~iWl~iGl~iYf~Y   46 (51)
T PF13906_consen   32 FGIWLAIGLVIYFGY   46 (51)
T ss_pred             HHHHHHHHHHHHHhe
Confidence            568999999988764


No 30 
>KOG4040 consensus NADH:ubiquinone oxidoreductase, NDUFB8/ASHI subunit [Energy production and conversion]
Probab=25.06  E-value=41  Score=26.48  Aligned_cols=41  Identities=34%  Similarity=0.400  Sum_probs=22.6

Q ss_pred             cCchhhHHHHHHHHHHHccCCCcceeeccCCCCCcccceeeecCCC
Q 034394           45 KPSQDLKREQEERAALAALDPNRYVEKRKPIPDPQETGLIYGNKNR   90 (96)
Q Consensus        45 kPe~~~~~eqe~RAAlA~~d~~rYVEkrkpipdpq~tgliyg~~~~   90 (96)
                      ||.---.-| |||+|-| -|-+-=+|..+|-+|   .|++||.--+
T Consensus        37 kPgpyP~te-eER~AAA-kKY~lrpEdY~py~d---Dg~gyGDYPk   77 (186)
T KOG4040|consen   37 KPGPYPTTE-EERRAAA-KKYGLRPEDYQPYDD---DGVGYGDYPK   77 (186)
T ss_pred             CCCCCCCCH-HHHHHHH-HHhCCCHhhcCcCCc---CCcccCCCCc
Confidence            444333333 3444434 333334688888776   5888996443


No 31 
>COG1565 Uncharacterized conserved protein [Function unknown]
Probab=24.63  E-value=72  Score=27.08  Aligned_cols=47  Identities=28%  Similarity=0.469  Sum_probs=37.9

Q ss_pred             eeEEEcCchhhHHHHHHHHHHHccCCCcceeeccCCCCCcccceeeecC
Q 034394           40 YYLWVKPSQDLKREQEERAALAALDPNRYVEKRKPIPDPQETGLIYGNK   88 (96)
Q Consensus        40 YylwvkPe~~~~~eqe~RAAlA~~d~~rYVEkrkpipdpq~tgliyg~~   88 (96)
                      =|..|-|+.++++.|.+...-.. +.-+.+|..--+|+- .+|+|.+|.
T Consensus       111 ~~~iiE~s~~L~~~Qk~~L~~~~-~~~~~~~~~e~~p~~-~~~i~~~NE  157 (370)
T COG1565         111 SYYIIEPSPELRARQKETLKATE-DLIRWVEWVEDLPKK-FPGIVVSNE  157 (370)
T ss_pred             eEEEEecCHHHHHHHHHHHhccc-cchhHHHHHHhcccc-CceEEEech
Confidence            45678999999999988766554 888899998887765 689998874


No 32 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=23.96  E-value=26  Score=19.89  Aligned_cols=18  Identities=17%  Similarity=0.348  Sum_probs=13.7

Q ss_pred             HHHHHHhhhheeeEEEcCchh
Q 034394           29 LASWVVAGTLAYYLWVKPSQD   49 (96)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~   49 (96)
                      +..|.++|+++.|   +||.|
T Consensus        19 l~~~~~tG~~~~f---~~ei~   36 (37)
T PF13706_consen   19 LFVIFLTGAVMVF---RDEID   36 (37)
T ss_pred             HHHHHHHhHHHHH---HHhhc
Confidence            6789999999887   55543


No 33 
>PF11943 DUF3460:  Protein of unknown function (DUF3460);  InterPro: IPR021853  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 70 amino acids in length. This protein has a conserved WDK sequence motif. 
Probab=23.75  E-value=46  Score=21.79  Aligned_cols=26  Identities=42%  Similarity=0.622  Sum_probs=17.1

Q ss_pred             EEEcCchhhHHHHHHHHHHHccCCCcc
Q 034394           42 LWVKPSQDLKREQEERAALAALDPNRY   68 (96)
Q Consensus        42 lwvkPe~~~~~eqe~RAAlA~~d~~rY   68 (96)
                      ||-| .+++.+..+.+||--..+||-|
T Consensus        32 lWDk-~~d~e~~~~~~~arV~qkpYvY   57 (60)
T PF11943_consen   32 LWDK-PQDLEEQARFRAARVPQKPYVY   57 (60)
T ss_pred             hcCC-CCCHHHHHHHHhccCCCCCCCC
Confidence            6777 5666665566666555778666


No 34 
>PF13396 PLDc_N:  Phospholipase_D-nuclease N-terminal
Probab=23.43  E-value=93  Score=17.49  Aligned_cols=23  Identities=17%  Similarity=0.582  Sum_probs=16.7

