Query         034483
Match_columns 93
No_of_seqs    130 out of 714
Neff          6.1 
Searched_HMMs 46136
Date          Fri Mar 29 03:20:58 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034483.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034483hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00768 X8 Possibly involve 100.0 7.7E-38 1.7E-42  200.0   8.5   84    7-90      1-85  (85)
  2 PF07983 X8:  X8 domain;  Inter 100.0 3.3E-29 7.2E-34  158.1   6.8   71    7-77      1-78  (78)
  3 PF09628 YvfG:  YvfG protein;    35.4      25 0.00053   21.4   1.3    9   54-62     27-35  (68)
  4 KOG3679 Predicted coiled-coil   23.1      51  0.0011   27.3   1.5   26   52-77    531-556 (802)
  5 COG0066 LeuD 3-isopropylmalate  18.3      90  0.0019   22.8   1.8   17   43-59     72-88  (191)
  6 PF04255 DUF433:  Protein of un  15.6 1.5E+02  0.0032   16.8   2.0   15   13-27     42-56  (56)
  7 PF01589 Alpha_E1_glycop:  Alph  11.6 1.4E+02   0.003   24.9   1.4   22   71-92    375-396 (502)
  8 KOG0044 Ca2+ sensor (EF-Hand s  10.6      87  0.0019   22.7  -0.0   15   45-59     95-109 (193)
  9 PF15606 Toxin_55:  Putative to  10.5   2E+02  0.0043   18.1   1.6   24   49-72     21-44  (77)
 10 COG3779 Uncharacterized protei   9.8 1.3E+02  0.0029   21.0   0.7   28    2-40     98-125 (151)

No 1  
>smart00768 X8 Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
Probab=100.00  E-value=7.7e-38  Score=200.04  Aligned_cols=84  Identities=48%  Similarity=0.935  Sum_probs=82.3

Q ss_pred             cceEeCCCCCHHHHHHHHHhhcCc-cccccccCCCCCCCCCChhhhHhHHHHHHHHHhCCCCCCCCCCCceEEEecCCCC
Q 034483            7 TWCVAKPSSDQAALLANINYACSQ-IDCRILQKGYPCFYPDNLMNHASISMNLYYQAKGRNRWNCDFRNSALIVTTDPSY   85 (93)
Q Consensus         7 ~wCV~~~~~~~~~l~~~l~~aCg~-~dC~~I~~~g~c~~~~t~~~~aSya~N~Yyq~~~~~~~aCdF~G~A~i~~~dps~   85 (93)
                      +|||+|+++++++|+++|+|||++ +||++|++||+||+|+++++|||||||+|||++++.+++|||+|+|+|++.||+.
T Consensus         1 ~wCv~~~~~~~~~l~~~~~yaCg~~~dC~~I~~~g~c~~~~~~~~~aS~a~N~YYq~~~~~~~aC~F~G~a~~~~~~ps~   80 (85)
T smart00768        1 LWCVAKPDADEAALQAALDYACGQGADCTAIQPGGSCYSPNTVKAHASYAFNSYYQKQGQSSGACDFGGTATITTTDPST   80 (85)
T ss_pred             CccccCCCCCHHHHHHHHHHHhcCCCCccccCCCCcccCCCCHHHHHHHHHHHHHHHcCCCCCcCCCCCceEEEecCCCC
Confidence            599999999999999999999999 8999999999999999999999999999999999999999999999999999999


Q ss_pred             Ceeee
Q 034483           86 SKCVY   90 (93)
Q Consensus        86 ~~C~~   90 (93)
                      ++|+|
T Consensus        81 ~~C~~   85 (85)
T smart00768       81 GSCKF   85 (85)
T ss_pred             CccCC
Confidence            99986


No 2  
>PF07983 X8:  X8 domain;  InterPro: IPR012946 The X8 domain [] contains 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen [] as well as at the C terminus of family 17 glycosyl hydrolases []. This domain may be involved in carbohydrate binding.; PDB: 2JON_A 2W61_A 2W62_A 2W63_A.
Probab=99.96  E-value=3.3e-29  Score=158.12  Aligned_cols=71  Identities=39%  Similarity=0.740  Sum_probs=60.8

