Query         034497
Match_columns 93
No_of_seqs    99 out of 103
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 03:30:05 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034497.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034497hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03242 LEA_3:  Late embryogen 100.0 1.1E-38 2.4E-43  216.9   3.8   83    1-86      1-93  (93)
  2 PF02736 Myosin_N:  Myosin N-te  86.6    0.23 4.9E-06   28.8   0.2   13   54-66      2-14  (42)
  3 PF09996 DUF2237:  Uncharacteri  70.1       2 4.3E-05   30.8   0.7   10   59-68     14-23  (117)
  4 COG3651 Uncharacterized protei  68.7     1.8 3.9E-05   31.1   0.3   10   58-67     20-29  (125)
  5 PF10948 DUF2635:  Protein of u  58.9     5.4 0.00012   24.2   1.0   15   58-72      9-23  (47)
  6 PF10500 SR-25:  Nuclear RNA-sp  54.4     3.7   8E-05   32.3  -0.3   37   39-75    156-192 (225)
  7 PRK09936 hypothetical protein;  49.9     8.4 0.00018   31.4   1.1   26   60-85    133-159 (296)
  8 PF03195 DUF260:  Protein of un  37.0      13 0.00028   25.4   0.3   18   53-70     64-81  (101)
  9 PF13405 EF-hand_6:  EF-hand do  31.3      30 0.00066   17.8   1.1   16   69-84     11-26  (31)
 10 TIGR03054 photo_alph_chp1 puta  31.0      28 0.00061   25.2   1.2   26   57-82    108-133 (135)
 11 TIGR02697 WPE_wolbac Wolbachia  29.1      25 0.00054   20.5   0.6   11   61-71      3-13  (36)
 12 PF07846 Metallothio_Cad:  Meta  28.1      28 0.00061   18.1   0.6    8   58-65     11-18  (21)
 13 PF09803 DUF2346:  Uncharacteri  28.1      16 0.00034   24.2  -0.4   31   57-87     34-64  (80)
 14 PF12904 Collagen_bind_2:  Puta  26.6      22 0.00048   24.0   0.1   18   53-71     49-66  (93)
 15 COG3375 Uncharacterized conser  25.5      42 0.00092   27.1   1.5   13   58-70    178-190 (266)
 16 cd02182 GH16_Strep_laminarinas  25.1      30 0.00064   26.2   0.5   28   54-81    109-137 (259)
 17 PF11767 SET_assoc:  Histone ly  24.8      25 0.00054   22.4   0.0   18   54-71     25-42  (66)
 18 PF07886 BA14K:  BA14K-like pro  23.8      46   0.001   18.5   1.0   12   60-71     14-25  (31)
 19 PF13597 NRDD:  Anaerobic ribon  23.7      37  0.0008   29.1   0.9   24   60-83    519-542 (546)
 20 PRK13750 replication protein;   22.6      34 0.00074   27.8   0.4   18   52-71    131-148 (285)
 21 PF14317 YcxB:  YcxB-like prote  22.3      25 0.00055   19.7  -0.3   27   58-84     35-61  (62)
 22 cd04711 BAH_Dnmt1_II BAH, or B  22.1      16 0.00035   26.7  -1.3   18   65-82     57-77  (137)
 23 PHA00542 putative Cro-like pro  21.4      78  0.0017   20.2   1.9   26   61-88      6-31  (82)
 24 PF10848 DUF2655:  Protein of u  21.3      41 0.00088   22.5   0.5   14   58-71     14-27  (82)
 25 KOG2165 Anaphase-promoting com  20.7      39 0.00085   30.9   0.5    8   56-63    419-426 (765)
 26 COG4953 PbpC Membrane carboxyp  20.6      54  0.0012   29.9   1.3   25   62-86    365-390 (733)
 27 COG3323 Uncharacterized protei  20.3      38 0.00082   24.0   0.2   21   52-73     35-55  (109)
 28 PF08265 YL1_C:  YL1 nuclear pr  20.3      48   0.001   18.3   0.6    8   58-65     12-19  (30)

No 1  
>PF03242 LEA_3:  Late embryogenesis abundant protein;  InterPro: IPR004926  Late-embryogenesis abundant (LEA) genes encode a diverse group of proteins that accumulate to high levels during the maturation phase of seed development [].  This group includes LEA-5 [], whose expression is induced by salt, drought and heat stress [], and related proteins. ; GO: 0006950 response to stress
Probab=100.00  E-value=1.1e-38  Score=216.88  Aligned_cols=83  Identities=36%  Similarity=0.500  Sum_probs=61.4

