Query         034476
Match_columns 93
No_of_seqs    37 out of 39
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 03:16:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034476.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034476hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09943 DUF2175:  Uncharacteri  48.3      10 0.00022   26.9   1.2   18   52-69     26-43  (101)
  2 PF12443 AKNA:  AT-hook-contain  41.7      18 0.00039   25.8   1.6   14   34-47     60-73  (106)
  3 PF03735 ENT:  ENT domain;  Int  33.8      74  0.0016   20.9   3.5   27   36-62     31-57  (73)
  4 PF10283 zf-CCHH:  Zinc-finger   29.8      20 0.00044   19.9   0.3   17   21-48      7-23  (26)
  5 KOG1556 26S proteasome regulat  27.6      32 0.00069   28.7   1.1   22   54-75     69-90  (309)
  6 smart00153 VHP Villin headpiec  26.1      36 0.00079   19.7   0.9   11   60-70      6-16  (36)
  7 PF10940 DUF2618:  Protein of u  20.1      60  0.0013   19.9   1.1   25   36-60      3-27  (40)
  8 COG1473 AbgB Metal-dependent a  20.0      71  0.0015   26.5   1.8   26   31-56     10-35  (392)
  9 PF02022 Integrase_Zn:  Integra  19.6 1.3E+02  0.0028   17.7   2.4   21   54-74      8-28  (40)
 10 PF01627 Hpt:  Hpt domain;  Int  19.6 1.9E+02  0.0042   16.8   3.2   38   32-69      4-44  (90)

No 1  
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=48.29  E-value=10  Score=26.86  Aligned_cols=18  Identities=22%  Similarity=0.296  Sum_probs=15.1

Q ss_pred             HHHhHHHHHHHHHhchhh
Q 034476           52 EHKTCFSKTIKKMFGMSK   69 (93)
Q Consensus        52 EHktCfk~ti~kmFG~sK   69 (93)
                      =||+||...+.+.+...+
T Consensus        26 VH~~C~~~~~~~k~~~~~   43 (101)
T PF09943_consen   26 VHYECFREKASKKLYGDV   43 (101)
T ss_pred             EeHHHHHHHHhhhcccCh
Confidence            399999999998887665


No 2  
>PF12443 AKNA:  AT-hook-containing transcription factor;  InterPro: IPR022150  This domain family is found in eukaryotes, and is approximately 110 amino acids in length. This family contains a transcription factor which regulates the expression of the costimulatory molecules on lymphocytes. 
Probab=41.74  E-value=18  Score=25.82  Aligned_cols=14  Identities=43%  Similarity=0.698  Sum_probs=11.4

Q ss_pred             hhHHHHHHHHHHhh
Q 034476           34 FLEDLKDHIDEFVN   47 (93)
Q Consensus        34 F~e~lKDh~~eFi~   47 (93)
                      =++.||||++||-.
T Consensus        60 qteeLK~kvqe~sk   73 (106)
T PF12443_consen   60 QTEELKDKVQEFSK   73 (106)
T ss_pred             HHHHHHHHHHHHhc
Confidence            36899999999953


No 3  
>PF03735 ENT:  ENT domain;  InterPro: IPR005491 This entry represents a protein regulator which is able to repress transcription, possibly via its interaction with a multi protein chromatin re-modeling complex that modifies the chromatin. Its interaction with BRCA2 suggests that it may play a central role in the DNA repair function of BRCA2 []. ; PDB: 1UZ3_B 1UTU_B 2FMM_E.
Probab=33.84  E-value=74  Score=20.94  Aligned_cols=27  Identities=26%  Similarity=0.388  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHhhcChHHHHhHHHHHHH
Q 034476           36 EDLKDHIDEFVNASMEEHKTCFSKTIK   62 (93)
Q Consensus        36 e~lKDh~~eFi~As~dEHktCfk~ti~   62 (93)
                      +.|-.+.+...++|-++|..++.+-..
T Consensus        31 e~lLt~Lr~~L~IS~e~H~~~l~~~~~   57 (73)
T PF03735_consen   31 EKLLTELRKELNISDEEHREELRRAVS   57 (73)
T ss_dssp             HHHHHHHHHHTT--HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCcHHHHHHHHHHhc
Confidence            445556667789999999999987654