Q ss_pred             cceEeCCCCCHHHHHHHHHhhcCc--cccccccCCCC-----CCCCCChhhhHhHHHHHHHHHhCCCCCCCCCCCceE
Q 034483            7 TWCVAKPSSDQAALLANINYACSQ--IDCRILQKGYP-----CFYPDNLMNHASISMNLYYQAKGRNRWNCDFRNSAL   77 (93)
Q Consensus         7 ~wCV~~~~~~~~~l~~~l~~aCg~--~dC~~I~~~g~-----c~~~~t~~~~aSya~N~Yyq~~~~~~~aCdF~G~A~   77 (93)
                      +|||+++++++++|+++|+|||++  +||++|++||+     .|++|++++|||||||+|||++++.+++|||+|+||
T Consensus         1 l~Cv~~~~~~~~~l~~~l~~aC~~~~~dC~~I~~~g~~G~YG~~S~C~~~~~lSya~N~YY~~~~~~~~~C~F~G~at   78 (78)
T PF07983_consen    1 LWCVAKPDADDKELQDLLDYACGQGGVDCSPIQPNGTTGVYGAYSMCSPRQHLSYAFNQYYQKQGRNSSACDFSGNAT   78 (78)
T ss_dssp             -EEEE-TTS-HHHHHHHHHHHTTT-SSSCCCC-EETTTTEE-TTTTS-CCHHHHHHHHHHHHHHTSSCCG-SS-STEE
T ss_pred             CcceeCCCCCHHHHHHHHHHHHcCCCCChhhhCCCCcccccccccCCCHHHHHHHHHHHHHHHcCCCCCcCCCCCCCC
Confidence            699999999999999999999999  89999999998     466666799999999999999999999999999996


No 3  
>PF09628 YvfG:  YvfG protein;  InterPro: IPR018590  Yvfg is a hypothetical protein of 71 residues expressed in some bacteria. The monomer consists of two parallel alpha helices, and the protein crystallises as a homo-dimer. ; PDB: 2GSV_A 2JS1_B.
Probab=35.40  E-value=25  Score=21.42  Aligned_cols=9  Identities=44%  Similarity=0.888  Sum_probs=7.6

Q ss_pred             HHHHHHHHH
Q 034483           54 ISMNLYYQA   62 (93)
Q Consensus        54 ya~N~Yyq~   62 (93)
                      -|||+||..
T Consensus        27 ~AmNaYYr~   35 (68)
T PF09628_consen   27 HAMNAYYRS   35 (68)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            589999975


No 4  
>KOG3679 consensus Predicted coiled-coil protein [General function prediction only]
Probab=23.15  E-value=51  Score=27.34  Aligned_cols=26  Identities=19%  Similarity=0.548  Sum_probs=21.6

Q ss_pred             HhHHHHHHHHHhCCCCCCCCCCCceE
Q 034483           52 ASISMNLYYQAKGRNRWNCDFRNSAL   77 (93)
Q Consensus        52 aSya~N~Yyq~~~~~~~aCdF~G~A~   77 (93)
                      +-.-+..||++++-..-+|.|+|.--
T Consensus       531 lilrlqeyfekqgvkdfacsfsgsip  556 (802)
T KOG3679|consen  531 LILRLQEYFEKQGVKDFACSFSGSIP  556 (802)
T ss_pred             HHHHHHHHHHHcCcceeeeeccCCcc
Confidence            44556789999999999999999753


No 5  
>COG0066 LeuD 3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism]
Probab=18.34  E-value=90  Score=22.84  Aligned_cols=17  Identities=24%  Similarity=0.266  Sum_probs=13.4

Q ss_pred             CCCCChhhhHhHHHHHH
Q 034483           43 FYPDNLMNHASISMNLY   59 (93)
Q Consensus        43 ~~~~t~~~~aSya~N~Y   59 (93)
                      |.-.+.++||.||+..|
T Consensus        72 FGcGSSREHApwALk~~   88 (191)
T COG0066          72 FGCGSSREHAPWALKDY   88 (191)
T ss_pred             CCCCccHHHHHHHHHHc
Confidence            44445699999999876


No 6  
>PF04255 DUF433:  Protein of unknown function (DUF433);  InterPro: IPR007367 This is a family of uncharacterised proteins.; PDB: 2GA1_B.
Probab=15.61  E-value=1.5e+02  Score=16.80  Aligned_cols=15  Identities=33%  Similarity=0.472  Sum_probs=9.0

Q ss_pred             CCCCHHHHHHHHHhh
Q 034483           13 PSSDQAALLANINYA   27 (93)
Q Consensus        13 ~~~~~~~l~~~l~~a   27 (93)
                      |.++.+++.++|.|+
T Consensus        42 p~Lt~~~i~aAl~ya   56 (56)
T PF04255_consen   42 PSLTLEDIRAALAYA   56 (56)
T ss_dssp             TT--HHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHhC
Confidence            346677777777774


