Query         034400
Match_columns 95
No_of_seqs    107 out of 262
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 02:27:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034400.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034400hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3475 60S ribosomal protein  100.0 1.8E-59   4E-64  322.7   1.9   92    1-92      1-92  (92)
  2 PTZ00073 60S ribosomal protein 100.0 1.5E-58 3.2E-63  318.4   3.5   90    1-90      1-90  (91)
  3 PRK04179 rpl37e 50S ribosomal  100.0 1.9E-36 4.2E-41  196.7   2.3   57    1-57      1-59  (62)
  4 PF01907 Ribosomal_L37e:  Ribos 100.0 2.1E-36 4.5E-41  192.7   0.0   54    2-55      1-55  (55)
  5 COG2126 RPL37A Ribosomal prote 100.0 3.4E-35 7.4E-40  190.3   2.3   60    1-60      1-61  (61)
  6 COG1998 RPS31 Ribosomal protei  93.5    0.03 6.5E-07   35.6   0.7   26   15-40     18-46  (51)
  7 PF14599 zinc_ribbon_6:  Zinc-r  90.2   0.099 2.1E-06   33.7   0.3   27   12-38     26-55  (61)
  8 PRK00432 30S ribosomal protein  90.0    0.17 3.7E-06   31.1   1.2   26   15-40     19-46  (50)
  9 PF01783 Ribosomal_L32p:  Ribos  88.4    0.28   6E-06   30.5   1.4   24   14-39     24-47  (56)
 10 PF13248 zf-ribbon_3:  zinc-rib  88.3    0.26 5.6E-06   26.3   1.0   23   17-40      3-25  (26)
 11 PF01599 Ribosomal_S27:  Riboso  82.9     0.6 1.3E-05   29.0   0.9   26   14-39     16-46  (47)
 12 smart00661 RPOL9 RNA polymeras  82.2    0.75 1.6E-05   26.8   1.1   23   18-40      2-29  (52)
 13 TIGR01031 rpmF_bact ribosomal   81.5    0.72 1.6E-05   28.9   0.9   24   14-39     24-47  (55)
 14 COG0675 Transposase and inacti  80.6    0.79 1.7E-05   33.5   1.0   25   14-40    307-331 (364)
 15 PF12773 DZR:  Double zinc ribb  79.8     1.8 3.9E-05   25.1   2.2   32    9-40      5-38  (50)
 16 PF09297 zf-NADH-PPase:  NADH p  76.1     1.1 2.5E-05   24.6   0.5   25   15-39      2-29  (32)
 17 PRK12286 rpmF 50S ribosomal pr  73.5     1.8 3.9E-05   27.3   1.0   24   14-39     25-48  (57)
 18 PHA00626 hypothetical protein   73.3     1.9 4.2E-05   28.1   1.1   23   18-40      2-32  (59)
 19 PRK05978 hypothetical protein;  73.1       2 4.4E-05   31.8   1.4   29   17-45     34-66  (148)
 20 PRK14892 putative transcriptio  72.9     2.1 4.5E-05   29.8   1.3   59   13-89     18-84  (99)
 21 PF13240 zinc_ribbon_2:  zinc-r  72.2     2.2 4.8E-05   22.4   1.0   21   19-40      2-22  (23)
 22 COG1571 Predicted DNA-binding   71.0       3 6.5E-05   35.7   2.1   26   16-41    350-377 (421)
 23 PF09538 FYDLN_acid:  Protein o  68.3       3 6.5E-05   29.2   1.3   24   16-39      9-34  (108)
 24 PRK12496 hypothetical protein;  67.7     3.1 6.7E-05   30.5   1.3   29   17-46    128-158 (164)
 25 PF12760 Zn_Tnp_IS1595:  Transp  66.1       4 8.6E-05   23.9   1.3   24   16-39     18-45  (46)
 26 TIGR02300 FYDLN_acid conserved  64.9       4 8.8E-05   30.1   1.5   24   16-39      9-34  (129)
 27 PRK00420 hypothetical protein;  63.0     4.1 8.9E-05   29.0   1.2   24   17-40     24-49  (112)
 28 PRK05508 methionine sulfoxide   62.5     4.7  0.0001   29.2   1.4   29   13-41     30-58  (119)
 29 KOG3362 Predicted BBOX Zn-fing  61.9     3.9 8.4E-05   31.1   0.9   21   22-42    109-129 (156)
 30 PF04060 FeS:  Putative Fe-S cl  61.7     3.9 8.5E-05   23.3   0.7   13   29-41      2-14  (35)
 31 KOG0856 Predicted pilin-like t  61.3     6.5 0.00014   29.6   2.0   39    3-41     36-79  (146)
 32 PF09855 DUF2082:  Nucleic-acid  60.5     4.7  0.0001   26.1   1.0    8   33-40     38-45  (64)
 33 COG0333 RpmF Ribosomal protein  59.8     5.2 0.00011   25.7   1.1   23   16-40     27-49  (57)
 34 PRK13130 H/ACA RNA-protein com  58.3     5.8 0.00013   25.2   1.1   20   18-40      7-26  (56)
 35 TIGR00357 methionine-R-sulfoxi  55.5      12 0.00025   27.5   2.5   29   13-41     37-65  (134)
 36 PF10571 UPF0547:  Uncharacteri  55.1     7.4 0.00016   21.1   1.1   22   18-40      2-23  (26)
 37 PF08271 TF_Zn_Ribbon:  TFIIB z  53.0     7.6 0.00016   22.4   1.0   22   18-39      2-27  (43)
 38 PF12172 DUF35_N:  Rubredoxin-l  52.9       6 0.00013   22.0   0.5   22   16-38     11-32  (37)
 39 COG5349 Uncharacterized protei  50.8     7.3 0.00016   28.7   0.8   26   15-40     20-49  (126)
 40 TIGR02098 MJ0042_CXXC MJ0042 f  49.5     7.6 0.00016   21.5   0.6   24   16-40      2-34  (38)
 41 PF13824 zf-Mss51:  Zinc-finger  48.9      12 0.00026   23.9   1.4   24   18-41      1-24  (55)
 42 COG0229 Conserved domain frequ  47.9      11 0.00023   28.3   1.3   27   15-41     41-67  (140)
 43 TIGR00269 conserved hypothetic  47.3     9.4  0.0002   25.8   0.9   12   31-42     80-91  (104)
 44 PRK05580 primosome assembly pr  46.8      13 0.00027   32.6   1.7   28   14-41    379-418 (679)
 45 PF12387 Peptidase_C74:  Pestiv  46.2      11 0.00024   29.7   1.2   26   12-39    158-183 (200)
 46 PRK00241 nudC NADH pyrophospha  45.8      11 0.00024   29.3   1.1   26   14-39     97-125 (256)
 47 PF10555 MraY_sig1:  Phospho-N-  45.4      10 0.00022   18.2   0.6    7    3-9       2-8   (13)
 48 COG1439 Predicted nucleic acid  45.1      11 0.00024   28.9   1.1   32   14-46    137-168 (177)
 49 PF01641 SelR:  SelR domain;  I  45.1      15 0.00033   26.5   1.7   32   10-41     31-62  (124)
 50 PHA02942 putative transposase;  44.8      12 0.00026   30.8   1.3   26   15-40    324-351 (383)
 51 PRK00222 methionine sulfoxide   44.4      21 0.00046   26.5   2.4   29   13-41     40-68  (142)
 52 PRK00398 rpoP DNA-directed RNA  43.6      14 0.00031   21.4   1.1   24   17-40      4-30  (46)
 53 PRK01110 rpmF 50S ribosomal pr  43.5      12 0.00027   23.7   0.9   21   16-39     27-47  (60)
 54 TIGR00311 aIF-2beta translatio  43.0      10 0.00023   27.4   0.6   25   15-39     96-126 (133)
 55 COG1545 Predicted nucleic-acid  42.5      14  0.0003   26.5   1.2   27   14-41     27-53  (140)
 56 PRK08329 threonine synthase; V  42.2      23 0.00049   28.2   2.4   66   17-87      2-69  (347)
 57 PF09082 DUF1922:  Domain of un  41.6     9.7 0.00021   25.3   0.2   22   17-40      4-28  (68)
 58 PRK06450 threonine synthase; V  41.0      15 0.00033   29.4   1.3   24   16-40      3-27  (338)
 59 KOG4192 Uncharacterized conser  40.9      12 0.00027   27.8   0.7   24    8-32     66-89  (134)
 60 PRK14018 trifunctional thiored  40.4      16 0.00034   31.8   1.4   29   13-41    415-443 (521)
 61 PF03604 DNA_RNApol_7kD:  DNA d  40.4      23 0.00049   20.1   1.6   23   18-40      2-26  (32)
 62 PF07282 OrfB_Zn_ribbon:  Putat  40.2      16 0.00035   22.3   1.1   25   15-39     27-54  (69)
 63 PF05191 ADK_lid:  Adenylate ki  40.0      16 0.00035   21.0   1.0   21   18-39      3-29  (36)
 64 COG1592 Rubrerythrin [Energy p  40.0      16 0.00034   27.6   1.1   28   16-43    134-161 (166)
 65 COG1594 RPB9 DNA-directed RNA   39.4      15 0.00032   25.7   0.9   23   17-39      3-30  (113)
 66 smart00834 CxxC_CXXC_SSSS Puta  39.4      22 0.00048   19.4   1.5   24   17-40      6-35  (41)
 67 PRK14559 putative protein seri  39.2      22 0.00048   31.6   2.1   29    9-40      8-36  (645)
 68 PRK11823 DNA repair protein Ra  39.1      18 0.00038   30.2   1.4   26   13-39      4-29  (446)
 69 PRK12336 translation initiatio  38.9      15 0.00033   27.8   1.0   34   15-48     97-138 (201)
 70 PRK04136 rpl40e 50S ribosomal   38.8      18 0.00039   22.7   1.1   22   17-39     15-36  (48)
 71 PRK03681 hypA hydrogenase nick  38.0      17 0.00037   25.1   1.0   37    3-40     53-96  (114)
 72 COG2816 NPY1 NTP pyrophosphohy  36.4      18 0.00038   29.5   1.0   27   13-39    108-137 (279)
 73 COG3677 Transposase and inacti  36.2      21 0.00047   25.4   1.3   25   14-40     28-62  (129)
 74 TIGR00515 accD acetyl-CoA carb  36.0      16 0.00036   29.2   0.8   26   15-40     25-54  (285)
 75 PRK12380 hydrogenase nickel in  35.8      20 0.00043   24.8   1.1   26   14-40     68-95  (113)
 76 PF10892 DUF2688:  Protein of u  35.6      13 0.00027   24.4   0.0   16   14-29      8-23  (60)
 77 TIGR01384 TFS_arch transcripti  35.6      20 0.00044   23.6   1.0   23   18-40      2-25  (104)
 78 PF02150 RNA_POL_M_15KD:  RNA p  35.2      20 0.00044   20.3   0.9   23   17-39      2-28  (35)
 79 smart00547 ZnF_RBZ Zinc finger  34.8      24 0.00052   17.9   1.1   22   18-40      4-25  (26)
 80 PRK05550 bifunctional methioni  34.5      33 0.00072   27.8   2.3   29   13-41     33-61  (283)
 81 PF10217 DUF2039:  Uncharacteri  34.4       8 0.00017   26.9  -1.1   12   30-41     80-91  (92)
 82 cd00729 rubredoxin_SM Rubredox  33.4      25 0.00055   19.7   1.1   27   17-43      3-30  (34)
 83 PRK14873 primosome assembly pr  33.2      24 0.00051   31.4   1.4   16   25-40    402-419 (665)
 84 PF10013 DUF2256:  Uncharacteri  33.1      15 0.00032   22.5   0.0   20   28-53      5-24  (42)
 85 PRK04351 hypothetical protein;  33.1      23 0.00049   25.9   1.1   22   17-38    113-139 (149)
 86 PF04216 FdhE:  Protein involve  33.1      22 0.00048   27.6   1.0   59   14-73    195-254 (290)
 87 cd07153 Fur_like Ferric uptake  32.0      20 0.00043   23.4   0.5   12   14-25     71-82  (116)
 88 COG2260 Predicted Zn-ribbon RN  31.6      25 0.00053   23.0   0.9   20   17-39      6-25  (59)
 89 CHL00174 accD acetyl-CoA carbo  31.4      17 0.00037   29.7   0.2   31   15-45     37-74  (296)
 90 TIGR00100 hypA hydrogenase nic  31.1      27 0.00058   24.2   1.1   38    3-41     53-96  (115)
 91 smart00653 eIF2B_5 domain pres  31.1      19 0.00042   25.2   0.4   25   15-39     79-109 (110)
 92 smart00659 RPOLCX RNA polymera  30.9      29 0.00062   20.7   1.1   23   18-40      4-28  (44)
 93 PF14787 zf-CCHC_5:  GAG-polypr  30.4      27 0.00058   20.8   0.8   13   16-28      2-14  (36)
 94 PRK05654 acetyl-CoA carboxylas  30.4      18 0.00039   29.1   0.2   26   15-40     26-55  (292)
 95 PF14803 Nudix_N_2:  Nudix N-te  30.2      20 0.00043   20.6   0.3    9   31-39     22-30  (34)
 96 PF07503 zf-HYPF:  HypF finger;  30.0      28 0.00061   20.0   0.9   15   24-38     14-28  (35)
 97 PRK14714 DNA polymerase II lar  27.7      31 0.00068   33.7   1.2   21   17-40    668-688 (1337)
 98 TIGR00375 conserved hypothetic  27.7      35 0.00076   28.6   1.4   30    6-40    233-267 (374)
 99 COG1645 Uncharacterized Zn-fin  27.6      31 0.00068   25.4   1.0   26   15-40     27-53  (131)
100 PRK09462 fur ferric uptake reg  27.4      26 0.00056   24.4   0.5   12   15-26     89-100 (148)
101 PF03858 Crust_neuro_H:  Crusta  26.9      17 0.00037   22.2  -0.4   17   56-72      1-17  (41)
102 TIGR00416 sms DNA repair prote  26.6      37  0.0008   28.5   1.4   26   13-39      4-29  (454)
103 PRK03988 translation initiatio  26.3      27 0.00059   25.4   0.5   25   15-39    101-131 (138)
104 PF06221 zf-C2HC5:  Putative zi  26.2      53  0.0012   20.9   1.7   33    8-40      8-44  (57)
105 PRK14890 putative Zn-ribbon RN  26.0      40 0.00087   21.9   1.2   27   14-40     23-57  (59)
106 PF01873 eIF-5_eIF-2B:  Domain   25.9      27 0.00058   24.9   0.4   25   15-39     92-122 (125)
107 PRK08764 ferredoxin; Provision  25.6      35 0.00075   23.9   0.9   13   28-40     14-26  (135)
108 PF14653 IGFL:  Insulin growth   25.1      35 0.00075   23.7   0.8   32   16-47     10-45  (89)
109 KOG3241 Uncharacterized conser  24.7      11 0.00023   30.0  -2.0   20   15-39     82-101 (227)
110 PTZ00255 60S ribosomal protein  24.5      38 0.00083   23.4   0.9   23   17-39     37-62  (90)
111 PF08772 NOB1_Zn_bind:  Nin one  24.0      37 0.00081   22.5   0.8   24   18-41     11-34  (73)
112 PRK00564 hypA hydrogenase nick  23.9      50  0.0011   22.9   1.4   28   13-41     68-98  (117)
113 PF01475 FUR:  Ferric uptake re  23.7      31 0.00068   22.9   0.3   13   13-25     77-89  (120)
114 PRK06260 threonine synthase; V  23.6      45 0.00099   26.9   1.3   24   16-40      3-28  (397)
115 PF09862 DUF2089:  Protein of u  23.5      35 0.00075   24.4   0.6   20   19-39      1-20  (113)
116 TIGR00280 L37a ribosomal prote  22.9      41 0.00089   23.4   0.8   23   17-39     36-61  (91)
117 COG2888 Predicted Zn-ribbon RN  22.8      40 0.00086   22.2   0.7   28   13-40     24-59  (61)
118 COG4888 Uncharacterized Zn rib  22.4      40 0.00087   24.2   0.7   26   14-39     20-54  (104)
119 PF03367 zf-ZPR1:  ZPR1 zinc-fi  22.2      35 0.00076   25.1   0.4   29   17-45      2-44  (161)
120 PRK06991 ferredoxin; Provision  22.1      44 0.00095   26.6   1.0   12   29-40     15-26  (270)
121 PRK07218 replication factor A;  22.1      46 0.00099   28.3   1.1   23   15-40    296-318 (423)
122 PF06869 DUF1258:  Protein of u  21.9      35 0.00076   27.7   0.4   24   12-37     14-37  (258)
123 TIGR00340 zpr1_rel ZPR1-relate  21.7      43 0.00094   24.9   0.8   14   31-44     28-41  (163)
124 PF08536 Whirly:  Whirly transc  21.6      37 0.00081   25.3   0.5   14   40-53     40-53  (139)
125 PRK14873 primosome assembly pr  21.2      56  0.0012   29.1   1.5   23   15-40    409-431 (665)
126 COG0777 AccD Acetyl-CoA carbox  21.1      38 0.00082   28.1   0.4   69   14-82     26-137 (294)
127 KOG2767 Translation initiation  20.8      43 0.00093   28.8   0.7   25   16-40     96-127 (400)
128 PRK04165 acetyl-CoA decarbonyl  20.8      47   0.001   28.4   0.9   12   29-40     12-23  (450)
129 PRK03976 rpl37ae 50S ribosomal  20.5      49  0.0011   22.9   0.8   23   17-39     37-62  (90)
130 PF14149 YhfH:  YhfH-like prote  20.3      34 0.00074   20.4   0.0   12   28-39     10-21  (37)
131 PRK00423 tfb transcription ini  20.1      50  0.0011   26.2   0.9   36   16-51     11-58  (310)