Q ss_pred             Ccccchh---------hhhhhhhhhhhhhHhhhcccCCCchHH-HHHHHhhhhhhhhccccccccccccCCCCccccCCC
Q 034497            1 MASKFSN---------SFLLLRFCRRSNAVAAGNVGGKQPAAA-EVMRKMTDMKAESVCGVEKEEFWMRDPNTGNWIPES   70 (93)
Q Consensus         1 MArs~sn---------~~lsl~~~RRgYaaAA~~~a~~~~~~~-~~a~~~~~~~~~~~~~~~~~~~WmpDP~TG~y~Pen   70 (93)
                      |||||||         +.|+++++||||+++++.  +.+++.. .+.++. +...+.++..++++|||||||||||||||
T Consensus         1 MArsls~ak~lsal~~~~~s~~~~rRgYaaaA~~--~~~sa~r~g~~~~~-~~~~~~~~~~~~~~~W~pDPvTGyyrPen   77 (93)
T PF03242_consen    1 MARSLSNAKVLSALVSDAFSSLISRRGYAAAAAA--VRSSAARGGAAGKA-KMASKAGEDSKEKSSWMPDPVTGYYRPEN   77 (93)
T ss_pred             CchhHHHHHHHHHHHHHHHHHHHHhhhHHHHHHH--HHhhcccccccccc-hhhhhcccccccccccccCCCCccccCCC
Confidence            9999999         567888899999999984  2221100 011111 11122233478899999999999999999


Q ss_pred             CcCcCCHHHHHHhhCC
Q 034497           71 QFNQIDAADLRDQLLP   86 (93)
Q Consensus        71 ~~~e~D~aeLR~~lL~   86 (93)
                      ||+|||+||||++||+
T Consensus        78 ~~~EiD~AeLR~~lL~   93 (93)
T PF03242_consen   78 HFGEIDAAELRAKLLK   93 (93)
T ss_pred             CCCCCCHHHHHHHHhC
Confidence            9999999999999996


No 2  
>PF02736 Myosin_N:  Myosin N-terminal SH3-like domain;  InterPro: IPR004009 This domain has an SH3-like fold. It is found at the N terminus of many but not all myosins. The function of this domain is unknown.; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 2EC6_A 2W4H_M 1O1E_P 1O1D_D 1O18_A 1O1C_P 1O1B_D 1O1F_A 2W4A_M 2W4G_M ....
Probab=86.61  E-value=0.23  Score=28.78  Aligned_cols=13  Identities=31%  Similarity=0.662  Sum_probs=10.6

Q ss_pred             ccccccCCCCccc
Q 034497           54 EEFWMRDPNTGNW   66 (93)
Q Consensus        54 ~~~WmpDP~TG~y   66 (93)
                      +.-|+|||..||=
T Consensus         2 ~~vWvpD~~egfv   14 (42)
T PF02736_consen    2 KWVWVPDPKEGFV   14 (42)
T ss_dssp             TEEEEEESSSSEE
T ss_pred             CEEEEeCCcccEE
Confidence            3469999999984


No 3  
>PF09996 DUF2237:  Uncharacterized protein conserved in bacteria (DUF2237);  InterPro: IPR018714 This family of hypothetical proteins has no known function.; PDB: 2LQ3_A 3USH_B.
Probab=70.06  E-value=2  Score=30.78  Aligned_cols=10  Identities=40%  Similarity=0.564  Sum_probs=7.6

Q ss_pred             cCCCCccccC
Q 034497           59 RDPNTGNWIP   68 (93)
Q Consensus        59 pDP~TG~y~P   68 (93)
                      -||.|||||=
T Consensus        14 ~~P~TGf~Rd   23 (117)
T PF09996_consen   14 TDPMTGFYRD   23 (117)
T ss_dssp             TTTT-STTSS
T ss_pred             CCCCcccccC
Confidence            4899999993


No 4  
>COG3651 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.69  E-value=1.8  Score=31.10  Aligned_cols=10  Identities=40%  Similarity=0.531  Sum_probs=8.8

