BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034490
         (93 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
 pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
 pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
 pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
 pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
 pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
 pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
 pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
 pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
 pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
 pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
 pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
 pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
 pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
 pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
 pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
 pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
 pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
 pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
 pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
 pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
 pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
 pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
 pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
          Length = 105

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 12  GREVTVELKNDLAIRGTLHSVDQYLNIKLENT--RVVDQDKYPHMLSVRNCFIRGSVVRY 69
           GR + VELKN     G L + D Y N+ L        D DK+     +  C+IRG+ ++Y
Sbjct: 26  GRPILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKF---FRLPECYIRGNNIKY 82

Query: 70  VQLPPDGVDVDLLHDATRREARG 92
           +++  + +       A +RE RG
Sbjct: 83  LRIQDEVLSQVAKQQAQQRENRG 105


>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
          Snrnp Core Domain
 pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|A Chain A, Macromolecular Machine 6
 pdb|4F7U|C Chain C, Macromolecular Machine 6
 pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
          Length = 119

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 1  MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC 60
          M    +   L    VT+ELKN   + GT+  VD  +N  L+  ++  +++ P  + +   
Sbjct: 1  MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREP--VQLETL 58

Query: 61 FIRGSVVRYVQLPPDGVDVDLL 82
           IRG+ +RY  L PD + +D L
Sbjct: 59 SIRGNNIRYFIL-PDSLPLDTL 79


>pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|B Chain B, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|C Chain C, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|D Chain D, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|E Chain E, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|F Chain F, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|G Chain G, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|H Chain H, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|I Chain I, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|J Chain J, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|K Chain K, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|L Chain L, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|M Chain M, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|N Chain N, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|O Chain O, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|P Chain P, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Q Chain Q, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|R Chain R, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|S Chain S, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|T Chain T, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|U Chain U, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|V Chain V, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|W Chain W, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|X Chain X, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Y Chain Y, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Z Chain Z, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|1 Chain 1, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|2 Chain 2, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
          Length = 130

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 3  FFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55
          F +   +L+GREV V L N    +G LH+VD  LNI L N      +K+  + 
Sbjct: 1  FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVF 53


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 5/71 (7%)

Query: 5  SYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENT-RVVDQDKYPHMLSVRNCFIR 63
          +  +D +G++V V+L++   IRG L S DQ++N+ LE+   ++D + Y     V    +R
Sbjct: 14 ATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMV----VR 69

Query: 64 GSVVRYVQLPP 74
          G  V ++   P
Sbjct: 70 GENVLFISPVP 80


>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Z Chain Z, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|1 Chain 1, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|2 Chain 2, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|F Chain F, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|I Chain I, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|F Chain F, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|F Chain F, Macromolecular Machine 6
 pdb|4F7U|I Chain I, Macromolecular Machine 6
 pdb|1VU2|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|ZZ Chain z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|4F77|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|4F77|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|4F77|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|4F77|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|4F77|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|ZZ Chain z, The 8s Snrnp Assembly Intermediate
          Length = 86

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 6  YFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTR 44
          +   L G+ V V+LK  +  +G L SVD Y+N++L NT 
Sbjct: 10 FLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTE 48


>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score = 35.4 bits (80), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 6  YFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGS 65
          +   ++G++V + L + +  +G L  +D Y+N+ LE T      K  ++    + FIRG+
Sbjct: 10 FLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYG--DAFIRGN 67

Query: 66 VVRYVQLPPD 75
           V YV    D
Sbjct: 68 NVLYVSALDD 77


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 33.9 bits (76), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 6  YFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGS 65
          +   ++G++V + L + +  +G L  +D Y N+ LE T      K  ++    + FIRG+
Sbjct: 8  FLNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEYVNGKKTNVYG--DAFIRGN 65

Query: 66 VVRYVQLPPD 75
           V YV    D
Sbjct: 66 NVLYVSALDD 75


>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|B Chain B, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|C Chain C, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|D Chain D, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|E Chain E, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|F Chain F, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|G Chain G, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|H Chain H, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|I Chain I, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|J Chain J, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|K Chain K, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|L Chain L, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|M Chain M, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|N Chain N, Crystal Structure Of Yeast Smf In Spacegroup P43212
          Length = 93

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 6  YFKDLVGREVTVELK-NDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLS---VRNCF 61
          + K LV   V V+LK N    RGTL S D Y N++L      + +++   +S   +   F
Sbjct: 25 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLN-----EAEEFVAGVSHGTLGEIF 79