No 1  
>KOG3475 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=1.8e-59  Score=322.65  Aligned_cols=92  Identities=71%  Similarity=1.242  Sum_probs=89.7

Q ss_pred             CCCCCCCCCCCCCCcccccccCCCccccccccccccccCcccccccCCccccccccccccccccccccccchhcccCcCc
Q 034400            1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFRE   80 (95)
Q Consensus         1 MtKGT~SfGKr~~ktH~lCrRCG~~syH~qKk~Ca~CGyps~k~R~YnWs~Ka~rr~ttGTGRmr~lk~v~rrfkngFre   80 (95)
                      |+|||+||||+|+|+|+||+|||++|||+||++|++||||++++|+||||+||+||+|||||||||||+|+|||+|||||
T Consensus         1 MtKGT~sFGKr~nkshtlC~RCG~~syH~QKstC~~CGYpaak~R~ynws~KAkRR~TtGTGrMr~lk~v~rrfrnGfre   80 (92)
T KOG3475|consen    1 MTKGTSSFGKRHNKSHTLCRRCGRRSYHIQKSTCSSCGYPAAKKRSYNWSAKAKRRRTTGTGRMRYLKIVYRRFRNGFRE   80 (92)
T ss_pred             CCCcccchhhccccchHHHHHhCchhhhhhcccccccCCcchhccCCCcchhhhhccccccchhHHHHHHHHHHhccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccccccc
Q 034400           81 GTQAAPRKKGAA   92 (95)
Q Consensus        81 Gt~~~~~~~~~~   92 (95)
                      |++|+|+.++++
T Consensus        81 gt~~k~k~a~~~   92 (92)
T KOG3475|consen   81 GTTAKPKAAAAA   92 (92)
T ss_pred             CCccCccccccC
Confidence            999999977653


No 2  
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=100.00  E-value=1.5e-58  Score=318.35  Aligned_cols=90  Identities=71%  Similarity=1.243  Sum_probs=88.4

Q ss_pred             CCCCCCCCCCCCCCcccccccCCCccccccccccccccCcccccccCCccccccccccccccccccccccchhcccCcCc
Q 034400            1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFRE   80 (95)
Q Consensus         1 MtKGT~SfGKr~~ktH~lCrRCG~~syH~qKk~Ca~CGyps~k~R~YnWs~Ka~rr~ttGTGRmr~lk~v~rrfkngFre   80 (95)
                      |+|||+||||||++|||||+|||++|||+||++||+||||++++|+|||+.||++|+|||||||||||+|+|||+|||||
T Consensus         1 MtKGT~SfGKr~~ktHtlCrRCG~~syH~qK~~CasCGypsak~R~YnWs~Ka~rr~ttGtGrmr~lk~v~rrf~ngfre   80 (91)
T PTZ00073          1 MTKGTGSFGKRHGKTHTLCRRCGKRSFHVQKKRCASCGYPSAKMRRYNWSVKAKRRRTTGTGRCRYLKTVARRAKNGFRE   80 (91)
T ss_pred             CCCCCcccccccCcCcchhcccCccccccccccchhcCCchhhccccchhhhhccccCCccchhHHHHHHHHHHhcCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccccc
Q 034400           81 GTQAAPRKKG   90 (95)
Q Consensus        81 Gt~~~~~~~~   90 (95)
                      ||+|+|++++
T Consensus        81 gt~~~~~~~~   90 (91)
T PTZ00073         81 GTKAKPKVKA   90 (91)
T ss_pred             CCccccccCC
Confidence            9999998765


No 3  
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=100.00  E-value=1.9e-36  Score=196.73  Aligned_cols=57  Identities=47%  Similarity=0.934  Sum_probs=54.7

Q ss_pred             CCCCCCCCCCCCCC-cccccccCCCccccccccccccccC-cccccccCCccccccccc
Q 034400            1 MGKGTGSFGKRRNK-THTLCVRCGRRSFHLQKSRCAACAY-PAARKRTYNWSVKAIRRK   57 (95)
Q Consensus         1 MtKGT~SfGKr~~k-tH~lCrRCG~~syH~qKk~Ca~CGy-ps~k~R~YnWs~Ka~rr~   57 (95)
                      |+|||+||||||++ |||+|||||++|||+||++||+||| |++++|+|||+.||+.+.
T Consensus         1 MtKGT~SfGKr~~k~tHt~CrRCG~~syh~qK~~CasCGygps~k~R~YnWs~Ka~~~~   59 (62)
T PRK04179          1 MSKGTPSMGKRNKGKTHIRCRRCGRHSYNVRKKYCAACGFGRSKRIRRYSWQNKKVNGK   59 (62)
T ss_pred             CCCCCcccccccCCcccchhcccCcccccccccchhhcCCCcccccccccHHHHhhccc
Confidence            99999999999997 9999999999999999999999999 999999999999997654


No 4  
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=100.00  E-value=2.1e-36  Score=192.66  Aligned_cols=54  Identities=74%  Similarity=1.329  Sum_probs=46.0

Q ss_pred             CCCCCCCCCCCCCcccccccCCCccccccccccccccCcccccc-cCCccccccc
Q 034400            2 GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKR-TYNWSVKAIR   55 (95)
Q Consensus         2 tKGT~SfGKr~~ktH~lCrRCG~~syH~qKk~Ca~CGyps~k~R-~YnWs~Ka~r   55 (95)
                      |||||||||||++|||||+|||++|||+||++||+||||++++| +|||+.||+|
T Consensus         1 tKGT~S~Gkr~~ktH~~CrRCG~~syH~qK~~CasCGyp~~kkrr~ynWs~Ka~r   55 (55)
T PF01907_consen    1 TKGTSSFGKRHNKTHTLCRRCGRRSYHIQKKTCASCGYPAAKKRRKYNWSAKAKR   55 (55)
T ss_dssp             -TTHHHHTTS-S-SEEE-TTTSSEEEETTTTEETTTBTTTSSS----SSSSHHHH
T ss_pred             CCCCCCccccCCccEeeecccCCeeeecCCCcccccCCCcccccccccchhhhcC
Confidence            69999999999999999999999999999999999999999999 9999999975


No 5  
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=3.4e-35  Score=190.35  Aligned_cols=60  Identities=62%  Similarity=1.119  Sum_probs=58.3

Q ss_pred             CCCCCCCCCCCCCCcccccccCCCccccccccccccccCc-ccccccCCcccccccccccc
Q 034400            1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYP-AARKRTYNWSVKAIRRKTTG   60 (95)
Q Consensus         1 MtKGT~SfGKr~~ktH~lCrRCG~~syH~qKk~Ca~CGyp-s~k~R~YnWs~Ka~rr~ttG   60 (95)
                      |+||||||||+|+++||+|||||++|||+||++|++|||| ++++|+|+|+.|+++++++|
T Consensus         1 MskGT~S~GKrnk~tH~~CRRCGr~syhv~k~~CaaCGfgrs~r~R~y~W~~K~~~r~~~~   61 (61)
T COG2126           1 MSKGTPSFGKRNKKTHIRCRRCGRRSYHVRKKYCAACGFGRSARMRSYNWQAKKKRRKTIG   61 (61)
T ss_pred             CCCCCccccccCCcceehhhhccchheeeccceecccCCCCccccccchhhhhhhcCeecC
Confidence            9999999999999999999999999999999999999998 99999999999999998865


No 6  
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=93.52  E-value=0.03  Score=35.62  Aligned_cols=26  Identities=31%  Similarity=0.829  Sum_probs=21.9

Q ss_pred             cccccccCCC---ccccccccccccccCc
Q 034400           15 THTLCVRCGR---RSFHLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~---~syH~qKk~Ca~CGyp   40 (95)
                      -.-.|.|||-   -+.|.....|+.|||-
T Consensus        18 k~~~CPrCG~gvfmA~H~dR~~CGkCgyT   46 (51)
T COG1998          18 KNRFCPRCGPGVFMADHKDRWACGKCGYT   46 (51)
T ss_pred             ccccCCCCCCcchhhhcCceeEeccccce
Confidence            4568999996   4669999999999995


No 7  
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=90.22  E-value=0.099  Score=33.69  Aligned_cols=27  Identities=33%  Similarity=0.872  Sum_probs=15.6

Q ss_pred             CCCcccccccCCCcc---cccccccccccc
Q 034400           12 RNKTHTLCVRCGRRS---FHLQKSRCAACA   38 (95)
Q Consensus        12 ~~ktH~lCrRCG~~s---yH~qKk~Ca~CG   38 (95)
                      +.+..|+|.-|+.+|   ||+--..|..||
T Consensus        26 ~~~v~IlCNDC~~~s~v~fH~lg~KC~~C~   55 (61)
T PF14599_consen   26 NKKVWILCNDCNAKSEVPFHFLGHKCSHCG   55 (61)
T ss_dssp             --EEEEEESSS--EEEEE--TT----TTTS
T ss_pred             CCEEEEECCCCCCccceeeeHhhhcCCCCC
Confidence            346899999999876   999999999999


No 8  
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=89.98  E-value=0.17  Score=31.13  Aligned_cols=26  Identities=35%  Similarity=0.943  Sum_probs=20.9

Q ss_pred             cccccccCCC--ccccccccccccccCc
Q 034400           15 THTLCVRCGR--RSFHLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~--~syH~qKk~Ca~CGyp   40 (95)
                      +...|++||.  -+-|.....|++|||.
T Consensus        19 ~~~fCP~Cg~~~m~~~~~r~~C~~Cgyt   46 (50)
T PRK00432         19 KNKFCPRCGSGFMAEHLDRWHCGKCGYT   46 (50)
T ss_pred             ccCcCcCCCcchheccCCcEECCCcCCE
Confidence            5668999998  4456668899999984


No 9  
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=88.40  E-value=0.28  Score=30.45  Aligned_cols=24  Identities=29%  Similarity=0.776  Sum_probs=21.1

Q ss_pred             CcccccccCCCccccccccccccccC
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      ..-+.|.-||  .+++.+..|.+|||
T Consensus        24 ~~l~~c~~cg--~~~~~H~vc~~cG~   47 (56)
T PF01783_consen   24 PNLVKCPNCG--EPKLPHRVCPSCGY   47 (56)
T ss_dssp             TSEEESSSSS--SEESTTSBCTTTBB
T ss_pred             cceeeeccCC--CEecccEeeCCCCe
Confidence            3557899999  79999999999997


No 10 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=88.32  E-value=0.26  Score=26.31  Aligned_cols=23  Identities=22%  Similarity=0.671  Sum_probs=19.1

Q ss_pred             cccccCCCccccccccccccccCc
Q 034400           17 TLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      +.|..||. .-...-..|..||.+
T Consensus         3 ~~Cp~Cg~-~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGA-EIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCcccCC-cCCcccccChhhCCC
Confidence            57999999 677888999999964


No 11 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=82.90  E-value=0.6  Score=28.95  Aligned_cols=26  Identities=31%  Similarity=0.815  Sum_probs=20.6

Q ss_pred             Ccccccc--cCCC---ccccccccccccccC
Q 034400           14 KTHTLCV--RCGR---RSFHLQKSRCAACAY   39 (95)
Q Consensus        14 ktH~lCr--RCG~---~syH~qKk~Ca~CGy   39 (95)
                      ..+-.|+  +||.   -+-|.....|++|||
T Consensus        16 r~rk~CP~~~CG~GvFMA~H~dR~~CGKCg~   46 (47)
T PF01599_consen   16 RLRKECPSPRCGAGVFMAEHKDRHYCGKCGY   46 (47)
T ss_dssp             ESSEE-TSTTTTSSSEEEE-SSEEEETTTSS
T ss_pred             EhhhcCCCcccCCceEeeecCCCccCCCccc
Confidence            4677899  9999   477999999999997


No 12 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=82.18  E-value=0.75  Score=26.77  Aligned_cols=23  Identities=26%  Similarity=0.814  Sum_probs=18.9

Q ss_pred             ccccCCCcccccc-----ccccccccCc
Q 034400           18 LCVRCGRRSFHLQ-----KSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~q-----Kk~Ca~CGyp   40 (95)
                      .|..||...|...     ...|..|||-
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~   29 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYE   29 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCe
Confidence            5899999998874     4679999994