Q ss_pred             ccCCCCcccc
Q 034497           58 MRDPNTGNWI   67 (93)
Q Consensus        58 mpDP~TG~y~   67 (93)
                      --||+||+||
T Consensus        20 ~~dPlTGFYR   29 (125)
T COG3651          20 CTDPLTGFYR   29 (125)
T ss_pred             cCCcchhhhc
Confidence            3599999998


No 5  
>PF10948 DUF2635:  Protein of unknown function (DUF2635);  InterPro: IPR024400 This family consists of uncharacterised proteins found in bacteria and bacteriophages. It includes protein Gp38 from Enterobacteria phage Mu.
Probab=58.89  E-value=5.4  Score=24.20  Aligned_cols=15  Identities=40%  Similarity=0.791  Sum_probs=13.2

Q ss_pred             ccCCCCccccCCCCc
Q 034497           58 MRDPNTGNWIPESQF   72 (93)
Q Consensus        58 mpDP~TG~y~Pen~~   72 (93)
                      ||||.||-+.|+...
T Consensus         9 VrdP~~g~~Lp~eG~   23 (47)
T PF10948_consen    9 VRDPDTGQLLPAEGE   23 (47)
T ss_pred             cCCCCCCCccCcccc
Confidence            899999999998863


No 6  
>PF10500 SR-25:  Nuclear RNA-splicing-associated protein;  InterPro: IPR019532  SR-25, otherwise known as ADP-ribosylation factor-like factor 6-interacting protein 4, is expressed in virtually all tissue types. At the N terminus there is a repeat of serine-arginine (SR repeat), and towards the middle of the protein there are clusters of both serines and of basic amino acids. The presence of many nuclear localisation signals strongly implies that this is a nuclear protein that may contribute to RNA splicing []. SR-25 is also implicated, along with heat-shock-protein-27, as a mediator in the Rac1 (GTPase ras-related C3 botulinum toxin substrate 1; also see IPR019093 from INTERPRO) signalling pathway [].
Probab=54.44  E-value=3.7  Score=32.32  Aligned_cols=37  Identities=22%  Similarity=0.096  Sum_probs=25.1

Q ss_pred             HhhhhhhhhccccccccccccCCCCccccCCCCcCcC
Q 034497           39 KMTDMKAESVCGVEKEEFWMRDPNTGNWIPESQFNQI   75 (93)
Q Consensus        39 ~~~~~~~~~~~~~~~~~~WmpDP~TG~y~Pen~~~e~   75 (93)
                      .|.|...|+=.+-.--+-||=||.||-+|=....+||
T Consensus       156 am~PmTkEEyearQSvIRrVvDpETGRtRLIkGdGEi  192 (225)
T PF10500_consen  156 AMAPMTKEEYEARQSVIRRVVDPETGRTRLIKGDGEI  192 (225)
T ss_pred             hcCCCCHHHHHHHHhhheeeecCCCCceeeecccchH
Confidence            3555555552112223559999999999999888886


No 7  
>PRK09936 hypothetical protein; Provisional
Probab=49.90  E-value=8.4  Score=31.36  Aligned_cols=26  Identities=23%  Similarity=0.328  Sum_probs=16.1

Q ss_pred             CCCCccccCCCCcC-cCCHHHHHHhhC
Q 034497           60 DPNTGNWIPESQFN-QIDAADLRDQLL   85 (93)
Q Consensus        60 DP~TG~y~Pen~~~-e~D~aeLR~~lL   85 (93)
                      =|++|||+|..--. .-..++-|+.|+
T Consensus       133 ~~v~GWYiP~ElDd~~W~~~~rR~~L~  159 (296)
T PRK09936        133 VPVDGWYLPAELDDLNWRDEARRQPLL  159 (296)
T ss_pred             CCCCeEEeeeccchhcccCHHHHHHHH
Confidence            45799999964321 112266677776


No 8  
>PF03195 DUF260:  Protein of unknown function DUF260;  InterPro: IPR004883 The lateral organ boundaries (LOB) gene is expressed at the adaxial base of initiating lateral organs and encodes a plant-specific protein of unknown function. The N-terminal one half of the LOB protein contains a conserved approximately 100-amino acid domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins and in proteins from a variety of other plant species. Genes encoding LOB domain (LBD) proteins are expressed in a variety of temporal- and tissue-specific patterns, suggesting that they may function in diverse processes [] The LOB domain contains conserved blocks of amino acids that identify the LBD gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is defining feature of the LOB domain, is present in all LBD proteins. It is possible that this motif forms a new zinc finger [].
Probab=36.99  E-value=13  Score=25.43  Aligned_cols=18  Identities=28%  Similarity=0.095  Sum_probs=13.7