No 4  
>PF10283 zf-CCHH:  Zinc-finger (CX5CX6HX5H) motif;  InterPro: IPR019406 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets [].  This entry represents a C2H2-type Znf motif that in humans is part of the APLF (aprataxin- and PNK-like) forkead association domain-containing protein []. The Znf is highly conserved both in primary sequence and in the spacing between the putative zinc coordinating residues, and is configured CX5CX6HX5H. Many of the proteins containing this Znf are involved in DNA strand break repair and/or contain domains implicated in DNA metabolism. This Znf motif appears to be specialised for the non-covalent binding of poly ADP-ribose; Aprataxin also appears to covalently bind poly ADP-ribose, but not through its Znf motif [].; PDB: 2KQC_A 2KUO_A 2KQE_A 2KQD_A 2KQB_A.
Probab=29.84  E-value=20  Score=19.89  Aligned_cols=17  Identities=29%  Similarity=0.522  Sum_probs=9.4

Q ss_pred             cchhhhccCCCchhhHHHHHHHHHHhhc
Q 034476           21 MTSCRKKKKDDATFLEDLKDHIDEFVNA   48 (93)
Q Consensus        21 ~sscRk~~~e~atF~e~lKDh~~eFi~A   48 (93)
                      .+|+||+.           +||.||-|-
T Consensus         7 ~~CYRkNp-----------~H~~~f~Hp   23 (26)
T PF10283_consen    7 AKCYRKNP-----------QHFKEFSHP   23 (26)
T ss_dssp             GG-S--SC-----------CHHHHCEST
T ss_pred             hhhhcCCH-----------HHHhhcCCC
Confidence            46777754           488888774


No 5  
>KOG1556 consensus 26S proteasome regulatory complex, subunit RPN8/PSMD7 [Posttranslational modification, protein turnover, chaperones]
Probab=27.55  E-value=32  Score=28.68  Aligned_cols=22  Identities=32%  Similarity=0.303  Sum_probs=16.6

Q ss_pred             HhHHHHHHHHHhchhhHhhhhh
Q 034476           54 KTCFSKTIKKMFGMSKVVAERN   75 (93)
Q Consensus        54 ktCfk~ti~kmFG~sK~vae~~   75 (93)
                      |---.++|.+||||.|.|..+.
T Consensus        69 WFlDh~Y~esM~~mfkKvNake   90 (309)
T KOG1556|consen   69 WFLDHNYIESMFGMFKKVNAKE   90 (309)
T ss_pred             EEeccHHHHHHHHHHHHhcchh
Confidence            3334589999999999887653


No 6  
>smart00153 VHP Villin headpiece domain.
Probab=26.14  E-value=36  Score=19.71  Aligned_cols=11  Identities=27%  Similarity=0.764  Sum_probs=8.6

Q ss_pred             HHHHHhchhhH
Q 034476           60 TIKKMFGMSKV   70 (93)
Q Consensus        60 ti~kmFG~sK~   70 (93)
                      -++++|||++.
T Consensus         6 eF~~vfgmsr~   16 (36)
T smart00153        6 DFEEVFGMTRE   16 (36)
T ss_pred             HHHHHHCCCHH
Confidence            36789999875


No 7  
>PF10940 DUF2618:  Protein of unknown function (DUF2618);  InterPro: IPR021237  This bacterial family of proteins has no known function. The sequences within the family are highly conserved. 
Probab=20.11  E-value=60  Score=19.91  Aligned_cols=25  Identities=28%  Similarity=0.527  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHhhcChHHHHhHHHHH
Q 034476           36 EDLKDHIDEFVNASMEEHKTCFSKT   60 (93)
Q Consensus        36 e~lKDh~~eFi~As~dEHktCfk~t   60 (93)
                      ..|.-||+.=-|+=|--|+.||.-.
T Consensus         3 ~~lMaHIRRtrHiMmpshR~~Fd~~   27 (40)
T PF10940_consen    3 RSLMAHIRRTRHIMMPSHRSCFDFS   27 (40)
T ss_pred             chHHHHHHhhhhhhchhhhcccchh
Confidence            3578899999999999999999754


No 8  
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only]
Probab=19.99  E-value=71  Score=26.48  Aligned_cols=26  Identities=19%  Similarity=0.195  Sum_probs=23.1

Q ss_pred             CchhhHHHHHHHHHHhhcChHHHHhH
Q 034476           31 DATFLEDLKDHIDEFVNASMEEHKTC   56 (93)
Q Consensus        31 ~atF~e~lKDh~~eFi~As~dEHktC   56 (93)
                      ....+.+++.|||+|=+.+-+|.||+
T Consensus        10 ~~~~l~~~rr~lH~~PEL~f~E~~Ta   35 (392)
T COG1473          10 LKDELIEWRRDLHEHPELGFEEYRTA   35 (392)
T ss_pred             hhHHHHHHHHHHhhCCccchhHHHHH
Confidence            34567899999999999999999997