No 13 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=81.46  E-value=0.72  Score=28.85  Aligned_cols=24  Identities=38%  Similarity=1.010  Sum_probs=20.9

Q ss_pred             CcccccccCCCccccccccccccccC
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      ...+.|..||.  |++....|..|||
T Consensus        24 p~l~~C~~cG~--~~~~H~vc~~cG~   47 (55)
T TIGR01031        24 PTLVVCPNCGE--FKLPHRVCPSCGY   47 (55)
T ss_pred             CcceECCCCCC--cccCeeECCccCe
Confidence            45567999997  8999999999997


No 14 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=80.63  E-value=0.79  Score=33.51  Aligned_cols=25  Identities=24%  Similarity=0.646  Sum_probs=21.1

Q ss_pred             CcccccccCCCccccccccccccccCc
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      -|-..|..||.  .+.+.-.|..||+-
T Consensus       307 ~tS~~C~~cg~--~~~r~~~C~~cg~~  331 (364)
T COG0675         307 YTSKTCPCCGH--LSGRLFKCPRCGFV  331 (364)
T ss_pred             CCcccccccCC--ccceeEECCCCCCe
Confidence            45678999999  77788899999983


No 15 
>PF12773 DZR:  Double zinc ribbon
Probab=79.78  E-value=1.8  Score=25.13  Aligned_cols=32  Identities=22%  Similarity=0.512  Sum_probs=25.1

Q ss_pred             CCCCCCcccccccCCCccc--cccccccccccCc
Q 034400            9 GKRRNKTHTLCVRCGRRSF--HLQKSRCAACAYP   40 (95)
Q Consensus         9 GKr~~ktH~lCrRCG~~sy--H~qKk~Ca~CGyp   40 (95)
                      |..+...-..|..||....  ......|..||.+
T Consensus         5 g~~~~~~~~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen    5 GTPNPDDAKFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             CCcCCccccCChhhcCChhhccCCCCCCcCCcCC
Confidence            4445566778999999988  7778889999985


No 16 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=76.13  E-value=1.1  Score=24.55  Aligned_cols=25  Identities=32%  Similarity=0.794  Sum_probs=13.7

Q ss_pred             cccccccCCCccccccc---cccccccC
Q 034400           15 THTLCVRCGRRSFHLQK---SRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qK---k~Ca~CGy   39 (95)
                      +|-.|-+||....-.+.   .+|.+||.
T Consensus         2 ~~rfC~~CG~~t~~~~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    2 NHRFCGRCGAPTKPAPGGWARRCPSCGH   29 (32)
T ss_dssp             TTSB-TTT--BEEE-SSSS-EEESSSS-
T ss_pred             CCcccCcCCccccCCCCcCEeECCCCcC
Confidence            56778888887766554   56777764


No 17 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=73.48  E-value=1.8  Score=27.34  Aligned_cols=24  Identities=29%  Similarity=0.747  Sum_probs=19.9

Q ss_pred             CcccccccCCCccccccccccccccC
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      .+-+.|..||.  +++....|..|||
T Consensus        25 ~~l~~C~~CG~--~~~~H~vC~~CG~   48 (57)
T PRK12286         25 PGLVECPNCGE--PKLPHRVCPSCGY   48 (57)
T ss_pred             CcceECCCCCC--ccCCeEECCCCCc
Confidence            44567999995  7888999999998


No 18 
>PHA00626 hypothetical protein
Probab=73.31  E-value=1.9  Score=28.15  Aligned_cols=23  Identities=26%  Similarity=0.787  Sum_probs=17.5

Q ss_pred             ccccCCCccccc--------cccccccccCc
Q 034400           18 LCVRCGRRSFHL--------QKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~--------qKk~Ca~CGyp   40 (95)
                      +|+.||+.....        |--.|-.|||-
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~   32 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYN   32 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCe
Confidence            689999864433        67789999984


No 19 
>PRK05978 hypothetical protein; Provisional
Probab=73.13  E-value=2  Score=31.78  Aligned_cols=29  Identities=31%  Similarity=0.641  Sum_probs=22.4

Q ss_pred             cccccCCCc----cccccccccccccCcccccc
Q 034400           17 TLCVRCGRR----SFHLQKSRCAACAYPAARKR   45 (95)
Q Consensus        17 ~lCrRCG~~----syH~qKk~Ca~CGyps~k~R   45 (95)
                      -.|.+||+-    .|-.-...|+.||.+=..-+
T Consensus        34 grCP~CG~G~LF~g~Lkv~~~C~~CG~~~~~~~   66 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPVDHCAACGEDFTHHR   66 (148)
T ss_pred             CcCCCCCCCcccccccccCCCccccCCccccCC
Confidence            479999984    56889999999997643333


No 20 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=72.89  E-value=2.1  Score=29.82  Aligned_cols=59  Identities=19%  Similarity=0.312  Sum_probs=37.0

Q ss_pred             CCcccccccCCCcccccc--------ccccccccCcccccccCCccccccccccccccccccccccchhcccCcCcCCCC
Q 034400           13 NKTHTLCVRCGRRSFHLQ--------KSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGTQA   84 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~q--------Kk~Ca~CGyps~k~R~YnWs~Ka~rr~ttGTGRmr~lk~v~rrfkngFreGt~~   84 (95)
                      ..+.+.|..||.  ..+.        +-.|..|||--.+  ..+          .++--    =+||..|-.-|.||-..
T Consensus        18 lpt~f~CP~Cge--~~v~v~~~k~~~h~~C~~CG~y~~~--~V~----------~l~ep----IDVY~~wiD~~~eg~i~   79 (99)
T PRK14892         18 LPKIFECPRCGK--VSISVKIKKNIAIITCGNCGLYTEF--EVP----------SVYDE----VDVYNKFIDLYLEGKIE   79 (99)
T ss_pred             CCcEeECCCCCC--eEeeeecCCCcceEECCCCCCccCE--ECC----------ccccc----hhhHHHHHHHHHhcCCC
Confidence            357788999994  5554        8899999973111  111          11111    25788888888888766


Q ss_pred             Ccccc
Q 034400           85 APRKK   89 (95)
Q Consensus        85 ~~~~~   89 (95)
                      .|-..
T Consensus        80 ~~~~~   84 (99)
T PRK14892         80 IKERK   84 (99)
T ss_pred             ccccC
Confidence            55443


No 21 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=72.19  E-value=2.2  Score=22.44  Aligned_cols=21  Identities=29%  Similarity=0.711  Sum_probs=14.0

Q ss_pred             cccCCCccccccccccccccCc
Q 034400           19 CVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        19 CrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      |..||...= ..-..|..||.|
T Consensus         2 Cp~CG~~~~-~~~~fC~~CG~~   22 (23)
T PF13240_consen    2 CPNCGAEIE-DDAKFCPNCGTP   22 (23)
T ss_pred             CcccCCCCC-CcCcchhhhCCc
Confidence            777777653 445668888864


No 22 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=71.02  E-value=3  Score=35.71  Aligned_cols=26  Identities=35%  Similarity=0.758  Sum_probs=18.6

Q ss_pred             ccccccCCCccccccc--cccccccCcc
Q 034400           16 HTLCVRCGRRSFHLQK--SRCAACAYPA   41 (95)
Q Consensus        16 H~lCrRCG~~syH~qK--k~Ca~CGyps   41 (95)
                      -.+|.+||.+-=-.-+  -+|-+|||.+
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~  377 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRA  377 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccC
Confidence            3489999987544433  5799999853


No 23 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=68.27  E-value=3  Score=29.25  Aligned_cols=24  Identities=29%  Similarity=0.825  Sum_probs=20.5

Q ss_pred             ccccccCCCcccccccc--ccccccC
Q 034400           16 HTLCVRCGRRSFHLQKS--RCAACAY   39 (95)
Q Consensus        16 H~lCrRCG~~syH~qKk--~Ca~CGy   39 (95)
                      --+|.-||.+-|-|+|.  +|..||-
T Consensus         9 KR~Cp~CG~kFYDLnk~PivCP~CG~   34 (108)
T PF09538_consen    9 KRTCPSCGAKFYDLNKDPIVCPKCGT   34 (108)
T ss_pred             cccCCCCcchhccCCCCCccCCCCCC
Confidence            34799999999999884  6999996


No 24 
>PRK12496 hypothetical protein; Provisional
Probab=67.65  E-value=3.1  Score=30.55  Aligned_cols=29  Identities=24%  Similarity=0.701  Sum_probs=21.9

Q ss_pred             cccccCCCcccc--ccccccccccCccccccc
Q 034400           17 TLCVRCGRRSFH--LQKSRCAACAYPAARKRT   46 (95)
Q Consensus        17 ~lCrRCG~~syH--~qKk~Ca~CGyps~k~R~   46 (95)
                      -.|..|| +.|.  .....|..||.|-++++.
T Consensus       128 ~~C~gC~-~~~~~~~~~~~C~~CG~~~~r~~~  158 (164)
T PRK12496        128 KVCKGCK-KKYPEDYPDDVCEICGSPVKRKMV  158 (164)
T ss_pred             EECCCCC-ccccCCCCCCcCCCCCChhhhcch
Confidence            5699999 4565  455789999998766654


No 25 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=66.09  E-value=4  Score=23.94  Aligned_cols=24  Identities=33%  Similarity=0.866  Sum_probs=16.5

Q ss_pred             ccccccCCCc-cccccc---cccccccC
Q 034400           16 HTLCVRCGRR-SFHLQK---SRCAACAY   39 (95)
Q Consensus        16 H~lCrRCG~~-syH~qK---k~Ca~CGy   39 (95)
                      ...|.+||.. .|.+..   -.|.+|++
T Consensus        18 g~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            3679999984 454433   57888875


No 26 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=64.92  E-value=4  Score=30.08  Aligned_cols=24  Identities=13%  Similarity=0.369  Sum_probs=20.8

Q ss_pred             ccccccCCCccccccc--cccccccC
Q 034400           16 HTLCVRCGRRSFHLQK--SRCAACAY   39 (95)
Q Consensus        16 H~lCrRCG~~syH~qK--k~Ca~CGy   39 (95)
                      --+|.-||.+-|-+.|  -+|..||.
T Consensus         9 Kr~Cp~cg~kFYDLnk~p~vcP~cg~   34 (129)
T TIGR02300         9 KRICPNTGSKFYDLNRRPAVSPYTGE   34 (129)
T ss_pred             cccCCCcCccccccCCCCccCCCcCC
Confidence            3479999999999987  47999996


No 27 
>PRK00420 hypothetical protein; Validated
Probab=63.00  E-value=4.1  Score=29.01  Aligned_cols=24  Identities=21%  Similarity=0.373  Sum_probs=20.9

Q ss_pred             cccccCCCccc--cccccccccccCc
Q 034400           17 TLCVRCGRRSF--HLQKSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~sy--H~qKk~Ca~CGyp   40 (95)
                      ..|+.||..-|  +-.+..|..||-+
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCe
Confidence            57999999999  5778899999975


No 28 
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=62.50  E-value=4.7  Score=29.19  Aligned_cols=29  Identities=21%  Similarity=0.629  Sum_probs=25.8

Q ss_pred             CCcccccccCCCccccccccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      ..-.-.|..||..-|.-+.|.-+.||+||
T Consensus        30 ~~G~Y~C~~Cg~pLF~S~~KfdSg~GWPS   58 (119)
T PRK05508         30 EKGTYVCKQCGAPLYRSEDKFKSGCGWPS   58 (119)
T ss_pred             CCeEEEecCCCCccccccccccCCCCCcc
Confidence            34556899999999999999999999995


No 29 
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=61.89  E-value=3.9  Score=31.11  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=16.7

Q ss_pred             CCCccccccccccccccCccc
Q 034400           22 CGRRSFHLQKSRCAACAYPAA   42 (95)
Q Consensus        22 CG~~syH~qKk~Ca~CGyps~   42 (95)
                      |-..+|-.+.+.|+.|||++.
T Consensus       109 ~a~p~~KP~r~fCaVCG~~S~  129 (156)
T KOG3362|consen  109 YAKPSFKPLRKFCAVCGYDSK  129 (156)
T ss_pred             ccCCCCCCcchhhhhcCCCch
Confidence            566788888899999998753


No 30 
>PF04060 FeS:  Putative Fe-S cluster;  InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster.; GO: 0051536 iron-sulfur cluster binding; PDB: 2YCL_A 4DJF_E 4DJD_C 4DJE_C.
Probab=61.66  E-value=3.9  Score=23.30  Aligned_cols=13  Identities=46%  Similarity=1.201  Sum_probs=6.0

Q ss_pred             ccccccccccCcc
Q 034400           29 LQKSRCAACAYPA   41 (95)
Q Consensus        29 ~qKk~Ca~CGyps   41 (95)
                      +.+.-|+.||||+
T Consensus         2 LP~~nCg~CG~~~   14 (35)
T PF04060_consen    2 LPGTNCGACGYPT   14 (35)
T ss_dssp             S-S----TTSSSS
T ss_pred             CCCCcCCCCCCcc
Confidence            3456799999983


No 31 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=61.29  E-value=6.5  Score=29.62  Aligned_cols=39  Identities=26%  Similarity=0.523  Sum_probs=31.3

Q ss_pred             CCCCCCCC-----CCCCcccccccCCCccccccccccccccCcc
Q 034400            3 KGTGSFGK-----RRNKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus         3 KGT~SfGK-----r~~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      |||-+.|.     ....---.|-.||...|--..|.++.||.||
T Consensus        36 kgTE~p~tGey~~~~e~GvY~C~~C~~pLykS~tKfdsgcGWPA   79 (146)
T KOG0856|consen   36 KGTERPGTGEYTKHFEEGVYVCAGCGTPLYKSTTKFDSGCGWPA   79 (146)
T ss_pred             hcccCCCCcccccccCCceEEEeecCCccccccccccCCCCCch
Confidence            67766665     2234456799999999999999999999994


No 32 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=60.52  E-value=4.7  Score=26.11  Aligned_cols=8  Identities=38%  Similarity=1.310  Sum_probs=5.7

Q ss_pred             ccccccCc
Q 034400           33 RCAACAYP   40 (95)
Q Consensus        33 ~Ca~CGyp   40 (95)
                      +|..|||-
T Consensus        38 ~C~~CGYT   45 (64)
T PF09855_consen   38 SCTNCGYT   45 (64)
T ss_pred             ECCCCCCE
Confidence            57777773


No 33 
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=59.77  E-value=5.2  Score=25.65  Aligned_cols=23  Identities=30%  Similarity=0.933  Sum_probs=19.8

Q ss_pred             ccccccCCCccccccccccccccCc
Q 034400           16 HTLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        16 H~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      -..|.-||.  |++....|..|||.
T Consensus        27 ~~~c~~cG~--~~l~Hrvc~~cg~Y   49 (57)
T COG0333          27 LSVCPNCGE--YKLPHRVCLKCGYY   49 (57)
T ss_pred             ceeccCCCC--cccCceEcCCCCCc
Confidence            367999995  89999999999984


