BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034462
(94 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q38WK2|ATPD_LACSS ATP synthase subunit delta OS=Lactobacillus sakei subsp. sakei
(strain 23K) GN=atpH PE=3 SV=1
Length = 180
Score = 29.6 bits (65), Expect = 5.8, Method: Compositional matrix adjust.
Identities = 16/60 (26%), Positives = 29/60 (48%)
Query: 32 SIFSSFSSSAGPLPRASRVLSALGSVESLMPLHSAIASARLKSSIAVDSTYWSWLSQDFA 91
++ F S R + + + + E L H IA A++ S++A+D + +SQ FA
Sbjct: 73 TLMQHFLSLVFDYQRMAEMPYIIAAYEDLYDQHKGIAHAKVTSAVALDDDQLAKISQSFA 132
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.314 0.118 0.325
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,819,598
Number of Sequences: 539616
Number of extensions: 540902
Number of successful extensions: 2811
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 2782
Number of HSP's gapped (non-prelim): 37
length of query: 94
length of database: 191,569,459
effective HSP length: 64
effective length of query: 30
effective length of database: 157,034,035
effective search space: 4711021050
effective search space used: 4711021050
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)