BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034476
         (93 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Q9U|A Chain A, Crystal Structure Of The Flavodiiron Protein From Giardia
           Intestinalis
 pdb|2Q9U|B Chain B, Crystal Structure Of The Flavodiiron Protein From Giardia
           Intestinalis
          Length = 414

 Score = 26.6 bits (57), Expect = 4.0,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 38  LKDHIDEFVNASMEEHKTCFSKTIKKMFGMSK 69
           LKDH  +F NA+    K C  + +K ++GM K
Sbjct: 94  LKDHYHKFTNATFVCTKKC-QEHLKILYGMEK 124


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.121    0.323 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,299,055
Number of Sequences: 62578
Number of extensions: 72942
Number of successful extensions: 158
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 157
Number of HSP's gapped (non-prelim): 3
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 45 (21.9 bits)