No 34 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=58.29  E-value=5.8  Score=25.23  Aligned_cols=20  Identities=30%  Similarity=0.806  Sum_probs=17.1

Q ss_pred             ccccCCCccccccccccccccCc
Q 034400           18 LCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      .|..||.-.+   +.+|..||-+
T Consensus         7 ~C~~CgvYTL---k~~CP~CG~~   26 (56)
T PRK13130          7 KCPKCGVYTL---KEICPVCGGK   26 (56)
T ss_pred             ECCCCCCEEc---cccCcCCCCC
Confidence            5889998777   9999999975


No 35 
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=55.45  E-value=12  Score=27.55  Aligned_cols=29  Identities=17%  Similarity=0.471  Sum_probs=25.7

Q ss_pred             CCcccccccCCCccccccccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      ..-.-.|..||...|--+.|.-+.||+||
T Consensus        37 ~~G~Y~C~~Cg~pLF~S~~KfdSg~GWPS   65 (134)
T TIGR00357        37 EEGIYVDITCGEPLFSSEDKFDSGCGWPS   65 (134)
T ss_pred             CCeEEEccCCCCccccccchhcCCCCCcC
Confidence            34456799999999999999999999995


No 36 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=55.14  E-value=7.4  Score=21.12  Aligned_cols=22  Identities=27%  Similarity=0.736  Sum_probs=15.7

Q ss_pred             ccccCCCccccccccccccccCc
Q 034400           18 LCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      .|..|+... -+.-+.|..|||-
T Consensus         2 ~CP~C~~~V-~~~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEV-PESAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCc-hhhcCcCCCCCCC
Confidence            377777765 4556789999983


No 37 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=52.98  E-value=7.6  Score=22.36  Aligned_cols=22  Identities=23%  Similarity=0.720  Sum_probs=15.4

Q ss_pred             ccccCCCccc----cccccccccccC
Q 034400           18 LCVRCGRRSF----HLQKSRCAACAY   39 (95)
Q Consensus        18 lCrRCG~~sy----H~qKk~Ca~CGy   39 (95)
                      .|..||...+    ..-.-.|..||.
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGL   27 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-B
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCC
Confidence            5899999863    233458999997


No 38 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=52.90  E-value=6  Score=22.03  Aligned_cols=22  Identities=32%  Similarity=0.804  Sum_probs=12.9

Q ss_pred             ccccccCCCcccccccccccccc
Q 034400           16 HTLCVRCGRRSFHLQKSRCAACA   38 (95)
Q Consensus        16 H~lCrRCG~~syH~qKk~Ca~CG   38 (95)
                      -..|..||...|=.+ ..|..||
T Consensus        11 ~~rC~~Cg~~~~pPr-~~Cp~C~   32 (37)
T PF12172_consen   11 GQRCRDCGRVQFPPR-PVCPHCG   32 (37)
T ss_dssp             EEE-TTT--EEES---SEETTTT
T ss_pred             EEEcCCCCCEecCCC-cCCCCcC
Confidence            356889998755444 8999997


No 39 
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.79  E-value=7.3  Score=28.73  Aligned_cols=26  Identities=35%  Similarity=0.754  Sum_probs=21.4

Q ss_pred             cccccccCCC----ccccccccccccccCc
Q 034400           15 THTLCVRCGR----RSFHLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~----~syH~qKk~Ca~CGyp   40 (95)
                      .+-+|.|||.    +.|=.-...|.+||..
T Consensus        20 l~grCP~CGeGrLF~gFLK~~p~C~aCG~d   49 (126)
T COG5349          20 LRGRCPRCGEGRLFRGFLKVVPACEACGLD   49 (126)
T ss_pred             hcCCCCCCCCchhhhhhcccCchhhhcccc
Confidence            3568999997    6788889999999963


No 40 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=49.48  E-value=7.6  Score=21.47  Aligned_cols=24  Identities=29%  Similarity=0.733  Sum_probs=15.2

Q ss_pred             ccccccCCCcccccc---------ccccccccCc
Q 034400           16 HTLCVRCGRRSFHLQ---------KSRCAACAYP   40 (95)
Q Consensus        16 H~lCrRCG~~syH~q---------Kk~Ca~CGyp   40 (95)
                      .+.|.+||.. |-++         +-+|+.||.+
T Consensus         2 ~~~CP~C~~~-~~v~~~~~~~~~~~v~C~~C~~~   34 (38)
T TIGR02098         2 RIQCPNCKTS-FRVVDSQLGANGGKVRCGKCGHV   34 (38)
T ss_pred             EEECCCCCCE-EEeCHHHcCCCCCEEECCCCCCE
Confidence            4678888874 2221         3478888853


No 41 
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=48.93  E-value=12  Score=23.92  Aligned_cols=24  Identities=25%  Similarity=0.609  Sum_probs=15.1

Q ss_pred             ccccCCCccccccccccccccCcc
Q 034400           18 LCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        18 lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      +|.-|+..-=.-+.-.|..||+|.
T Consensus         1 ~Cpv~~~~~~~~v~~~Cp~cGipt   24 (55)
T PF13824_consen    1 LCPVCKKDLPAHVNFECPDCGIPT   24 (55)
T ss_pred             CCCCCccccccccCCcCCCCCCcC
Confidence            355555544445566788888873


No 42 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=47.88  E-value=11  Score=28.28  Aligned_cols=27  Identities=22%  Similarity=0.639  Sum_probs=24.2

Q ss_pred             cccccccCCCccccccccccccccCcc
Q 034400           15 THTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        15 tH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      ---.|.-||..-|.-.-|.-+-||.||
T Consensus        41 GiY~c~~cg~pLF~S~~KfdSgcGWPS   67 (140)
T COG0229          41 GIYVCIVCGEPLFSSEDKFDSGCGWPS   67 (140)
T ss_pred             ceEEeecCCCccccccccccCCCCCcc
Confidence            345799999999999999999999994


No 43 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=47.33  E-value=9.4  Score=25.75  Aligned_cols=12  Identities=33%  Similarity=0.886  Sum_probs=7.9

Q ss_pred             ccccccccCccc
Q 034400           31 KSRCAACAYPAA   42 (95)
Q Consensus        31 Kk~Ca~CGyps~   42 (95)
                      ...|..||||+.
T Consensus        80 ~~~C~~CG~pss   91 (104)
T TIGR00269        80 LRRCERCGEPTS   91 (104)
T ss_pred             CCcCCcCcCcCC
Confidence            356777777754


No 44 
>PRK05580 primosome assembly protein PriA; Validated
Probab=46.77  E-value=13  Score=32.64  Aligned_cols=28  Identities=32%  Similarity=0.788  Sum_probs=19.3

Q ss_pred             CcccccccCCCc----------ccccccc--ccccccCcc
Q 034400           14 KTHTLCVRCGRR----------SFHLQKS--RCAACAYPA   41 (95)
Q Consensus        14 ktH~lCrRCG~~----------syH~qKk--~Ca~CGyps   41 (95)
                      ...+.|+.||..          .||....  .|--|||..
T Consensus       379 ~~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~  418 (679)
T PRK05580        379 APFLLCRDCGWVAECPHCDASLTLHRFQRRLRCHHCGYQE  418 (679)
T ss_pred             CCceEhhhCcCccCCCCCCCceeEECCCCeEECCCCcCCC
Confidence            356778888855          5886554  488888853


No 45 
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=46.24  E-value=11  Score=29.66  Aligned_cols=26  Identities=27%  Similarity=0.756  Sum_probs=22.8

Q ss_pred             CCCcccccccCCCccccccccccccccC
Q 034400           12 RNKTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        12 ~~ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      .++.+|+|--|-.+.+  +..+|.+||-
T Consensus       158 k~~hcilCtvCe~r~w--~g~~CPKCGr  183 (200)
T PF12387_consen  158 KSKHCILCTVCEGREW--KGGNCPKCGR  183 (200)
T ss_pred             CCCceEEEeeeecCcc--CCCCCCcccC
Confidence            3678999999999999  7788999995


No 46 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=45.75  E-value=11  Score=29.30  Aligned_cols=26  Identities=23%  Similarity=0.556  Sum_probs=19.8

Q ss_pred             CcccccccCCCcccc---ccccccccccC
Q 034400           14 KTHTLCVRCGRRSFH---LQKSRCAACAY   39 (95)
Q Consensus        14 ktH~lCrRCG~~syH---~qKk~Ca~CGy   39 (95)
                      .+|-.|.+||.....   -....|.+||.
T Consensus        97 ~~~~fC~~CG~~~~~~~~~~~~~C~~c~~  125 (256)
T PRK00241         97 RSHRFCGYCGHPMHPSKTEWAMLCPHCRE  125 (256)
T ss_pred             hcCccccccCCCCeecCCceeEECCCCCC
Confidence            578899999998543   34567999985


No 47 
>PF10555 MraY_sig1:  Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 ;  InterPro: IPR018480 Phospho-N-acetylmuramoyl-pentapeptide-transferase (2.7.8.13 from EC) (MraY) is a bacterial enzyme responsible for the formation of the first lipid intermediate of the cell wall peptidoglycan synthesis []. It catalyses the formation of undecaprenyl-pyrophosphoryl-N-acetylmuramoyl-pentapeptide from UDP-MurNAc-pentapeptide and undecaprenyl-phosphate.  MraY is an integral membrane protein with probably ten transmembrane domains. It belongs to family 4 of glycosyl transferases. Homologues of MraY have been found in archaebacteria Methanobacterium thermoautotrophicum and in Arabidopsis thaliana (Mouse-ear cress). This entry represents two conserved sites found in these proteins. The first site is located at the end of the first cytoplasmic loop and the beginning of the second transmembrane domain. The second site is located in the third cytoplasmic loop.
Probab=45.39  E-value=10  Score=18.23  Aligned_cols=7  Identities=43%  Similarity=0.824  Sum_probs=6.0

Q ss_pred             CCCCCCC
Q 034400            3 KGTGSFG    9 (95)
Q Consensus         3 KGT~SfG    9 (95)
                      +|||.||
T Consensus         2 ~gTPTMG    8 (13)
T PF10555_consen    2 SGTPTMG    8 (13)
T ss_pred             CCCccce
Confidence            6899998


No 48 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=45.14  E-value=11  Score=28.88  Aligned_cols=32  Identities=38%  Similarity=0.637  Sum_probs=25.4

Q ss_pred             CcccccccCCCccccccccccccccCccccccc
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAYPAARKRT   46 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGyps~k~R~   46 (95)
                      +--..|..|++. |+..+..|..||-|..+++.
T Consensus       137 ~w~~rC~GC~~~-f~~~~~~Cp~CG~~~~~~~~  168 (177)
T COG1439         137 KWRLRCHGCKRI-FPEPKDFCPICGSPLKRKRV  168 (177)
T ss_pred             eeeEEEecCcee-cCCCCCcCCCCCCceEEeee
Confidence            345689999864 77999999999998666554


No 49 
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=45.05  E-value=15  Score=26.48  Aligned_cols=32  Identities=19%  Similarity=0.551  Sum_probs=26.4

Q ss_pred             CCCCCcccccccCCCccccccccccccccCcc
Q 034400           10 KRRNKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        10 Kr~~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      .....-.-.|..||..-|.-..|.-+.||+||
T Consensus        31 ~~~~~G~Y~C~~Cg~pLF~S~~Kf~Sg~GWPS   62 (124)
T PF01641_consen   31 DHKEEGIYVCAVCGTPLFSSDTKFDSGCGWPS   62 (124)
T ss_dssp             CTTSSEEEEETTTS-EEEEGGGEETSSSSSSE
T ss_pred             CCCCCEEEEcCCCCCccccCcccccCCcCCcc
Confidence            33455667899999999999999999999995


No 50 
>PHA02942 putative transposase; Provisional
Probab=44.75  E-value=12  Score=30.76  Aligned_cols=26  Identities=23%  Similarity=0.749  Sum_probs=18.9

Q ss_pred             cccccccCCCccc--cccccccccccCc
Q 034400           15 THTLCVRCGRRSF--HLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~sy--H~qKk~Ca~CGyp   40 (95)
                      |--.|..||...-  ..+.-.|..|||-
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~  351 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYE  351 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCE
Confidence            5567999997643  2345689999995


No 51 
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=44.42  E-value=21  Score=26.45  Aligned_cols=29  Identities=24%  Similarity=0.628  Sum_probs=25.9

Q ss_pred             CCcccccccCCCccccccccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      ..-.-.|..||...|--..|.-+.||+||
T Consensus        40 ~~G~Y~C~~Cg~pLF~S~~Kf~Sg~GWPS   68 (142)
T PRK00222         40 EKGIYVCIVCGEPLFSSDTKFDSGCGWPS   68 (142)
T ss_pred             CCeEEEecCCCchhcCCcccccCCCCCcC
Confidence            34556999999999999999999999996


No 52 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=43.55  E-value=14  Score=21.43  Aligned_cols=24  Identities=38%  Similarity=0.847  Sum_probs=15.1

Q ss_pred             cccccCCCcc-c--cccccccccccCc
Q 034400           17 TLCVRCGRRS-F--HLQKSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~s-y--H~qKk~Ca~CGyp   40 (95)
                      ..|..||... |  ..+..+|..||.+
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCe
Confidence            4677888752 2  1225778888875


No 53 
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=43.45  E-value=12  Score=23.69  Aligned_cols=21  Identities=19%  Similarity=0.351  Sum_probs=16.9

Q ss_pred             ccccccCCCccccccccccccccC
Q 034400           16 HTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        16 H~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      -+.|..||.  |++....|. |||
T Consensus        27 ~~~c~~cg~--~~~pH~vc~-cG~   47 (60)
T PRK01110         27 LSVDKTTGE--YHLPHHVSP-KGY   47 (60)
T ss_pred             eeEcCCCCc--eeccceecC-Ccc
Confidence            357888884  788888899 997


No 54 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=42.96  E-value=10  Score=27.36  Aligned_cols=25  Identities=28%  Similarity=0.715  Sum_probs=20.8

Q ss_pred             cccccccCCCccccccc------cccccccC
Q 034400           15 THTLCVRCGRRSFHLQK------SRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qK------k~Ca~CGy   39 (95)
                      ...+|.-||+.--.+.|      ..|.+||.
T Consensus        96 ~yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa  126 (133)
T TIGR00311        96 KYVICRECNRPDTRIIKEGRVSLLKCEACGA  126 (133)
T ss_pred             heEECCCCCCCCcEEEEeCCeEEEecccCCC
Confidence            45799999998877776      58999997


No 55 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=42.52  E-value=14  Score=26.46  Aligned_cols=27  Identities=26%  Similarity=0.679  Sum_probs=21.3