Q ss_pred             CCcchHHHHHH-------hhhheeeEEEcC
Q 034394           24 RGGANLASWVV-------AGTLAYYLWVKP   46 (96)
Q Consensus        24 RG~~nlAaW~V-------AG~lAYylwvkP   46 (96)
                      |..++-.+|++       .|.++|+++-++
T Consensus        17 ~~~~~k~~W~~~i~~~P~iG~i~Yl~~gr~   46 (46)
T PF13396_consen   17 RSPSSKILWLIVILFFPIIGPILYLIFGRK   46 (46)
T ss_pred             CCCchhhHHHHHHHHHHHHHHhheEEEeCC
Confidence            55678889985       477888887553


No 35 
>PF11167 DUF2953:  Protein of unknown function (DUF2953);  InterPro: IPR021338  This family of proteins has no known function. 
Probab=23.15  E-value=11  Score=22.18  Aligned_cols=11  Identities=45%  Similarity=1.060  Sum_probs=9.4

Q ss_pred             CCCcccceeee
Q 034394           76 PDPQETGLIYG   86 (96)
Q Consensus        76 pdpq~tgliyg   86 (96)
                      .||-.||++||
T Consensus         6 ~Daa~Tgi~~G   16 (53)
T PF11167_consen    6 GDAADTGILYG   16 (53)
T ss_pred             cCHHHHHHHHH
Confidence            58889999887


No 36 
>COG1525 Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair]
Probab=22.80  E-value=2.3e+02  Score=20.01  Aligned_cols=20  Identities=20%  Similarity=0.220  Sum_probs=17.1

Q ss_pred             CCcchHHHHHHhhhheeeEE
Q 034394           24 RGGANLASWVVAGTLAYYLW   43 (96)
Q Consensus        24 RG~~nlAaW~VAG~lAYylw   43 (96)
                      .+++|++.|+|.=|+|.-+.
T Consensus       127 ~~~~~v~~~lV~~G~A~~~~  146 (192)
T COG1525         127 VDGTDVNLELVKEGLARVYY  146 (192)
T ss_pred             ECCEEHHHHHHhCCCEEEec
Confidence            57899999999999976655


No 37 
>PHA00431 internal virion protein C
Probab=21.29  E-value=53  Score=30.40  Aligned_cols=54  Identities=28%  Similarity=0.407  Sum_probs=38.5

Q ss_pred             Ccchhhhhhhchhhh-hhhcccccCCc-------------c----hHHHHHHhhhheeeEEEcCchhhHHHH
Q 034394            1 MASSWRRTIGNLRSF-VGNSMGGVRGG-------------A----NLASWVVAGTLAYYLWVKPSQDLKREQ   54 (96)
Q Consensus         1 ma~~wrrt~gn~rsf-i~n~mgG~RG~-------------~----nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (96)
                      |||.-.+.||++|.- ..-+=||.+|-             +    .|+-|+-||+-||-.+..-.+++..|+
T Consensus         1 MaSkl~~aL~q~~~~g~~rlrg~~~~~~yqA~~v~a~~~~s~ll~sl~~f~~aG~~ay~~y~~~~k~~AdER   72 (746)
T PHA00431          1 MASKLEQALGQMRAPGTERLRGGTGGMQYQAATVQAEVGQSNLLESLGKFAKAGADAYGAYDERRKDKADER   72 (746)
T ss_pred             CcchHHHHHhcccCCcccccccccccceeehhhhccccCCchHHHHHHHHHHHhHHHHHHHHHHHHHhHhhh
Confidence            788888888888753 22233444442             2    456799999999999988888777775


No 38 
>PRK07581 hypothetical protein; Validated
Probab=20.99  E-value=19  Score=26.54  Aligned_cols=12  Identities=42%  Similarity=0.471  Sum_probs=9.5

Q ss_pred             hhhhhcccccCC
Q 034394           14 SFVGNSMGGVRG   25 (96)
Q Consensus        14 sfi~n~mgG~RG   25 (96)
                      .+||+||||.-+
T Consensus       127 ~lvG~S~GG~va  138 (339)
T PRK07581        127 LVVGWSMGAQQT  138 (339)
T ss_pred             EEEEeCHHHHHH
Confidence            368999999754


No 39 
>PRK09689 prophage protein NinE; Provisional
Probab=20.31  E-value=45  Score=21.95  Aligned_cols=12  Identities=50%  Similarity=0.706  Sum_probs=9.6

Q ss_pred             eeccCCCCCccc
Q 034394           70 EKRKPIPDPQET   81 (96)
Q Consensus        70 Ekrkpipdpq~t   81 (96)
                      .|+||||.|.++
T Consensus        20 rkrKP~~k~Sdv   31 (56)
T PRK09689         20 RKRKPELKPSEI   31 (56)
T ss_pred             cCCCCCCChhhc
Confidence            478999988765


Done!