Query         034489
Match_columns 93
No_of_seqs    104 out of 178
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 03:24:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034489.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034489hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09809 MRP-L27:  Mitochondria 100.0 3.2E-34   7E-39  199.7   3.5   73   19-91      4-76  (113)
  2 KOG4756 Mitochondrial ribosoma  99.9 7.8E-24 1.7E-28  152.1   2.9   83    4-86     12-105 (146)
  3 PF11201 DUF2982:  Protein of u  32.2      44 0.00096   24.5   2.4   27   40-66      7-33  (152)
  4 PF06007 PhnJ:  Phosphonate met  27.8      62  0.0013   26.0   2.7   45   47-91    174-233 (277)
  5 PF15172 Prolactin_RP:  Prolact  21.8      39 0.00085   20.5   0.5   20   28-47     14-33  (47)
  6 PF15199 DAOA:  D-amino acid ox  17.9      44 0.00096   22.0   0.1   12   70-81      9-20  (82)
  7 PF05223 MecA_N:  NTF2-like N-t  15.4      78  0.0017   20.9   0.9   19   48-68     98-116 (118)
  8 COG3363 Archaeal IMP cyclohydr  14.5      73  0.0016   24.4   0.6   24   59-82     39-63  (200)
  9 PF12426 DUF3674:  RNA dependen  14.3 1.4E+02  0.0031   17.6   1.7   21   50-70     17-37  (41)
 10 PF08394 Arc_trans_TRASH:  Arch  13.1      64  0.0014   18.4  -0.0   13   22-34     11-23  (37)

No 1  
>PF09809 MRP-L27:  Mitochondrial ribosomal protein L27;  InterPro: IPR019189 Proteins in this entry are components of the mitochondrial ribosome large subunit. They are also involved in apoptosis and cell cycle regulation. 
Probab=100.00  E-value=3.2e-34  Score=199.67  Aligned_cols=73  Identities=51%  Similarity=0.792  Sum_probs=69.1

Q ss_pred             CCCCcccccccCCccccCccCCCCceEeeeccEEEccCCCCeeeCCCCCCcccccccccCCCCcccccccCCC
Q 034489           19 SSLDILSSKRAPRDYYKGKNCKSTGFHTRKGGYVVVQEKLPNYVVPDLTDFKLKSYVSQCPREVKTAEAAEPG   91 (93)
Q Consensus        19 ~~~~~ltsK~gnk~~yKG~g~~~~G~~t~~G~f~i~~~kvp~fVVPdL~~f~LKPyVS~~~~~v~q~e~t~~~   91 (93)
                      .+..|||||||||+||||+|++++|+|+++|+|+|+|+|||+||||||++|+||||||++++++.|+|+||+.
T Consensus         4 ~rr~~LttK~g~k~fyKG~g~~~~G~~t~~g~yvi~~~kvp~~VVPdL~~f~LKPyVS~~~p~~~~~~~Ta~~   76 (113)
T PF09809_consen    4 FRRFPLTTKRGNKGFYKGTGARGTGRHTKKGGYVIVPEKVPEFVVPDLTDFKLKPYVSYRTPEVKQEEFTAKD   76 (113)
T ss_pred             ccccccccccCCccccCCcCCCCCcEEccCccEEECHHHCceeeCCCCCCCccccccccCccccccccccHHH
Confidence            3445799999999999999999999999999999999999999999999999999999999999999999863


No 2  
>KOG4756 consensus Mitochondrial ribosomal protein L27 [Translation, ribosomal structure and biogenesis]
Probab=99.88  E-value=7.8e-24  Score=152.05  Aligned_cols=83  Identities=53%  Similarity=0.789  Sum_probs=68.5

Q ss_pred             hHHHHHHHhhhhhc----cCCCC-------cccccccCCccccCccCCCCceEeeeccEEEccCCCCeeeCCCCCCcccc
Q 034489            4 GLILGIGRAFRRKR----TSSLD-------ILSSKRAPRDYYKGKNCKSTGFHTRKGGYVVVQEKLPNYVVPDLTDFKLK   72 (93)
Q Consensus         4 g~~~~~~rg~~r~~----a~~~~-------~ltsK~gnk~~yKG~g~~~~G~~t~~G~f~i~~~kvp~fVVPdL~~f~LK   72 (93)
                      |.|.++.|-++|.|    |++++       |+++|++||+.|||+|++++|+||+.|.|+|+|+|+||||||||++|+||
T Consensus        12 ~slna~~rp~~r~r~~~~a~glsK~g~kr~Pr~~k~~~k~l~kgtgakgiGfht~kggyvV~~ekv~eyVvPdl~gFkLk   91 (146)
T KOG4756|consen   12 GSLNAIGRPFRRKRVKKGASGLSKLGPKRAPRDFKLNPKELHKGTGAKGIGFHTRKGGYVVQPEKVPEYVVPDLTGFKLK   91 (146)
T ss_pred             hhhhhccCccccccccccccchhhhccccCchhhhcCchhhcccccccccceeeccccEEeCHhhccceeccCccCceec
Confidence            56788888888876    66665       55555666666799999999999999999999999999999999999999