Query: 62 IRGSVVRYVQLPPD 75
          IR + V Y++  P+
Sbjct: 80 IRSNNVLYIRELPN 93


>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|B Chain B, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|C Chain C, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|D Chain D, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|E Chain E, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|F Chain F, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|G Chain G, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
          Length = 93

 Score = 30.8 bits (68), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 6  YFKDLVGREVTVELK-NDLAIRGTLHSVDQYLNIKL 40
          + K LV   V V+LK N    RGTL S D Y N++L
Sbjct: 25 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQL 60


>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|W Chain W, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 126

 Score = 30.0 bits (66), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 12 GREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQ 71
          G  VT E       RG L   +  +N ++ N  V  +D    +  +   +IRGS +R++ 
Sbjct: 15 GHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRD--GRVAQLEQVYIRGSKIRFLI 72

Query: 72 LPPDGVDVDLLHDA 85
          LP      D+L +A
Sbjct: 73 LP------DMLKNA 80


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 29.3 bits (64), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRG 64
          V V+LK +  +RG L S DQ++N+ L ++  +  D     L      IRG
Sbjct: 22 VLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGT--IVIRG 69


>pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor
            Domain
 pdb|3VKH|B Chain B, X-Ray Structure Of A Functional Full-Length Dynein Motor
            Domain
          Length = 3367

 Score = 27.7 bits (60), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 21   NDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVV 67
            ND  +RG L S+D ++++  +    +D DK P  ++VR   I GS +
Sbjct: 2936 NDADLRGALDSIDYWVDLYSKGRSNIDPDKIP-WIAVRT--ILGSTI 2979


>pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor
            Domain
 pdb|3VKG|B Chain B, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor
            Domain
          Length = 3245

 Score = 27.7 bits (60), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 21   NDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVV 67
            ND  +RG L S+D ++++  +    +D DK P  ++VR   I GS +
Sbjct: 2814 NDADLRGALDSIDYWVDLYSKGRSNIDPDKIP-WIAVRT--ILGSTI 2857


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQ 71
          V ++LK D   RG L S D ++N+ L +   ++  +    L      IRG  + Y+ 
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGT--VLIRGDNIVYIS 80


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 27.3 bits (59), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQ 71
          V ++LK D   RG L S D ++N+ L +   ++  +    L      IRG  + Y+ 
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGT--VLIRGDNIVYIS 80


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQ 71
          V ++LK D   RG L S D ++N+ L +   ++  +    L      IRG  + Y+ 
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGT--VLIRGDNIVYIS 80


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 27.3 bits (59), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQ 71
          V ++LK D   RG L S D ++N+ L +   ++  +    L      IRG  + Y+ 
Sbjct: 28 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGT--VLIRGDNIVYIS 82


>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
 pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
 pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
 pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
 pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
 pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
 pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
 pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
 pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
 pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
 pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
 pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
 pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
 pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
          Length = 93

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 11/70 (15%)

Query: 15 VTVELKNDLAIRGTLHSVDQYLNIKLENTRVV-------DQDKYPHMLSVRN----CFIR 63
          V V+L+ D  + G LH+ D++LN  L +   +       + DK   + ++R      F+R
Sbjct: 22 VYVKLRGDRELNGRLHAYDEHLNXVLGDAEEIVTIFDDEETDKDKALKTIRKHYEXLFVR 81

Query: 64 GSVVRYVQLP 73
          G  V  +  P
Sbjct: 82 GDSVILIAPP 91


>pdb|2ELF|A Chain A, Crystal Structure Of The Selb-Like Elongation Factor
          Ef-Pyl From Methanosarcina Mazei
          Length = 370

 Score = 25.4 bits (54), Expect = 9.1,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 3/72 (4%)

Query: 10 LVGREVT--VELKNDLAIRGTLHSVDQYLNIKL-ENTRVVDQDKYPHMLSVRNCFIRGSV 66
          ++G E +    L  +L  +GT   +  Y N K   N   VD   YP  L      +  S 
Sbjct: 26 IIGTEKSGRTSLAANLGKKGTSSDITXYNNDKEGRNXVFVDAHSYPKTLKSLITALNISD 85

Query: 67 VRYVQLPPDGVD 78
          +  + +PP G+D
Sbjct: 86 IAVLCIPPQGLD 97


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.142    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,694,657
Number of Sequences: 62578
Number of extensions: 91524
Number of successful extensions: 236
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 218
Number of HSP's gapped (non-prelim): 21
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)