Q ss_pred             CcccccccCCCccccccccccccccCcc
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      -.-+.|..||+. |+.-...|..||.+.
T Consensus        27 l~g~kC~~CG~v-~~PPr~~Cp~C~~~~   53 (140)
T COG1545          27 LLGTKCKKCGRV-YFPPRAYCPKCGSET   53 (140)
T ss_pred             EEEEEcCCCCeE-EcCCcccCCCCCCCC
Confidence            367889999975 556678999999764


No 56 
>PRK08329 threonine synthase; Validated
Probab=42.23  E-value=23  Score=28.19  Aligned_cols=66  Identities=20%  Similarity=0.341  Sum_probs=32.7

Q ss_pred             cccccCCCccccccccccccccCcccccccCCccccccccccccccccccccccc--hhcccCcCcCCCCCcc
Q 034400           17 TLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVP--RRFKSGFREGTQAAPR   87 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk~Ca~CGyps~k~R~YnWs~Ka~rr~ttGTGRmr~lk~v~--rrfkngFreGt~~~~~   87 (95)
                      ..|.+||...=--....| .||-|=.  ..|+++.....+...  |--||-.-++  ....--.-||.||.-+
T Consensus         2 l~C~~Cg~~~~~~~~~~C-~c~~~l~--~~~~~~~~~~~~~~~--~~wry~~~lP~~~~~~~sl~eg~Tpl~~   69 (347)
T PRK08329          2 LRCTKCGRTYEEKFKLRC-DCGGTLL--VEREYGSFDSPREYL--DMRRYIDYLPVDEEFLPHLTPPITPTVK   69 (347)
T ss_pred             cCcCCCCCCcCCCCceec-CCCCcEE--EEecccccccccccc--chhhhHHhCCCCCCCCCcCCCCCCcccc
Confidence            469999976422223579 7986532  234444221122222  3334433333  2222356688777543


No 57 
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=41.57  E-value=9.7  Score=25.34  Aligned_cols=22  Identities=27%  Similarity=0.819  Sum_probs=15.6

Q ss_pred             cccccCCCcccccc---ccccccccCc
Q 034400           17 TLCVRCGRRSFHLQ---KSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~syH~q---Kk~Ca~CGyp   40 (95)
                      +.| .||+.+|-.+   .+.| -||+.
T Consensus         4 frC-~Cgr~lya~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EEE-TTS--EEEETT-SEEEE-TTTEE
T ss_pred             EEe-cCCCEEEecCCcceeEe-cCCCe
Confidence            578 7999999654   5789 99983


No 58 
>PRK06450 threonine synthase; Validated
Probab=41.02  E-value=15  Score=29.41  Aligned_cols=24  Identities=29%  Similarity=0.873  Sum_probs=18.0

Q ss_pred             ccccccCCCcccccc-ccccccccCc
Q 034400           16 HTLCVRCGRRSFHLQ-KSRCAACAYP   40 (95)
Q Consensus        16 H~lCrRCG~~syH~q-Kk~Ca~CGyp   40 (95)
                      ...|.+||+. |... ...|..||-|
T Consensus         3 ~~~C~~Cg~~-~~~~~~~~C~~cg~~   27 (338)
T PRK06450          3 KEVCMKCGKE-RESIYEIRCKKCGGP   27 (338)
T ss_pred             eeEECCcCCc-CCCcccccCCcCCCE
Confidence            3589999988 5543 4579999975


No 59 
>KOG4192 consensus Uncharacterized conserved protein [Function unknown]
Probab=40.91  E-value=12  Score=27.78  Aligned_cols=24  Identities=46%  Similarity=0.927  Sum_probs=18.4

Q ss_pred             CCCCCCCcccccccCCCcccccccc
Q 034400            8 FGKRRNKTHTLCVRCGRRSFHLQKS   32 (95)
Q Consensus         8 fGKr~~ktH~lCrRCG~~syH~qKk   32 (95)
                      ||-+ .-.|+.|.+||=+||+...+
T Consensus        66 ~gth-~aqhtfck~cGV~sf~~~rs   89 (134)
T KOG4192|consen   66 FGTH-QAQHTFCKRCGVQSFYSPRS   89 (134)
T ss_pred             eccc-hhheeeeccccceecccccc
Confidence            4443 46799999999999997543


No 60 
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=40.42  E-value=16  Score=31.79  Aligned_cols=29  Identities=17%  Similarity=0.296  Sum_probs=25.9

Q ss_pred             CCcccccccCCCccccccccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      ..-.-.|..||..-|.-..|.-+.||+||
T Consensus       415 ~~G~y~c~~c~~pLf~s~~Kf~sg~GWPs  443 (521)
T PRK14018        415 KPGIYVDVVSGEPLFSSADKYDSGCGWPS  443 (521)
T ss_pred             CCEEEEecCCCCccccCcccccCCCCCcc
Confidence            34566899999999999999999999995


No 61 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=40.35  E-value=23  Score=20.09  Aligned_cols=23  Identities=26%  Similarity=0.642  Sum_probs=11.1

Q ss_pred             ccccCCCccccc--cccccccccCc
Q 034400           18 LCVRCGRRSFHL--QKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~--qKk~Ca~CGyp   40 (95)
                      +|-.||...--.  ..-+|-.|||.
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~R   26 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGHR   26 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-S
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCCe
Confidence            466666654421  22367777763


No 62 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=40.19  E-value=16  Score=22.26  Aligned_cols=25  Identities=32%  Similarity=0.773  Sum_probs=15.7

Q ss_pred             cccccccCCCcccc---ccccccccccC
Q 034400           15 THTLCVRCGRRSFH---LQKSRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH---~qKk~Ca~CGy   39 (95)
                      |--.|..||...-.   ...-.|..||+
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~   54 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGF   54 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCC
Confidence            44567777765433   44566777776


No 63 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=39.97  E-value=16  Score=20.98  Aligned_cols=21  Identities=33%  Similarity=1.115  Sum_probs=14.4

Q ss_pred             ccccCCCcccccc------ccccccccC
Q 034400           18 LCVRCGRRSFHLQ------KSRCAACAY   39 (95)
Q Consensus        18 lCrRCG~~syH~q------Kk~Ca~CGy   39 (95)
                      +|..||+ .||+.      ...|..||-
T Consensus         3 ~C~~Cg~-~Yh~~~~pP~~~~~Cd~cg~   29 (36)
T PF05191_consen    3 ICPKCGR-IYHIEFNPPKVEGVCDNCGG   29 (36)
T ss_dssp             EETTTTE-EEETTTB--SSTTBCTTTTE
T ss_pred             CcCCCCC-ccccccCCCCCCCccCCCCC
Confidence            5777875 67873      356888874


No 64 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=39.95  E-value=16  Score=27.64  Aligned_cols=28  Identities=21%  Similarity=0.476  Sum_probs=23.1

Q ss_pred             ccccccCCCccccccccccccccCcccc
Q 034400           16 HTLCVRCGRRSFHLQKSRCAACAYPAAR   43 (95)
Q Consensus        16 H~lCrRCG~~syH~qKk~Ca~CGyps~k   43 (95)
                      --+|+-||--..=.--..|..||-|..+
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~k~~  161 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAPKEK  161 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCChHHH
Confidence            4579999998888888999999977543


No 65 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=39.37  E-value=15  Score=25.70  Aligned_cols=23  Identities=30%  Similarity=0.842  Sum_probs=18.8

Q ss_pred             cccccCCCccccc-----cccccccccC
Q 034400           17 TLCVRCGRRSFHL-----QKSRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~-----qKk~Ca~CGy   39 (95)
                      ..|..||+--|=.     ....|.+|||
T Consensus         3 ~FCp~Cgsll~p~~~~~~~~l~C~kCgy   30 (113)
T COG1594           3 RFCPKCGSLLYPKKDDEGGKLVCRKCGY   30 (113)
T ss_pred             cccCCccCeeEEeEcCCCcEEECCCCCc
Confidence            4699999988873     3678999999


No 66 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=39.36  E-value=22  Score=19.39  Aligned_cols=24  Identities=21%  Similarity=0.400  Sum_probs=15.8

Q ss_pred             cccccCCCcccc------ccccccccccCc
Q 034400           17 TLCVRCGRRSFH------LQKSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~syH------~qKk~Ca~CGyp   40 (95)
                      ..|.-||..---      .....|..||-+
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (41)
T smart00834        6 YRCEDCGHTFEVLQKISDDPLATCPECGGD   35 (41)
T ss_pred             EEcCCCCCEEEEEEecCCCCCCCCCCCCCc
Confidence            468888883322      335679999964


No 67 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=39.20  E-value=22  Score=31.63  Aligned_cols=29  Identities=17%  Similarity=0.565  Sum_probs=19.3

Q ss_pred             CCCCCCcccccccCCCccccccccccccccCc
Q 034400            9 GKRRNKTHTLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus         9 GKr~~ktH~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      |.-+....-.|..||..-   ..+.|..||.+
T Consensus         8 g~~n~~~akFC~~CG~~l---~~~~Cp~CG~~   36 (645)
T PRK14559          8 QFENPNNNRFCQKCGTSL---THKPCPQCGTE   36 (645)
T ss_pred             CCcCCCCCccccccCCCC---CCCcCCCCCCC
Confidence            445556677888888864   23567777774


No 68 
>PRK11823 DNA repair protein RadA; Provisional
Probab=39.07  E-value=18  Score=30.18  Aligned_cols=26  Identities=35%  Similarity=0.735  Sum_probs=20.7

Q ss_pred             CCcccccccCCCccccccccccccccC
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      .|+...|..||-.+--.+ ..|.+|+-
T Consensus         4 ~~~~y~C~~Cg~~~~~~~-g~Cp~C~~   29 (446)
T PRK11823          4 KKTAYVCQECGAESPKWL-GRCPECGA   29 (446)
T ss_pred             CCCeEECCcCCCCCcccC-eeCcCCCC
Confidence            378899999998775444 78999985


No 69 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=38.95  E-value=15  Score=27.75  Aligned_cols=34  Identities=29%  Similarity=0.706  Sum_probs=24.9

Q ss_pred             cccccccCCCccccccc------cccccccC--cccccccCC
Q 034400           15 THTLCVRCGRRSFHLQK------SRCAACAY--PAARKRTYN   48 (95)
Q Consensus        15 tH~lCrRCG~~syH~qK------k~Ca~CGy--ps~k~R~Yn   48 (95)
                      ...+|.-|++.--.+.+      ..|.+||.  |-.....-|
T Consensus        97 ~yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~~v~~~~~~~  138 (201)
T PRK12336         97 EYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKASS  138 (201)
T ss_pred             heEECCCCCCCCcEEEEcCCeEEEEcccCCCCcccccccccc
Confidence            46799999998887776      47999999  544444333


No 70 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=38.83  E-value=18  Score=22.73  Aligned_cols=22  Identities=32%  Similarity=1.081  Sum_probs=16.5

Q ss_pred             cccccCCCccccccccccccccC
Q 034400           17 TLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      -+|++|+-+- ++.-..|-.|||
T Consensus        15 ~ICrkC~ARn-p~~A~~CRKCg~   36 (48)
T PRK04136         15 KICMRCNARN-PWRATKCRKCGY   36 (48)
T ss_pred             cchhcccCCC-CccccccccCCC
Confidence            4788888764 566677888887


No 71 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=38.00  E-value=17  Score=25.14  Aligned_cols=37  Identities=24%  Similarity=0.486  Sum_probs=22.4

Q ss_pred             CCCCCCCCCC----CCcccccccCCCcccccc---ccccccccCc
Q 034400            3 KGTGSFGKRR----NKTHTLCVRCGRRSFHLQ---KSRCAACAYP   40 (95)
Q Consensus         3 KGT~SfGKr~----~ktH~lCrRCG~~syH~q---Kk~Ca~CGyp   40 (95)
                      +||..-|-.-    -+.-..|+.||. .|-+.   ...|..||=+
T Consensus        53 ~~t~~egA~L~i~~~p~~~~C~~Cg~-~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         53 RGTVAEGCKLHLEEQEAECWCETCQQ-YVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             CCCccCCCEEEEEeeCcEEEcccCCC-eeecCCccCCcCcCcCCC
Confidence            4555444321    355678999995 44332   2559999954


No 72 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=36.44  E-value=18  Score=29.54  Aligned_cols=27  Identities=26%  Similarity=0.835  Sum_probs=22.5

Q ss_pred             CCcccccccCCCcccccc---ccccccccC
Q 034400           13 NKTHTLCVRCGRRSFHLQ---KSRCAACAY   39 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~q---Kk~Ca~CGy   39 (95)
                      ..+|-.|-+||.+.+=.+   +..|.+||.
T Consensus       108 ~~~~RFCg~CG~~~~~~~~g~~~~C~~cg~  137 (279)
T COG2816         108 YRSHRFCGRCGTKTYPREGGWARVCPKCGH  137 (279)
T ss_pred             HhhCcCCCCCCCcCccccCceeeeCCCCCC
Confidence            468999999999988554   678999996


No 73 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.25  E-value=21  Score=25.38  Aligned_cols=25  Identities=28%  Similarity=0.636  Sum_probs=19.6

Q ss_pred             CcccccccCCCcccc----------ccccccccccCc
Q 034400           14 KTHTLCVRCGRRSFH----------LQKSRCAACAYP   40 (95)
Q Consensus        14 ktH~lCrRCG~~syH----------~qKk~Ca~CGyp   40 (95)
                      +++.-|++|+.  ||          .|.-.|.+|++-
T Consensus        28 ~~~~~cP~C~s--~~~~k~g~~~~~~qRyrC~~C~~t   62 (129)
T COG3677          28 ITKVNCPRCKS--SNVVKIGGIRRGHQRYKCKSCGST   62 (129)
T ss_pred             cccCcCCCCCc--cceeeECCccccccccccCCcCcc
Confidence            46678999875  44          788999999973


No 74 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=36.00  E-value=16  Score=29.25  Aligned_cols=26  Identities=23%  Similarity=0.594  Sum_probs=21.9

Q ss_pred             cccccccCCCccccc----cccccccccCc
Q 034400           15 THTLCVRCGRRSFHL----QKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~syH~----qKk~Ca~CGyp   40 (95)
                      .-+.|..|+..-|+.    .-.+|..|||.
T Consensus        25 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   54 (285)
T TIGR00515        25 VWTKCPKCGQVLYTKELERNLEVCPKCDHH   54 (285)
T ss_pred             CeeECCCCcchhhHHHHHhhCCCCCCCCCc
Confidence            468899999999986    34799999993


No 75 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=35.79  E-value=20  Score=24.78  Aligned_cols=26  Identities=15%  Similarity=0.589  Sum_probs=17.3

Q ss_pred             CcccccccCCCccccc--cccccccccCc
Q 034400           14 KTHTLCVRCGRRSFHL--QKSRCAACAYP   40 (95)
Q Consensus        14 ktH~lCrRCG~~syH~--qKk~Ca~CGyp   40 (95)
                      +.-..|+.||.. |-+  ....|..||-+
T Consensus        68 p~~~~C~~Cg~~-~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         68 PAQAWCWDCSQV-VEIHQHDAQCPHCHGE   95 (113)
T ss_pred             CcEEEcccCCCE-EecCCcCccCcCCCCC
Confidence            455789999943 333  33459999944