No 7  
>PF01589 Alpha_E1_glycop:  Alphavirus E1 glycoprotein;  InterPro: IPR002548 Alphaviruses are enveloped RNA viruses that use arthropods such as mosquitoes for transmission to their vertebrate hosts, and include Semliki Forest and Sindbis viruses []. Alphaviruses consist of three structural proteins: the core nucleocapsid protein C, and the envelope proteins P62 and E1 that associate as a heterodimer. The viral membrane-anchored surface glycoproteins are responsible for receptor recognition and entry into target cells through membrane fusion. The proteolytic maturation of P62 into E2 (IPR000936 from INTERPRO) and E3 (IPR002533 from INTERPRO) causes a change in the viral surface. Together the E1, E2, and sometimes E3, glycoprotein "spikes" form an E1/E2 dimer or an E1/E2/E3 trimer, where E2 extends from the centre to the vertices, E1 fills the space between the vertices, and E3, if present, is at the distal end of the spike []. Upon exposure of the virus to the acidity of the endosome, E1 dissociates from E2 to form an E1 homotrimer, which is necessary for the fusion step to drive the cellular and viral membranes together. The alphaviral glycoprotein E1 is a class II viral fusion protein, which is structurally different from the class I fusion proteins found in influenza virus and HIV. The structure of the Semliki Forest virus revealed a structure that is similar to that of flaviviral glycoprotein E, with three structural domains in the same primary sequence arrangement []. This entry represents all three domains of the alphaviral E1 glycoprotein.; GO: 0004252 serine-type endopeptidase activity, 0019028 viral capsid, 0055036 virion membrane; PDB: 2YEW_L 1LD4_P 1Z8Y_K 3MUU_B 3N44_F 2XFB_F 3N42_F 2XFC_H 3N40_F 3N41_F ....
Probab=11.59  E-value=1.4e+02  Score=24.90  Aligned_cols=22  Identities=27%  Similarity=0.339  Sum_probs=16.3

Q ss_pred             CCCCceEEEecCCCCCeeeeec
Q 034483           71 DFRNSALIVTTDPSYSKCVYSY   92 (93)
Q Consensus        71 dF~G~A~i~~~dps~~~C~~~~   92 (93)
                      ||+|.|+|+-..--.|.|..++
T Consensus       375 DfGGvati~Y~~~k~GkCaVHs  396 (502)
T PF01589_consen  375 DFGGVATITYKADKAGKCAVHS  396 (502)
T ss_dssp             SSEEEEEEEEEESS-EEEEEEE
T ss_pred             CCCceEEEEEecCCCccCceec
Confidence            8999999986555558887664


No 8  
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=10.57  E-value=87  Score=22.68  Aligned_cols=15  Identities=20%  Similarity=0.337  Sum_probs=12.9

Q ss_pred             CCChhhhHhHHHHHH
Q 034483           45 PDNLMNHASISMNLY   59 (93)
Q Consensus        45 ~~t~~~~aSya~N~Y   59 (93)
                      ..++.+++.|+|..|
T Consensus        95 rGt~eekl~w~F~ly  109 (193)
T KOG0044|consen   95 RGTLEEKLKWAFRLY  109 (193)
T ss_pred             CCcHHHHhhhhheee
Confidence            347899999999998


No 9  
>PF15606 Toxin_55:  Putative toxin 55
Probab=10.54  E-value=2e+02  Score=18.07  Aligned_cols=24  Identities=17%  Similarity=0.303  Sum_probs=20.2

Q ss_pred             hhhHhHHHHHHHHHhCCCCCCCCC
Q 034483           49 MNHASISMNLYYQAKGRNRWNCDF   72 (93)
Q Consensus        49 ~~~aSya~N~Yyq~~~~~~~aCdF   72 (93)
                      .+...=.+|.|++.-++.+.-|+.
T Consensus        21 ~~~v~~~~~~~~~~~GK~~drCd~   44 (77)
T PF15606_consen   21 VQQVYEIISDAFQSGGKAPDRCDV   44 (77)
T ss_pred             HHHHHHHHHHHHhhcCCCCcHHHH
Confidence            566777899999999999999974


No 10 
>COG3779 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=9.79  E-value=1.3e+02  Score=21.02  Aligned_cols=28  Identities=21%  Similarity=0.303  Sum_probs=19.2

Q ss_pred             CCCCccceEeCCCCCHHHHHHHHHhhcCccccccccCCC
Q 034483            2 VNGQKTWCVAKPSSDQAALLANINYACSQIDCRILQKGY   40 (93)
Q Consensus         2 ~~~~~~wCV~~~~~~~~~l~~~l~~aCg~~dC~~I~~~g   40 (93)
                      |.-++.|||.++++++=.      |     .|.+|..||
T Consensus        98 Ve~Gqsv~v~~dDISDWm------y-----~~gg~~yGg  125 (151)
T COG3779          98 VEQGQSVCVPVDDISDWM------Y-----VCGGIPYGG  125 (151)
T ss_pred             eecCcEEEEehhhhhhhh------e-----eeCCEeecC
Confidence            345788999998886543      2     456666666


Done!