Q ss_pred             cccccccCCCCccccCCC
Q 034497           53 KEEFWMRDPNTGNWIPES   70 (93)
Q Consensus        53 ~~~~WmpDP~TG~y~Pen   70 (93)
                      |-..|..||+.|.+--..
T Consensus        64 EA~~R~~dPv~Gc~G~i~   81 (101)
T PF03195_consen   64 EANARARDPVYGCVGIIS   81 (101)
T ss_pred             HHHhhccCCCcchHHHHH
Confidence            346699999999875444


No 9  
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=31.35  E-value=30  Score=17.81  Aligned_cols=16  Identities=31%  Similarity=0.285  Sum_probs=12.7

Q ss_pred             CCCcCcCCHHHHHHhh
Q 034497           69 ESQFNQIDAADLRDQL   84 (93)
Q Consensus        69 en~~~e~D~aeLR~~l   84 (93)
                      .|+.+.||..||+..|
T Consensus        11 ~d~dG~I~~~el~~~l   26 (31)
T PF13405_consen   11 KDGDGFIDFEELRAIL   26 (31)
T ss_dssp             TTSSSEEEHHHHHHHH
T ss_pred             CCCCCcCcHHHHHHHH
Confidence            3566889999999876


No 10 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=30.98  E-value=28  Score=25.23  Aligned_cols=26  Identities=31%  Similarity=0.346  Sum_probs=21.8

Q ss_pred             cccCCCCccccCCCCcCcCCHHHHHH
Q 034497           57 WMRDPNTGNWIPESQFNQIDAADLRD   82 (93)
Q Consensus        57 WmpDP~TG~y~Pen~~~e~D~aeLR~   82 (93)
                      =+-||.||..+.-+.|+....+...+
T Consensus       108 tL~Dp~Tg~~i~L~aFG~dN~aaFa~  133 (135)
T TIGR03054       108 TLTDPATGWSIELNAFGADNAAAFER  133 (135)
T ss_pred             EEEcCCCCcEEEEeecCCchHHHHHh
Confidence            36799999999999999988776543


No 11 
>TIGR02697 WPE_wolbac Wolbachia palindromic element (WPE) domain. This domain conceptually resembles TIGR01045, the Rickettsial palindromic element (RPE) domain. In both cases, a protein-coding palindromic element spreads through a genome, inserting usually in protein-coding regions. The additional protein coding sequence is thought to allow function of the host protein because of location in surface-exposed regions of the protein structure. Note that this model appears to work better in fragment mode.
Probab=29.09  E-value=25  Score=20.55  Aligned_cols=11  Identities=36%  Similarity=0.806  Sum_probs=9.7

Q ss_pred             CCCccccCCCC
Q 034497           61 PNTGNWIPESQ   71 (93)
Q Consensus        61 P~TG~y~Pen~   71 (93)
                      ||-+||-|||-
T Consensus         3 PV~~hwDp~~l   13 (36)
T TIGR02697         3 PVPRHWDPENL   13 (36)
T ss_pred             ccccccCcchh
Confidence            78899999986


No 12 
>PF07846 Metallothio_Cad:  Metallothionein family;  InterPro: IPR012484 The sequence making up family 7 of the metallothionein superfamily are found repeated in metallothionein proteins expressed by two Tetrahymena species. Metallothioneins are low molecular mass, cysteine-rich metal-binding proteins that are thought to be involved in the regulation of levels of trace metals, and detoxification of these metals when present in excess []. Some of the metallothioneins found in this family (for example, Q8T6B3 from SWISSPROT) are known to be induced by cadmium and are thought to be involved in the cellular sequestration of toxic metal ions. The high proportion of cysteine residues allows the metal ions to be bound by the formation of clusters of metal-thiolate complexes []. Tetrahymena spp. metallothioneins differ from other eukaryotic metallothioneins mainly in the length of their sequences and in the cysteine-containing motifs they exhibit. ; GO: 0046870 cadmium ion binding
Probab=28.12  E-value=28  Score=18.15  Aligned_cols=8  Identities=50%  Similarity=0.887  Sum_probs=6.3