No 76 
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=35.57  E-value=13  Score=24.44  Aligned_cols=16  Identities=38%  Similarity=0.667  Sum_probs=11.1

Q ss_pred             CcccccccCCCccccc
Q 034400           14 KTHTLCVRCGRRSFHL   29 (95)
Q Consensus        14 ktH~lCrRCG~~syH~   29 (95)
                      -.-+-|||||+.---+
T Consensus         8 IV~t~CrRCGk~i~tl   23 (60)
T PF10892_consen    8 IVETPCRRCGKSIRTL   23 (60)
T ss_pred             eeeehhhhhCccHHHH
Confidence            3557899999865433


No 77 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=35.57  E-value=20  Score=23.60  Aligned_cols=23  Identities=26%  Similarity=0.709  Sum_probs=18.2

Q ss_pred             ccccCCCccccc-cccccccccCc
Q 034400           18 LCVRCGRRSFHL-QKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~-qKk~Ca~CGyp   40 (95)
                      .|..||..-+=. ..-.|..|||-
T Consensus         2 fC~~Cg~~l~~~~~~~~C~~C~~~   25 (104)
T TIGR01384         2 FCPKCGSLMTPKNGVYVCPSCGYE   25 (104)
T ss_pred             CCcccCcccccCCCeEECcCCCCc
Confidence            589999887643 56789999985


No 78 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=35.24  E-value=20  Score=20.31  Aligned_cols=23  Identities=26%  Similarity=0.882  Sum_probs=14.6

Q ss_pred             cccccCCCcccccccc----ccccccC
Q 034400           17 TLCVRCGRRSFHLQKS----RCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk----~Ca~CGy   39 (95)
                      ..|..||.--|-....    .|..|||
T Consensus         2 ~FCp~C~nlL~p~~~~~~~~~C~~C~Y   28 (35)
T PF02150_consen    2 RFCPECGNLLYPKEDKEKRVACRTCGY   28 (35)
T ss_dssp             -BETTTTSBEEEEEETTTTEEESSSS-
T ss_pred             eeCCCCCccceEcCCCccCcCCCCCCC
Confidence            3588888877643321    4899999


No 79 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=34.84  E-value=24  Score=17.93  Aligned_cols=22  Identities=32%  Similarity=0.751  Sum_probs=14.5

Q ss_pred             ccccCCCccccccccccccccCc
Q 034400           18 LCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      .|..|+-.-|..+. .|..|+-|
T Consensus         4 ~C~~C~~~N~~~~~-~C~~C~~p   25 (26)
T smart00547        4 ECPACTFLNFASRS-KCFACGAP   25 (26)
T ss_pred             cCCCCCCcChhhhc-cccccCCc
Confidence            46667766666655 77777754


No 80 
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=34.53  E-value=33  Score=27.82  Aligned_cols=29  Identities=31%  Similarity=0.701  Sum_probs=26.1

Q ss_pred             CCcccccccCCCccccccccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      .+=.-.|..||...|.-+.|.-+.||+||
T Consensus        33 ~~G~y~c~~c~~~LF~s~~Kf~sg~GWPs   61 (283)
T PRK05550         33 EKGVYLCRRCGAPLFRSEDKFNSGCGWPS   61 (283)
T ss_pred             CCcEEEcCCCCchhcCChhhccCCCCCcC
Confidence            45566799999999999999999999996


No 81 
>PF10217 DUF2039:  Uncharacterized conserved protein (DUF2039);  InterPro: IPR019351  This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. 
Probab=34.40  E-value=8  Score=26.90  Aligned_cols=12  Identities=33%  Similarity=0.805  Sum_probs=9.4

Q ss_pred             cccccccccCcc
Q 034400           30 QKSRCAACAYPA   41 (95)
Q Consensus        30 qKk~Ca~CGyps   41 (95)
                      +...||.||-|.
T Consensus        80 ~~~vCaKC~k~~   91 (92)
T PF10217_consen   80 ELKVCAKCGKPP   91 (92)
T ss_pred             hhccCcccCCCC
Confidence            568899999753


No 82 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=33.43  E-value=25  Score=19.73  Aligned_cols=27  Identities=22%  Similarity=0.549  Sum_probs=16.4

Q ss_pred             cccccCCCccccc-cccccccccCcccc
Q 034400           17 TLCVRCGRRSFHL-QKSRCAACAYPAAR   43 (95)
Q Consensus        17 ~lCrRCG~~syH~-qKk~Ca~CGyps~k   43 (95)
                      -+|.-||-.--=. .-..|..||.|...
T Consensus         3 ~~C~~CG~i~~g~~~p~~CP~Cg~~~~~   30 (34)
T cd00729           3 WVCPVCGYIHEGEEAPEKCPICGAPKEK   30 (34)
T ss_pred             EECCCCCCEeECCcCCCcCcCCCCchHH
Confidence            3688888542111 23689999987543


No 83 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=33.20  E-value=24  Score=31.37  Aligned_cols=16  Identities=19%  Similarity=0.414  Sum_probs=8.0

Q ss_pred             cccccc--ccccccccCc
Q 034400           25 RSFHLQ--KSRCAACAYP   40 (95)
Q Consensus        25 ~syH~q--Kk~Ca~CGyp   40 (95)
                      -.||..  .-.|--|||.
T Consensus       402 L~~h~~~~~l~Ch~CG~~  419 (665)
T PRK14873        402 LGLPSAGGTPRCRWCGRA  419 (665)
T ss_pred             eeEecCCCeeECCCCcCC
Confidence            345543  3446666653


No 84 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.13  E-value=15  Score=22.53  Aligned_cols=20  Identities=30%  Similarity=0.833  Sum_probs=14.2

Q ss_pred             cccccccccccCcccccccCCccccc
Q 034400           28 HLQKSRCAACAYPAARKRTYNWSVKA   53 (95)
Q Consensus        28 H~qKk~Ca~CGyps~k~R~YnWs~Ka   53 (95)
                      |+-.+.|+.||-|      |.|-.|.
T Consensus         5 ~lp~K~C~~C~rp------f~WRKKW   24 (42)
T PF10013_consen    5 NLPSKICPVCGRP------FTWRKKW   24 (42)
T ss_pred             cCCCCcCcccCCc------chHHHHH
Confidence            6777999999965      5555443


No 85 
>PRK04351 hypothetical protein; Provisional
Probab=33.08  E-value=23  Score=25.88  Aligned_cols=22  Identities=32%  Similarity=0.902  Sum_probs=13.1

Q ss_pred             cccccCCC-----cccccccccccccc
Q 034400           17 TLCVRCGR-----RSFHLQKSRCAACA   38 (95)
Q Consensus        17 ~lCrRCG~-----~syH~qKk~Ca~CG   38 (95)
                      -.|..||.     ++.+..+-.|+.|+
T Consensus       113 Y~C~~Cg~~~~r~Rr~n~~~yrCg~C~  139 (149)
T PRK04351        113 YECQSCGQQYLRKRRINTKRYRCGKCR  139 (149)
T ss_pred             EECCCCCCEeeeeeecCCCcEEeCCCC
Confidence            45666665     44555666666665


No 86 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=33.06  E-value=22  Score=27.62  Aligned_cols=59  Identities=19%  Similarity=0.380  Sum_probs=27.3

Q ss_pred             CcccccccCCCccccccccccccccCc-ccccccCCccccccccccccccccccccccchh
Q 034400           14 KTHTLCVRCGRRSFHLQKSRCAACAYP-AARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRR   73 (95)
Q Consensus        14 ktH~lCrRCG~~syH~qKk~Ca~CGyp-s~k~R~YnWs~Ka~rr~ttGTGRmr~lk~v~rr   73 (95)
                      +-+-.|-.||. .||.....|..||-. ..++..+.......-|=-+=----.|||+|++.
T Consensus       195 ~R~L~Cs~C~t-~W~~~R~~Cp~Cg~~~~~~l~~~~~e~~~~~rve~C~~C~~YlK~vd~~  254 (290)
T PF04216_consen  195 KRYLHCSLCGT-EWRFVRIKCPYCGNTDHEKLEYFTVEGEPAYRVEVCESCGSYLKTVDRE  254 (290)
T ss_dssp             EEEEEETTT---EEE--TTS-TTT---SS-EEE--------SEEEEEETTTTEEEEEEETT
T ss_pred             cEEEEcCCCCC-eeeecCCCCcCCCCCCCcceeeEecCCCCcEEEEECCcccchHHHHhhh
Confidence            34567777875 578888899999984 355555544444434433334455799999843


No 87 
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=32.00  E-value=20  Score=23.39  Aligned_cols=12  Identities=33%  Similarity=1.132  Sum_probs=10.2

Q ss_pred             CcccccccCCCc
Q 034400           14 KTHTLCVRCGRR   25 (95)
Q Consensus        14 ktH~lCrRCG~~   25 (95)
                      .-|+.|..||+.
T Consensus        71 h~H~~C~~Cg~i   82 (116)
T cd07153          71 HHHLICTKCGKV   82 (116)
T ss_pred             CCceEeCCCCCE
Confidence            469999999975


No 88 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=31.64  E-value=25  Score=22.97  Aligned_cols=20  Identities=35%  Similarity=1.099  Sum_probs=14.9

Q ss_pred             cccccCCCccccccccccccccC
Q 034400           17 TLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      .+|+.||.  |-++ ..|..||=
T Consensus         6 rkC~~cg~--YTLk-e~Cp~CG~   25 (59)
T COG2260           6 RKCPKCGR--YTLK-EKCPVCGG   25 (59)
T ss_pred             hcCcCCCc--eeec-ccCCCCCC
Confidence            46888875  5555 89999995


No 89 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.42  E-value=17  Score=29.69  Aligned_cols=31  Identities=19%  Similarity=0.503  Sum_probs=24.2

Q ss_pred             cccccccCCCcccccc----ccccccccCc---ccccc
Q 034400           15 THTLCVRCGRRSFHLQ----KSRCAACAYP---AARKR   45 (95)
Q Consensus        15 tH~lCrRCG~~syH~q----Kk~Ca~CGyp---s~k~R   45 (95)
                      .-+.|..|+...|+.+    ..+|..|||.   +++.|
T Consensus        37 lw~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rltAreR   74 (296)
T CHL00174         37 LWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDR   74 (296)
T ss_pred             CeeECCCccchhhHHHHHHcCCCCCCCCCCcCCCHHHH
Confidence            4678999999999865    4799999993   44444


No 90 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=31.11  E-value=27  Score=24.16  Aligned_cols=38  Identities=21%  Similarity=0.382  Sum_probs=23.2

Q ss_pred             CCCCCCCCC----CCCcccccccCCCccccc-c-ccccccccCcc
Q 034400            3 KGTGSFGKR----RNKTHTLCVRCGRRSFHL-Q-KSRCAACAYPA   41 (95)
Q Consensus         3 KGT~SfGKr----~~ktH~lCrRCG~~syH~-q-Kk~Ca~CGyps   41 (95)
                      +||..-|-.    .-+.-..|+.||.. |-+ + ...|..||-+.
T Consensus        53 ~~t~~ega~L~I~~~p~~~~C~~Cg~~-~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        53 EGTVAEGAKLNIEDEPVECECEDCSEE-VSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             CCCccCCCEEEEEeeCcEEEcccCCCE-EecCCcCccCcCCcCCC
Confidence            455544432    13556789999944 433 2 56699999553


No 91 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=31.07  E-value=19  Score=25.15  Aligned_cols=25  Identities=36%  Similarity=0.761  Sum_probs=19.2

Q ss_pred             cccccccCCCccccccc------cccccccC
Q 034400           15 THTLCVRCGRRSFHLQK------SRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qK------k~Ca~CGy   39 (95)
                      ...+|.-|++.-=.+.+      ..|.+||.
T Consensus        79 ~yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       79 EYVLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             hcEECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            35789999998877776      35888884


No 92 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=30.90  E-value=29  Score=20.72  Aligned_cols=23  Identities=35%  Similarity=0.869  Sum_probs=14.5

Q ss_pred             ccccCCCccccc--cccccccccCc
Q 034400           18 LCVRCGRRSFHL--QKSRCAACAYP   40 (95)
Q Consensus        18 lCrRCG~~syH~--qKk~Ca~CGyp   40 (95)
                      +|..||..---.  ..-.|..||+.
T Consensus         4 ~C~~Cg~~~~~~~~~~irC~~CG~r   28 (44)
T smart00659        4 ICGECGRENEIKSKDVVRCRECGYR   28 (44)
T ss_pred             ECCCCCCEeecCCCCceECCCCCce
Confidence            577777743322  45678888874


No 93 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=30.42  E-value=27  Score=20.81  Aligned_cols=13  Identities=38%  Similarity=0.828  Sum_probs=6.8

Q ss_pred             ccccccCCCcccc
Q 034400           16 HTLCVRCGRRSFH   28 (95)
Q Consensus        16 H~lCrRCG~~syH   28 (95)
                      -++|.|||+-...
T Consensus         2 ~~~CprC~kg~Hw   14 (36)
T PF14787_consen    2 PGLCPRCGKGFHW   14 (36)
T ss_dssp             --C-TTTSSSCS-
T ss_pred             CccCcccCCCcch
Confidence            3689999875433


No 94 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=30.41  E-value=18  Score=29.07  Aligned_cols=26  Identities=23%  Similarity=0.584  Sum_probs=21.8

Q ss_pred             cccccccCCCcccccc----ccccccccCc
Q 034400           15 THTLCVRCGRRSFHLQ----KSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~syH~q----Kk~Ca~CGyp   40 (95)
                      .-+.|..|+...|+.+    -.+|..|||-
T Consensus        26 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   55 (292)
T PRK05654         26 LWTKCPSCGQVLYRKELEANLNVCPKCGHH   55 (292)
T ss_pred             CeeECCCccchhhHHHHHhcCCCCCCCCCC
Confidence            4689999999999864    3699999993


No 95 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=30.20  E-value=20  Score=20.55  Aligned_cols=9  Identities=33%  Similarity=1.106  Sum_probs=4.9

Q ss_pred             ccccccccC
Q 034400           31 KSRCAACAY   39 (95)
Q Consensus        31 Kk~Ca~CGy   39 (95)
                      ..+|.+|||
T Consensus        22 R~vC~~Cg~   30 (34)
T PF14803_consen   22 RLVCPACGF   30 (34)
T ss_dssp             EEEETTTTE
T ss_pred             ceECCCCCC
Confidence            345666654


No 96 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=30.01  E-value=28  Score=20.02  Aligned_cols=15  Identities=40%  Similarity=0.866  Sum_probs=10.2

Q ss_pred             Ccccccccccccccc
Q 034400           24 RRSFHLQKSRCAACA   38 (95)
Q Consensus        24 ~~syH~qKk~Ca~CG   38 (95)
                      .+-||.|--.|..||
T Consensus        14 ~RR~~~~~isC~~CG   28 (35)
T PF07503_consen   14 NRRFHYQFISCTNCG   28 (35)
T ss_dssp             STTTT-TT--BTTCC
T ss_pred             CCcccCcCccCCCCC
Confidence            356999999999999