No 9  
>PF02022 Integrase_Zn:  Integrase Zinc binding domain The structure of the N-terminal zinc binding domain.;  InterPro: IPR003308 Retroviral integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains: an N-terminal zinc binding domain, a central catalytic core and a C-terminal DNA-binding domain [, ]. Often found as part of the POL polyprotein.; GO: 0008270 zinc ion binding; PDB: 1E0E_A 3F9K_F 1E27_C 1K6Y_B 1WJD_A 1WJB_A 1WJF_A 1WJE_B 3HPG_B 3HPH_C ....
Probab=19.63  E-value=1.3e+02  Score=17.68  Aligned_cols=21  Identities=24%  Similarity=0.536  Sum_probs=14.3

Q ss_pred             HhHHHHHHHHHhchhhHhhhh
Q 034476           54 KTCFSKTIKKMFGMSKVVAER   74 (93)
Q Consensus        54 ktCfk~ti~kmFG~sK~vae~   74 (93)
                      +.+--+.+...||.++.||+.
T Consensus         8 ~H~n~~~L~~~f~ip~~vAk~   28 (40)
T PF02022_consen    8 YHSNAKALRHKFGIPRLVAKQ   28 (40)
T ss_dssp             HHH-HHHHHHHHT--HHHHHH
T ss_pred             HccCHHHHHHHHccCHHHHHH
Confidence            345567888999999999975


No 10 
>PF01627 Hpt:  Hpt domain;  InterPro: IPR008207 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. Signal transducing histidine kinases are the key elements in two-component signal transduction systems, which control complex processes such as the initiation of development in microorganisms [, ]. Examples of histidine kinases are EnvZ, which plays a central role in osmoregulation [], and CheA, which plays a central role in the chemotaxis system []. Histidine kinases usually have an N-terminal ligand-binding domain and a C-terminal kinase domain, but other domains may also be present. The kinase domain is responsible for the autophosphorylation of the histidine with ATP, the phosphotransfer from the kinase to an aspartate of the response regulator, and (with bifunctional enzymes) the phosphotransfer from aspartyl phosphate back to ADP or to water []. The kinase core has a unique fold, distinct from that of the Ser/Thr/Tyr kinase superfamily.  HKs can be roughly divided into two classes: orthodox and hybrid kinases [, ]. Most orthodox HKs, typified by the Escherichia coli EnvZ protein, function as periplasmic membrane receptors and have a signal peptide and transmembrane segment(s) that separate the protein into a periplasmic N-terminal sensing domain and a highly conserved cytoplasmic C-terminal kinase core. Members of this family, however, have an integral membrane sensor domain. Not all orthodox kinases are membrane bound, e.g., the nitrogen regulatory kinase NtrB (GlnL) is a soluble cytoplasmic HK []. Hybrid kinases contain multiple phosphodonor and phosphoacceptor sites and use multi-step phospho-relay schemes instead of promoting a single phosphoryl transfer. In addition to the sensor domain and kinase core, they contain a CheY-like receiver domain and a His-containing phosphotransfer (HPt) domain. This entry represents a domain present at the N terminus in proteins which undergo autophosphorylation. The group includes, the gliding motility regulatory protein from Myxococcus xanthus and a number of bacterial chemotaxis proteins.; GO: 0004871 signal transducer activity, 0000160 two-component signal transduction system (phosphorelay); PDB: 3KYJ_A 3KYI_A 3IQT_A 1Y6D_A 2LD6_A 1TQG_A 2R25_A 1OXB_A 1QSP_B 1C03_B ....
Probab=19.56  E-value=1.9e+02  Score=16.78  Aligned_cols=38  Identities=16%  Similarity=0.296  Sum_probs=24.6

Q ss_pred             chhhHHHHHHHHHHhhcC---hHHHHhHHHHHHHHHhchhh
Q 034476           32 ATFLEDLKDHIDEFVNAS---MEEHKTCFSKTIKKMFGMSK   69 (93)
Q Consensus        32 atF~e~lKDh~~eFi~As---~dEHktCfk~ti~kmFG~sK   69 (93)
                      ..|++++.+++++...+-   ..+=+.=+...+.++=|.+.
T Consensus         4 ~~f~~~~~~~~~~l~~~~~~~~~~d~~~l~~~~H~lkG~a~   44 (90)
T PF01627_consen    4 DIFLEEAPEDLEQLEQALQALEQEDWEELRRLAHRLKGSAG   44 (90)
T ss_dssp             HHHHHHHHHHHHHHHHHHCSSHHCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhHhhHHHHHHHHHHHhhhHH
Confidence            368888888888887776   44444455555555544433


Done!