Q ss_pred             ccCCCCcc
Q 034497           58 MRDPNTGN   65 (93)
Q Consensus        58 mpDP~TG~   65 (93)
                      --||.|||
T Consensus        11 C~DPnsG~   18 (21)
T PF07846_consen   11 CTDPNSGC   18 (21)
T ss_pred             ccCCCCcc
Confidence            35999997


No 13 
>PF09803 DUF2346:  Uncharacterized conserved protein (DUF2346);  InterPro: IPR018625  Members of this family of proteins have no known function. 
Probab=28.05  E-value=16  Score=24.19  Aligned_cols=31  Identities=16%  Similarity=0.377  Sum_probs=23.4

Q ss_pred             cccCCCCccccCCCCcCcCCHHHHHHhhCCc
Q 034497           57 WMRDPNTGNWIPESQFNQIDAADLRDQLLPK   87 (93)
Q Consensus        57 WmpDP~TG~y~Pen~~~e~D~aeLR~~lL~~   87 (93)
                      ||.+-...+|.|++....-...++++.++.+
T Consensus        34 ~v~~~~~~~~ppe~~~~~~ele~~~~~~~~k   64 (80)
T PF09803_consen   34 WVIKRKRELYPPENEEIREELEEFKEELRKK   64 (80)
T ss_pred             HhHHHhcccCCCCCcccHHHHHHHHHHHHHH
Confidence            8888888999999876555567777777644


No 14 
>PF12904 Collagen_bind_2:  Putative collagen-binding domain of a collagenase ;  InterPro: IPR024749 This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. The structure of one family member, Q8A905 from SWISSPROT, has been characterised. The domain occurs in the C-terminal region of the protein.; PDB: 3KZS_D.
Probab=26.63  E-value=22  Score=23.95  Aligned_cols=18  Identities=28%  Similarity=0.763  Sum_probs=13.0

Q ss_pred             cccccccCCCCccccCCCC
Q 034497           53 KEEFWMRDPNTGNWIPESQ   71 (93)
Q Consensus        53 ~~~~WmpDP~TG~y~Pen~   71 (93)
                      .+..|+ ||.||-|.+...
T Consensus        49 ~~a~Wf-dPR~G~~~~~g~   66 (93)
T PF12904_consen   49 VKAWWF-DPRTGKYTYIGE   66 (93)
T ss_dssp             EEEEEE-ETTT-BEEEEEE
T ss_pred             eeEEEE-cCCCCCEEEeee
Confidence            467787 999999988643


No 15 
>COG3375 Uncharacterized conserved protein [Function unknown]
Probab=25.46  E-value=42  Score=27.05  Aligned_cols=13  Identities=23%  Similarity=0.294  Sum_probs=11.0

Q ss_pred             ccCCCCccccCCC
Q 034497           58 MRDPNTGNWIPES   70 (93)
Q Consensus        58 mpDP~TG~y~Pen   70 (93)
                      .++++||||||..
T Consensus       178 in~~~~g~~rp~~  190 (266)
T COG3375         178 INPGGTGYLRPVE  190 (266)
T ss_pred             cCCCCcccccccc
Confidence            3469999999988


No 16 
>cd02182 GH16_Strep_laminarinase_like Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
Probab=25.07  E-value=30  Score=26.17  Aligned_cols=28  Identities=25%  Similarity=0.398  Sum_probs=16.2

Q ss_pred             ccccc-cCCCCccccCCCCcCcCCHHHHH
Q 034497           54 EEFWM-RDPNTGNWIPESQFNQIDAADLR   81 (93)
Q Consensus        54 ~~~Wm-pDP~TG~y~Pen~~~e~D~aeLR   81 (93)
                      -.||| |++.++.|-+=-..+|||+.|-.
T Consensus       109 PAfWll~~~~~~~~~~WP~~GEIDImE~~  137 (259)
T cd02182         109 PAFWMLGDSYRGNGTNWPACGELDIMENV  137 (259)
T ss_pred             eeeeccCCCccCCCCCCCccceeeeeecc
Confidence            36786 55544222222235899999865


No 17 
>PF11767 SET_assoc:  Histone lysine methyltransferase SET associated;  InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes. This entry represents a domain of unknown function which is associated with the SET domain and found in histone lysine methyltransferases []. 
Probab=24.76  E-value=25  Score=22.41  Aligned_cols=18  Identities=28%  Similarity=0.219  Sum_probs=14.0