No 97 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=27.74  E-value=31  Score=33.71  Aligned_cols=21  Identities=29%  Similarity=0.928  Sum_probs=11.3

Q ss_pred             cccccCCCccccccccccccccCc
Q 034400           17 TLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        17 ~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      ..|..||..+|-   ..|..||.+
T Consensus       668 rkCPkCG~~t~~---~fCP~CGs~  688 (1337)
T PRK14714        668 RRCPSCGTETYE---NRCPDCGTH  688 (1337)
T ss_pred             EECCCCCCcccc---ccCcccCCc
Confidence            456666665442   255555544


No 98 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=27.67  E-value=35  Score=28.55  Aligned_cols=30  Identities=27%  Similarity=0.579  Sum_probs=19.4

Q ss_pred             CCCCCCCCCcccccccCCCccccccc-----cccccccCc
Q 034400            6 GSFGKRRNKTHTLCVRCGRRSFHLQK-----SRCAACAYP   40 (95)
Q Consensus         6 ~SfGKr~~ktH~lCrRCG~~syH~qK-----k~Ca~CGyp   40 (95)
                      |-.||-|   .+-|++|+.. |...-     ..|. ||-|
T Consensus       233 P~~GKYh---~~~c~~C~~~-~~~~~~~~~~~~Cp-CG~~  267 (374)
T TIGR00375       233 PLLGKYH---QTACEACGEP-AVSEDAETACANCP-CGGR  267 (374)
T ss_pred             cCCCccc---hhhhcccCCc-CCchhhhhcCCCCC-CCCc
Confidence            3456666   5678888754 33333     6799 9976


No 99 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=27.58  E-value=31  Score=25.36  Aligned_cols=26  Identities=27%  Similarity=0.738  Sum_probs=20.3

Q ss_pred             cccccccCCCcccccc-ccccccccCc
Q 034400           15 THTLCVRCGRRSFHLQ-KSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~syH~q-Kk~Ca~CGyp   40 (95)
                      +-.-|..||..-|-.+ +-.|..|||.
T Consensus        27 L~~hCp~Cg~PLF~KdG~v~CPvC~~~   53 (131)
T COG1645          27 LAKHCPKCGTPLFRKDGEVFCPVCGYR   53 (131)
T ss_pred             HHhhCcccCCcceeeCCeEECCCCCce
Confidence            3456999999999744 4579999974


No 100
>PRK09462 fur ferric uptake regulator; Provisional
Probab=27.44  E-value=26  Score=24.44  Aligned_cols=12  Identities=33%  Similarity=1.041  Sum_probs=10.0

Q ss_pred             cccccccCCCcc
Q 034400           15 THTLCVRCGRRS   26 (95)
Q Consensus        15 tH~lCrRCG~~s   26 (95)
                      -|..|..||+..
T Consensus        89 ~H~iC~~Cg~i~  100 (148)
T PRK09462         89 DHLICLDCGKVI  100 (148)
T ss_pred             CceEECCCCCEE
Confidence            689999999753


No 101
>PF03858 Crust_neuro_H:  Crustacean neurohormone H;  InterPro: IPR005558 Arthropod express a family of neuropeptides [] which so far consist of the following types of neurohormones:  Crustacean hyperglycemic hormone (CHH). CHH is primarily involved in blood sugar regulation, but also plays a role in the control of molting and reproduction. Molt-inhibiting hormone (MIH). MIH inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Gonad-inhibiting hormone (GIH), also known as vitellogenesis-inhibiting hormone (VIH) because of its role in inhibiting vitellogenesis in female animals. Mandibular organ-inhibiting hormone (MOIH). MOIH represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Ion transport peptide (ITP) from locust. ITP stimulates salt and water reabsorption and inhibits acid secretion in the ileum of the locust.  Caenorhabditis elegans hypothetical protein ZC168.2.  These neurohormones are peptides of 70 to 80 residues which are processed from larger size precursors. They contain six conserved cysteines that are involved in disulphide bonds, as shown in the following schematic representation.  Crustacean neurohormone H proteins are referred to as precursor-related peptides as they are typically co-transcribed and translated with the CHH neurohormone (IPR001166 from INTERPRO). However, in some species this neuropeptide is synthesized as a separate protein. Furthermore, neurohormone H can undergo proteolysis to give rise to 5 different neuropeptides [].
Probab=26.94  E-value=17  Score=22.25  Aligned_cols=17  Identities=41%  Similarity=0.516  Sum_probs=12.3

Q ss_pred             cccccccccccccccch
Q 034400           56 RKTTGTGRMRYLRHVPR   72 (95)
Q Consensus        56 r~ttGTGRmr~lk~v~r   72 (95)
                      |.+.|.|||..|-.-.|
T Consensus         1 RSaeG~GRMerLLaSlr   17 (41)
T PF03858_consen    1 RSAEGFGRMERLLASLR   17 (41)
T ss_pred             CCccchhhHHHHHHHHh
Confidence            56789999987755443


No 102
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=26.61  E-value=37  Score=28.50  Aligned_cols=26  Identities=31%  Similarity=0.744  Sum_probs=20.2

Q ss_pred             CCcccccccCCCccccccccccccccC
Q 034400           13 NKTHTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      .|+...|..||-.+.-. -..|.+|+-
T Consensus         4 ~~~~y~C~~Cg~~~~~~-~g~Cp~C~~   29 (454)
T TIGR00416         4 AKSKFVCQHCGADSPKW-QGKCPACHA   29 (454)
T ss_pred             CCCeEECCcCCCCCccc-cEECcCCCC
Confidence            46888999999876433 378999985


No 103
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=26.34  E-value=27  Score=25.37  Aligned_cols=25  Identities=32%  Similarity=0.748  Sum_probs=20.2

Q ss_pred             cccccccCCCccccccc------cccccccC
Q 034400           15 THTLCVRCGRRSFHLQK------SRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qK------k~Ca~CGy   39 (95)
                      ...+|.-||+.--.+.|      ..|.+||.
T Consensus       101 ~yVlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988        101 EYVICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             hcEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            45789999998877776      36999997


No 104
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=26.15  E-value=53  Score=20.88  Aligned_cols=33  Identities=21%  Similarity=0.534  Sum_probs=24.9

Q ss_pred             CCCCCCC--cccccccCCCccccccc--cccccccCc
Q 034400            8 FGKRRNK--THTLCVRCGRRSFHLQK--SRCAACAYP   40 (95)
Q Consensus         8 fGKr~~k--tH~lCrRCG~~syH~qK--k~Ca~CGyp   40 (95)
                      +|.+|.-  ....|..||+..--...  ..|..||-|
T Consensus         8 ~a~~H~L~~~~~NCl~CGkIiC~~Eg~~~pC~fCg~~   44 (57)
T PF06221_consen    8 QARRHPLFPYAPNCLNCGKIICEQEGPLGPCPFCGTP   44 (57)
T ss_pred             ccccCCCccccccccccChhhcccccCcCcCCCCCCc
Confidence            3555532  36679999999988887  899999975


No 105
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=25.99  E-value=40  Score=21.87  Aligned_cols=27  Identities=22%  Similarity=0.695  Sum_probs=17.1

Q ss_pred             CcccccccCCCc-ccc-------ccccccccccCc
Q 034400           14 KTHTLCVRCGRR-SFH-------LQKSRCAACAYP   40 (95)
Q Consensus        14 ktH~lCrRCG~~-syH-------~qKk~Ca~CGyp   40 (95)
                      -++..|.-||.. .+-       -.--+|.+|||-
T Consensus        23 ~~~F~CPnCG~~~I~RC~~CRk~~~~Y~CP~CGF~   57 (59)
T PRK14890         23 AVKFLCPNCGEVIIYRCEKCRKQSNPYTCPKCGFE   57 (59)
T ss_pred             cCEeeCCCCCCeeEeechhHHhcCCceECCCCCCc
Confidence            477888888876 221       123467788873


No 106
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=25.89  E-value=27  Score=24.91  Aligned_cols=25  Identities=36%  Similarity=0.786  Sum_probs=19.0

Q ss_pred             cccccccCCCcccccccc------ccccccC
Q 034400           15 THTLCVRCGRRSFHLQKS------RCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qKk------~Ca~CGy   39 (95)
                      ...+|.-|++.--.+.+.      .|.+||.
T Consensus        92 ~yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  122 (125)
T PF01873_consen   92 EYVLCPECGSPDTELIKEGRLIFLKCKACGA  122 (125)
T ss_dssp             HHSSCTSTSSSSEEEEEETTCCEEEETTTSC
T ss_pred             HEEEcCCCCCCccEEEEcCCEEEEEecccCC
Confidence            357899999887777664      6888885


No 107
>PRK08764 ferredoxin; Provisional
Probab=25.55  E-value=35  Score=23.87  Aligned_cols=13  Identities=23%  Similarity=0.887  Sum_probs=10.4

Q ss_pred             cccccccccccCc
Q 034400           28 HLQKSRCAACAYP   40 (95)
Q Consensus        28 H~qKk~Ca~CGyp   40 (95)
                      .+-+.-|+.||||
T Consensus        14 ~lp~~ncg~cg~~   26 (135)
T PRK08764         14 LLPQTQCGQCGFD   26 (135)
T ss_pred             hCCCCCCccCCCc
Confidence            3556789999998


No 108
>PF14653 IGFL:  Insulin growth factor-like family
Probab=25.07  E-value=35  Score=23.73  Aligned_cols=32  Identities=25%  Similarity=0.567  Sum_probs=23.5

Q ss_pred             ccccc---cCCCccccccccccccccC-cccccccC
Q 034400           16 HTLCV---RCGRRSFHLQKSRCAACAY-PAARKRTY   47 (95)
Q Consensus        16 H~lCr---RCG~~syH~qKk~Ca~CGy-ps~k~R~Y   47 (95)
                      ..+|.   |||.+.|+.++..|..=.+ +-.+.|.+
T Consensus        10 l~~Cq~~~rCG~~~YNPl~~cC~~~~iv~l~kT~~C   45 (89)
T PF14653_consen   10 LWLCQPAPRCGDKFYNPLEHCCCDDTIVPLPKTRKC   45 (89)
T ss_pred             cccccccCcccCcccChhhhcccCCcEEcCCCcccc
Confidence            45675   8999999999999976655 44555544


No 109
>KOG3241 consensus Uncharacterized conserved protein [Function unknown]
Probab=24.68  E-value=11  Score=30.02  Aligned_cols=20  Identities=35%  Similarity=0.913  Sum_probs=15.9

Q ss_pred             cccccccCCCccccccccccccccC
Q 034400           15 THTLCVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        15 tH~lCrRCG~~syH~qKk~Ca~CGy   39 (95)
                      -|++||.|-..     -+.||+|+-
T Consensus        82 YH~~Cr~CA~e-----~~vCAKC~k  101 (227)
T KOG3241|consen   82 YHKLCRGCAKE-----QKVCAKCCK  101 (227)
T ss_pred             HHHhcccHHHH-----HHHHHHHhc
Confidence            58888888654     489999986


No 110
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=24.48  E-value=38  Score=23.44  Aligned_cols=23  Identities=30%  Similarity=0.752  Sum_probs=16.1

Q ss_pred             cccccCCCccccccc---cccccccC
Q 034400           17 TLCVRCGRRSFHLQK---SRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qK---k~Ca~CGy   39 (95)
                      -.|..||+.+.--+-   ..|.+||+
T Consensus        37 y~CpfCgk~~vkR~a~GIW~C~~C~~   62 (90)
T PTZ00255         37 YFCPFCGKHAVKRQAVGIWRCKGCKK   62 (90)
T ss_pred             ccCCCCCCCceeeeeeEEEEcCCCCC
Confidence            458888877765444   67888886


No 111
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=23.99  E-value=37  Score=22.47  Aligned_cols=24  Identities=21%  Similarity=0.526  Sum_probs=12.0

Q ss_pred             ccccCCCccccccccccccccCcc
Q 034400           18 LCVRCGRRSFHLQKSRCAACAYPA   41 (95)
Q Consensus        18 lCrRCG~~syH~qKk~Ca~CGyps   41 (95)
                      .|.-|=...--..+.-|.+||.++
T Consensus        11 rC~aCf~~t~~~~k~FCp~CGn~T   34 (73)
T PF08772_consen   11 RCHACFKITKDMTKQFCPKCGNAT   34 (73)
T ss_dssp             E-SSS--EES-SS--S-SSS--S-
T ss_pred             EccccccCcCCCCceeCcccCCCc
Confidence            588888888888899999999873


No 112
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.93  E-value=50  Score=22.92  Aligned_cols=28  Identities=21%  Similarity=0.497  Sum_probs=18.8

Q ss_pred             CCcccccccCCCcccccc---ccccccccCcc
Q 034400           13 NKTHTLCVRCGRRSFHLQ---KSRCAACAYPA   41 (95)
Q Consensus        13 ~ktH~lCrRCG~~syH~q---Kk~Ca~CGyps   41 (95)
                      -+....|+.||.. |-+.   ...|..||=+.
T Consensus        68 vp~~~~C~~Cg~~-~~~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         68 EKVELECKDCSHV-FKPNALDYGVCEKCHSKN   98 (117)
T ss_pred             cCCEEEhhhCCCc-cccCCccCCcCcCCCCCc
Confidence            3567889999944 4332   23599999654


No 113
>PF01475 FUR:  Ferric uptake regulator family;  InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins. These are responsible for controlling the intracellular concentration of iron in many bacteria. Although iron is essential for most organisms, high concentrations can be toxic because of the formation of hydroxyl radicals []. FURs can also control zinc homeostasis [] and is the subject of research on the pathogenesis of mycobacteria.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1MZB_A 2RGV_B 2FE3_B 3F8N_B 3EYY_B 2W57_A 2FU4_A 2O03_A 3MWM_B 2XIG_B ....
Probab=23.68  E-value=31  Score=22.86  Aligned_cols=13  Identities=31%  Similarity=1.022  Sum_probs=9.9

Q ss_pred             CCcccccccCCCc
Q 034400           13 NKTHTLCVRCGRR   25 (95)
Q Consensus        13 ~ktH~lCrRCG~~   25 (95)
                      .-.|..|..||+.
T Consensus        77 ~h~h~iC~~Cg~v   89 (120)
T PF01475_consen   77 HHHHFICTQCGKV   89 (120)
T ss_dssp             SCEEEEETTTS-E
T ss_pred             cceEEEECCCCCE
Confidence            4579999999964


No 114
>PRK06260 threonine synthase; Validated
Probab=23.63  E-value=45  Score=26.93  Aligned_cols=24  Identities=21%  Similarity=0.686  Sum_probs=17.5