Q ss_pred             cccccCCCCccccc
Q 034489           73 SYVSQCPREVKTAE   86 (93)
Q Consensus        73 PyVS~~~~~v~q~e   86 (93)
                      ||||-+.|....+.
T Consensus        92 PYVs~q~p~~~~q~  105 (146)
T KOG4756|consen   92 PYVSVQCPLRRVQV  105 (146)
T ss_pred             cceeccCchhHhhh
Confidence            99996665544433


No 3  
>PF11201 DUF2982:  Protein of unknown function (DUF2982);  InterPro: IPR021367  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=32.20  E-value=44  Score=24.51  Aligned_cols=27  Identities=22%  Similarity=0.628  Sum_probs=23.1

Q ss_pred             CCCceEeeeccEEEccCCCCeeeCCCC
Q 034489           40 KSTGFHTRKGGYVVVQEKLPNYVVPDL   66 (93)
Q Consensus        40 ~~~G~~t~~G~f~i~~~kvp~fVVPdL   66 (93)
                      ..+=||.++|.++|+|+-|..+-+|..
T Consensus         7 ~~l~y~hr~G~w~i~W~Ni~ri~ip~v   33 (152)
T PF11201_consen    7 EGLQYHHRRGGWVIPWQNIQRIDIPRV   33 (152)
T ss_pred             cceEEEecCccEEeecccceeeCCCcc
Confidence            345688899999999999999999953


No 4  
>PF06007 PhnJ:  Phosphonate metabolism protein PhnJ;  InterPro: IPR010306 This family consists of several bacterial phosphonate metabolism (PhnJ) sequences. The exact role that PhnJ plays in phosphonate utilisation is unknown.; GO: 0042916 alkylphosphonate transport
Probab=27.78  E-value=62  Score=26.04  Aligned_cols=45  Identities=16%  Similarity=0.227  Sum_probs=33.5

Q ss_pred             eeccEEEccCCCCeeeCCCCCCcc---------------cccccccCCCCcccccccCCC
Q 034489           47 RKGGYVVVQEKLPNYVVPDLTDFK---------------LKSYVSQCPREVKTAEAAEPG   91 (93)
Q Consensus        47 ~~G~f~i~~~kvp~fVVPdL~~f~---------------LKPyVS~~~~~v~q~e~t~~~   91 (93)
                      ..|+|+++++=||-|-+|.|....               +-||-.-.+-.+.-.+|..+.
T Consensus       174 V~grYvm~PSPIPrfDnPKl~~~~aL~LfGAGREkrIYAvPPyT~V~sL~FeD~pF~~e~  233 (277)
T PF06007_consen  174 VNGRYVMDPSPIPRFDNPKLHMSPALQLFGAGREKRIYAVPPYTDVESLDFEDHPFEVER  233 (277)
T ss_pred             ECCeEeeCCCCCCCCCCccccCChhhhhhcCCcceeeeecCCCccccccCccCCCCcccc
Confidence            478999999999999999875432               557766666666666666543


No 5  
>PF15172 Prolactin_RP:  Prolactin-releasing peptide
Probab=21.79  E-value=39  Score=20.48  Aligned_cols=20  Identities=20%  Similarity=0.431  Sum_probs=15.9

Q ss_pred             ccCCccccCccCCCCceEee
Q 034489           28 RAPRDYYKGKNCKSTGFHTR   47 (93)
Q Consensus        28 ~gnk~~yKG~g~~~~G~~t~   47 (93)
                      .-|--.|.|.|..++|++-+
T Consensus        14 dIdP~WY~gRgiRPvGRFGr   33 (47)
T PF15172_consen   14 DIDPAWYVGRGIRPVGRFGR   33 (47)
T ss_pred             CCCchheecccccccccccc
Confidence            34455899999999999864


No 6  
>PF15199 DAOA:  D-amino acid oxidase activator
Probab=17.91  E-value=44  Score=21.98  Aligned_cols=12  Identities=33%  Similarity=0.467  Sum_probs=9.5