Q ss_pred             ccccccCCCcccccc--ccccccccCc
Q 034400           16 HTLCVRCGRRSFHLQ--KSRCAACAYP   40 (95)
Q Consensus        16 H~lCrRCG~~syH~q--Kk~Ca~CGyp   40 (95)
                      +..|.+||.. |...  -..|..||-+
T Consensus         3 ~~~C~~cg~~-~~~~~~~~~Cp~cg~~   28 (397)
T PRK06260          3 WLKCIECGKE-YDPDEIIYTCPECGGL   28 (397)
T ss_pred             EEEECCCCCC-CCCCCccccCCCCCCe
Confidence            4689999977 5433  2579999864


No 115
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=23.50  E-value=35  Score=24.39  Aligned_cols=20  Identities=25%  Similarity=0.884  Sum_probs=16.3

Q ss_pred             cccCCCccccccccccccccC
Q 034400           19 CVRCGRRSFHLQKSRCAACAY   39 (95)
Q Consensus        19 CrRCG~~syH~qKk~Ca~CGy   39 (95)
                      |+-|| ...++.+-.|.+|+-
T Consensus         1 CPvCg-~~l~vt~l~C~~C~t   20 (113)
T PF09862_consen    1 CPVCG-GELVVTRLKCPSCGT   20 (113)
T ss_pred             CCCCC-CceEEEEEEcCCCCC
Confidence            78888 567888899999983


No 116
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=22.87  E-value=41  Score=23.39  Aligned_cols=23  Identities=22%  Similarity=0.664  Sum_probs=16.2

Q ss_pred             cccccCCCccccccc---cccccccC
Q 034400           17 TLCVRCGRRSFHLQK---SRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qK---k~Ca~CGy   39 (95)
                      -.|..||+.+.--+-   ..|.+||+
T Consensus        36 y~CpfCgk~~vkR~a~GIW~C~~C~~   61 (91)
T TIGR00280        36 YVCPFCGKKTVKRGSTGIWTCRKCGA   61 (91)
T ss_pred             ccCCCCCCCceEEEeeEEEEcCCCCC
Confidence            458888877754443   67888886


No 117
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=22.83  E-value=40  Score=22.16  Aligned_cols=28  Identities=21%  Similarity=0.667  Sum_probs=17.5

Q ss_pred             CCcccccccCCCc-cccc-------cccccccccCc
Q 034400           13 NKTHTLCVRCGRR-SFHL-------QKSRCAACAYP   40 (95)
Q Consensus        13 ~ktH~lCrRCG~~-syH~-------qKk~Ca~CGyp   40 (95)
                      +-++..|.-||.. -|--       .--+|.+|||-
T Consensus        24 ~~v~F~CPnCGe~~I~Rc~~CRk~g~~Y~Cp~CGF~   59 (61)
T COG2888          24 TAVKFPCPNCGEVEIYRCAKCRKLGNPYRCPKCGFE   59 (61)
T ss_pred             ceeEeeCCCCCceeeehhhhHHHcCCceECCCcCcc
Confidence            4577889999932 2222       22468888884


No 118
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=22.36  E-value=40  Score=24.19  Aligned_cols=26  Identities=23%  Similarity=0.710  Sum_probs=18.6

Q ss_pred             CcccccccCCCcccc---cc------ccccccccC
Q 034400           14 KTHTLCVRCGRRSFH---LQ------KSRCAACAY   39 (95)
Q Consensus        14 ktH~lCrRCG~~syH---~q------Kk~Ca~CGy   39 (95)
                      ++-+.|.+||...--   +.      --.|+.||-
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGl   54 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGL   54 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcc
Confidence            345779999987654   33      347999995


No 119
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=22.18  E-value=35  Score=25.05  Aligned_cols=29  Identities=24%  Similarity=0.717  Sum_probs=16.0

Q ss_pred             cccccCCCcccc--------------ccccccccccCcccccc
Q 034400           17 TLCVRCGRRSFH--------------LQKSRCAACAYPAARKR   45 (95)
Q Consensus        17 ~lCrRCG~~syH--------------~qKk~Ca~CGyps~k~R   45 (95)
                      ++|..||.....              +.--.|.+|||...-..
T Consensus         2 s~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGyk~~ev~   44 (161)
T PF03367_consen    2 SLCPNCGENGTTRILLTDIPYFKEVIIMSFECEHCGYKNNEVK   44 (161)
T ss_dssp             EE-TTTSSCCEEEEEEEEETTTEEEEEEEEE-TTT--EEEEEE
T ss_pred             CcCCCCCCCcEEEEEEEcCCCCceEEEEEeECCCCCCEeeeEE
Confidence            578889987643              12347999999754444


No 120
>PRK06991 ferredoxin; Provisional
Probab=22.14  E-value=44  Score=26.60  Aligned_cols=12  Identities=33%  Similarity=1.085  Sum_probs=9.7

Q ss_pred             ccccccccccCc
Q 034400           29 LQKSRCAACAYP   40 (95)
Q Consensus        29 ~qKk~Ca~CGyp   40 (95)
                      |-...|+.||||
T Consensus        15 LP~~nCg~CGy~   26 (270)
T PRK06991         15 LPQTQCTKCGYD   26 (270)
T ss_pred             CCCCCCccCCCC
Confidence            456789999998


No 121
>PRK07218 replication factor A; Provisional
Probab=22.07  E-value=46  Score=28.28  Aligned_cols=23  Identities=30%  Similarity=0.556  Sum_probs=19.4

Q ss_pred             cccccccCCCccccccccccccccCc
Q 034400           15 THTLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      .-.+|+-|++.-   |+..|..||-.
T Consensus       296 li~rCP~C~r~v---~~~~C~~hG~v  318 (423)
T PRK07218        296 LIERCPECGRVI---QKGQCRSHGAV  318 (423)
T ss_pred             ceecCcCccccc---cCCcCCCCCCc
Confidence            346899999997   88999999973


No 122
>PF06869 DUF1258:  Protein of unknown function (DUF1258);  InterPro: IPR009667 This family represents a conserved region approximately 260 residues long within a number of hypothetical proteins of unknown function that seem to be specific to Caenorhabditis elegans. Note that this family contains a number of conserved cysteine and histidine residues.
Probab=21.93  E-value=35  Score=27.71  Aligned_cols=24  Identities=33%  Similarity=0.773  Sum_probs=18.6

Q ss_pred             CCCcccccccCCCccccccccccccc
Q 034400           12 RNKTHTLCVRCGRRSFHLQKSRCAAC   37 (95)
Q Consensus        12 ~~ktH~lCrRCG~~syH~qKk~Ca~C   37 (95)
                      +--+|.+|..||+...+.++  |.-|
T Consensus        14 ~~S~h~~CN~CG~~~~~~~k--C~~c   37 (258)
T PF06869_consen   14 NFSTHFICNSCGKVVESNEK--CSCC   37 (258)
T ss_pred             cceeehhhhhhhhhhccCce--eecc
Confidence            34689999999997777764  6555


No 123
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=21.68  E-value=43  Score=24.92  Aligned_cols=14  Identities=21%  Similarity=0.608  Sum_probs=9.8

Q ss_pred             ccccccccCccccc
Q 034400           31 KSRCAACAYPAARK   44 (95)
Q Consensus        31 Kk~Ca~CGyps~k~   44 (95)
                      --.|..|||...-.
T Consensus        28 sf~C~~CGyr~~ev   41 (163)
T TIGR00340        28 TYICEKCGYRSTDV   41 (163)
T ss_pred             EEECCCCCCchhhe
Confidence            34799999975443


No 124
>PF08536 Whirly:  Whirly transcription factor;  InterPro: IPR013742 This is a family of plant transcription factors. ; PDB: 3R9Y_A 3N1I_A 3N1K_A 3RA0_A 3N1H_A 3N1J_A 3N1L_A 3R9Z_A 1L3A_D.
Probab=21.62  E-value=37  Score=25.29  Aligned_cols=14  Identities=50%  Similarity=0.973  Sum_probs=9.3

Q ss_pred             cccccccCCccccc
Q 034400           40 PAARKRTYNWSVKA   53 (95)
Q Consensus        40 ps~k~R~YnWs~Ka   53 (95)
                      |+.--|.|+|+.|-
T Consensus        40 pa~g~r~YDW~kKq   53 (139)
T PF08536_consen   40 PAVGPRQYDWSKKQ   53 (139)
T ss_dssp             EBCSTTEB-GGG-E
T ss_pred             cccCCcccccccce
Confidence            56667999999884


No 125
>PRK14873 primosome assembly protein PriA; Provisional
Probab=21.15  E-value=56  Score=29.08  Aligned_cols=23  Identities=30%  Similarity=0.725  Sum_probs=17.4

Q ss_pred             cccccccCCCccccccccccccccCc
Q 034400           15 THTLCVRCGRRSFHLQKSRCAACAYP   40 (95)
Q Consensus        15 tH~lCrRCG~~syH~qKk~Ca~CGyp   40 (95)
                      ....|+.||...   .-..|..||-+
T Consensus       409 ~~l~Ch~CG~~~---~p~~Cp~Cgs~  431 (665)
T PRK14873        409 GTPRCRWCGRAA---PDWRCPRCGSD  431 (665)
T ss_pred             CeeECCCCcCCC---cCccCCCCcCC
Confidence            345699999864   36799999954


No 126
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=21.15  E-value=38  Score=28.10  Aligned_cols=69  Identities=26%  Similarity=0.449  Sum_probs=44.4

Q ss_pred             CcccccccCCCcccccc----ccccccccCc---ccccc--------c---------------------CC-cccccccc
Q 034400           14 KTHTLCVRCGRRSFHLQ----KSRCAACAYP---AARKR--------T---------------------YN-WSVKAIRR   56 (95)
Q Consensus        14 ktH~lCrRCG~~syH~q----Kk~Ca~CGyp---s~k~R--------~---------------------Yn-Ws~Ka~rr   56 (95)
                      -.-+.|.-||.-.||..    ..+|.+|+|-   +++.|        +                     |. |-.++...
T Consensus        26 ~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A~~Ri~~llD~gsf~el~~~l~~~dPL~F~d~k~Y~~rL~~a~~~  105 (294)
T COG0777          26 GLWTKCPSCGEMLYRKELESNLKVCPKCGHHMRISARERLEALLDEGSFEELDSPLEPKDPLKFPDSKKYKDRLEAARKK  105 (294)
T ss_pred             CceeECCCccceeeHHHHHhhhhcccccCcccccCHHHHHHHhhCCCcceecccCCCcCCcccCCcchhhHHHHHHHHhh
Confidence            45689999999999974    5789999992   34433        1                     21 22222111


Q ss_pred             c------cccccccccccccchhcccCcCcCC
Q 034400           57 K------TTGTGRMRYLRHVPRRFKSGFREGT   82 (95)
Q Consensus        57 ~------ttGTGRmr~lk~v~rrfkngFreGt   82 (95)
                      .      -+|.|.+--++.|.-=+.-.|..|+
T Consensus       106 tg~~davvtg~g~i~G~pvv~av~df~FmgGS  137 (294)
T COG0777         106 TGLDDAVVTGEGTINGLPVVLAVMDFAFMGGS  137 (294)
T ss_pred             cCCCcceEEEeeEECCeEEEEEEEeccccccc
Confidence            1      2577777777777777777776665


No 127
>KOG2767 consensus Translation initiation factor 5 (eIF-5) [Translation, ribosomal structure and biogenesis]
Probab=20.82  E-value=43  Score=28.85  Aligned_cols=25  Identities=28%  Similarity=0.797  Sum_probs=19.2

Q ss_pred             ccccccCCCcc--ccccc-----cccccccCc
Q 034400           16 HTLCVRCGRRS--FHLQK-----SRCAACAYP   40 (95)
Q Consensus        16 H~lCrRCG~~s--yH~qK-----k~Ca~CGyp   40 (95)
                      -.||.-|+..-  +++.+     ..|.+|||.
T Consensus        96 FVlC~~C~NPETel~itk~q~i~~~CkACG~r  127 (400)
T KOG2767|consen   96 FVLCPSCENPETELIITKKQTISLKCKACGFR  127 (400)
T ss_pred             heeCcCCCCCceeEEecccchhhhHHHHcCCc
Confidence            36899999874  56665     469999995


No 128
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional
Probab=20.76  E-value=47  Score=28.44  Aligned_cols=12  Identities=42%  Similarity=1.046  Sum_probs=9.6

Q ss_pred             ccccccccccCc
Q 034400           29 LQKSRCAACAYP   40 (95)
Q Consensus        29 ~qKk~Ca~CGyp   40 (95)
                      +.+.-|+.||||
T Consensus        12 LP~~nCg~CG~~   23 (450)
T PRK04165         12 LPKTNCGECGEP   23 (450)
T ss_pred             CCCCCCCCCCCc
Confidence            456679999998


No 129
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=20.50  E-value=49  Score=22.94  Aligned_cols=23  Identities=26%  Similarity=0.645  Sum_probs=16.0

Q ss_pred             cccccCCCccccccc---cccccccC
Q 034400           17 TLCVRCGRRSFHLQK---SRCAACAY   39 (95)
Q Consensus        17 ~lCrRCG~~syH~qK---k~Ca~CGy   39 (95)
                      -.|..||+.++--+-   ..|.+||+
T Consensus        37 y~CpfCgk~~vkR~a~GIW~C~~C~~   62 (90)
T PRK03976         37 HVCPVCGRPKVKRVGTGIWECRKCGA   62 (90)
T ss_pred             ccCCCCCCCceEEEEEEEEEcCCCCC
Confidence            358888877765444   67888886


No 130
>PF14149 YhfH:  YhfH-like protein
Probab=20.32  E-value=34  Score=20.35  Aligned_cols=12  Identities=25%  Similarity=0.811  Sum_probs=10.0

Q ss_pred             cccccccccccC
Q 034400           28 HLQKSRCAACAY   39 (95)
Q Consensus        28 H~qKk~Ca~CGy   39 (95)
                      ++-.|.|+.||-
T Consensus        10 nLp~K~C~~CG~   21 (37)
T PF14149_consen   10 NLPPKKCTECGK   21 (37)
T ss_pred             hCCCcccHHHHH
Confidence            577899999995


No 131
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=20.10  E-value=50  Score=26.17  Aligned_cols=36  Identities=19%  Similarity=0.494  Sum_probs=24.3

Q ss_pred             ccccccCCCccc----cccccccccccCc--------ccccccCCccc
Q 034400           16 HTLCVRCGRRSF----HLQKSRCAACAYP--------AARKRTYNWSV   51 (95)
Q Consensus        16 H~lCrRCG~~sy----H~qKk~Ca~CGyp--------s~k~R~YnWs~   51 (95)
                      ...|+.||...+    -----.|+.||+=        ..-+|.|+=..
T Consensus        11 ~~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~Vl~e~~iD~g~EWR~f~~~~   58 (310)
T PRK00423         11 KLVCPECGSDKLIYDYERGEIVCADCGLVIEENIIDQGPEWRAFDPEQ   58 (310)
T ss_pred             CCcCcCCCCCCeeEECCCCeEeecccCCcccccccccCCCccCCCccc
Confidence            357999997432    3355789999992        45677776433


Done!