Q ss_pred             ccccccccCCCC
Q 034489           70 KLKSYVSQCPRE   81 (93)
Q Consensus        70 ~LKPyVS~~~~~   81 (93)
                      +|.|||||-+..
T Consensus         9 slcpwvsylpqp   20 (82)
T PF15199_consen    9 SLCPWVSYLPQP   20 (82)
T ss_pred             hhcchhhhCCch
Confidence            689999996643


No 7  
>PF05223 MecA_N:  NTF2-like N-terminal transpeptidase domain;  InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide. Methicillin resistance in MRSA strains is due to the acquisition of the mecA gene via horizontal transfer from an unidentified species which encodes penicillin-binding protein 2a (PBP2a).  The structure of the N-terminal domain from MecA is known [] Q53707 from SWISSPROT and is found to be similar to that found in NTF2 IPR002075 from INTERPRO. The length of the PBP2A N-terminal domain (which positions the transpeptidase active site more than 100A from the expected C terminus of the transmembrane anchor) suggests a possible structural role and potentially gives the transpeptidase domain substantial reach from the cell membrane. This domain seems unlikely to have an enzymatic function.; GO: 0046677 response to antibiotic; PDB: 1MWS_B 1MWT_B 1MWR_A 1MWU_A 1VQQ_A.
Probab=15.37  E-value=78  Score=20.94  Aligned_cols=19  Identities=26%  Similarity=0.559  Sum_probs=11.3

Q ss_pred             eccEEEccCCCCeeeCCCCCC
Q 034489           48 KGGYVVVQEKLPNYVVPDLTD   68 (93)
Q Consensus        48 ~G~f~i~~~kvp~fVVPdL~~   68 (93)
                      .+.+.|+|+  |.+|.|+|.+
T Consensus        98 ~~~W~V~W~--ps~I~P~L~~  116 (118)
T PF05223_consen   98 DDDWKVDWD--PSLIFPGLKD  116 (118)
T ss_dssp             TTCEEE-----GGGTSTT--T
T ss_pred             CCcEEEEeC--ccCCCCCCCC
Confidence            557889997  8899998864


No 8  
>COG3363 Archaeal IMP cyclohydrolase [Nucleotide transport and metabolism]
Probab=14.45  E-value=73  Score=24.42  Aligned_cols=24  Identities=21%  Similarity=0.301  Sum_probs=17.1

Q ss_pred             CeeeCCC-CCCcccccccccCCCCc
Q 034489           59 PNYVVPD-LTDFKLKSYVSQCPREV   82 (93)
Q Consensus        59 p~fVVPd-L~~f~LKPyVS~~~~~v   82 (93)
                      .-+|||. ...-.--|||+|+-..+
T Consensus        39 ~vaVVP~d~~e~~~NPYvtYnCiri   63 (200)
T COG3363          39 AVAVVPEDPSEITENPYVTYNCIRI   63 (200)
T ss_pred             ceEEeccCccccccCCcEEEEEEEE
Confidence            3789994 66555699999964443


No 9  
>PF12426 DUF3674:  RNA dependent RNA polymerase;  InterPro: IPR024378 This domain is found in the RNA-directed RNA polymerase. It is located towards the N terminus and is approximately 40 amino acids in length. There is a conserved MFNLKF sequence motif. There are two completely conserved residues (E and P) that may be functionally important.
Probab=14.28  E-value=1.4e+02  Score=17.56  Aligned_cols=21  Identities=19%  Similarity=0.374  Sum_probs=16.5

Q ss_pred             cEEEccCCCCeeeCCCCCCcc
Q 034489           50 GYVVVQEKLPNYVVPDLTDFK   70 (93)
Q Consensus        50 ~f~i~~~kvp~fVVPdL~~f~   70 (93)
                      +|.|--.+.+.|.+||-.+..
T Consensus        17 KFhi~~~k~~~y~IP~Y~~~~   37 (41)
T PF12426_consen   17 KFHIGGPKTQPYYIPDYRGIP   37 (41)
T ss_pred             eeeeCCcccccccCCCCCCcc
Confidence            678888899999999865443


No 10 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=13.14  E-value=64  Score=18.43  Aligned_cols=13  Identities=23%  Similarity=0.429  Sum_probs=11.0

Q ss_pred             CcccccccCCccc
Q 034489           22 DILSSKRAPRDYY   34 (93)
Q Consensus        22 ~~ltsK~gnk~~y   34 (93)
                      .|.+-|.+|+.||
T Consensus        11 eP~~~k~~~~~y~   23 (37)
T PF08394_consen   11 EPIVVKIGNKVYY   23 (37)
T ss_pred             CEEEEEECCeEEE
Confidence            5788999999887


Done!