Q ss_pred             ccccccCCCCccccCCCC
Q 034497           54 EEFWMRDPNTGNWIPESQ   71 (93)
Q Consensus        54 ~~~WmpDP~TG~y~Pen~   71 (93)
                      .-.|+.+-.||||+==|-
T Consensus        25 ~~~~I~~d~tGfYIvF~~   42 (66)
T PF11767_consen   25 RWDRIRDDRTGFYIVFND   42 (66)
T ss_pred             CcceEEecCCEEEEEECC
Confidence            345899999999996553


No 18 
>PF07886 BA14K:  BA14K-like protein;  InterPro: IPR012413 The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus (Q44701 from SWISSPROT) and by Brucella suis (Q8FVU0 from SWISSPROT). BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process []. 
Probab=23.84  E-value=46  Score=18.53  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=10.4

Q ss_pred             CCCCccccCCCC
Q 034497           60 DPNTGNWIPESQ   71 (93)
Q Consensus        60 DP~TG~y~Pen~   71 (93)
                      ||.||.|+|-+.
T Consensus        14 ~p~~~Ty~~~~G   25 (31)
T PF07886_consen   14 DPRDNTYQPYDG   25 (31)
T ss_pred             CCCCCcEeCCCC
Confidence            899999999764


No 19 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=23.73  E-value=37  Score=29.08  Aligned_cols=24  Identities=29%  Similarity=0.447  Sum_probs=8.1

Q ss_pred             CCCCccccCCCCcCcCCHHHHHHh
Q 034497           60 DPNTGNWIPESQFNQIDAADLRDQ   83 (93)
Q Consensus        60 DP~TG~y~Pen~~~e~D~aeLR~~   83 (93)
                      .-+||||+|.+++++-=-+|++.+
T Consensus       519 ~Rv~GYl~~v~~~n~gK~~E~~~R  542 (546)
T PF13597_consen  519 SRVTGYLRPVSRWNKGKQAEFKDR  542 (546)
T ss_dssp             B-SSSS-BTTS-------------
T ss_pred             EEeeccccCccccCHHHHHHHHHh
Confidence            458999999998888777777654


No 20 
>PRK13750 replication protein; Provisional
Probab=22.61  E-value=34  Score=27.84  Aligned_cols=18  Identities=28%  Similarity=0.506  Sum_probs=14.3

Q ss_pred             ccccccccCCCCccccCCCC
Q 034497           52 EKEEFWMRDPNTGNWIPESQ   71 (93)
Q Consensus        52 ~~~~~WmpDP~TG~y~Pen~   71 (93)
                      .-+..|  |+.+|+|+|-..
T Consensus       131 ~cek~w--D~~~g~yiPk~I  148 (285)
T PRK13750        131 TYQTEY--DPLIGCYIPTDI  148 (285)
T ss_pred             eeeeec--cchhhcccCcce
Confidence            345668  999999999764


No 21 
>PF14317 YcxB:  YcxB-like protein
Probab=22.31  E-value=25  Score=19.73  Aligned_cols=27  Identities=22%  Similarity=0.391  Sum_probs=21.8

Q ss_pred             ccCCCCccccCCCCcCcCCHHHHHHhh
Q 034497           58 MRDPNTGNWIPESQFNQIDAADLRDQL   84 (93)
Q Consensus        58 mpDP~TG~y~Pen~~~e~D~aeLR~~l   84 (93)
                      .-++..++.+|-..+.+-|..++++.|
T Consensus        35 ~~~~~~~~~iPk~~f~~~e~~~f~~~l   61 (62)
T PF14317_consen   35 YLGKNQAFIIPKRAFSEEEKEEFREFL   61 (62)
T ss_pred             EECCCeEEEEEHHHCCHhHHHHHHHHh
Confidence            358889999999998877888887654


No 22 
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=22.10  E-value=16  Score=26.70  Aligned_cols=18  Identities=28%  Similarity=0.399  Sum_probs=12.2

Q ss_pred             cccCCCCcCcCCH---HHHHH
Q 034497           65 NWIPESQFNQIDA---ADLRD   82 (93)
Q Consensus        65 ~y~Pen~~~e~D~---aeLR~   82 (93)
                      ||||||..+-...   +|+|+
T Consensus        57 fYRPEdi~~g~~~ayhsDire   77 (137)
T cd04711          57 FYRPENTHKGFKATYHADINM   77 (137)
T ss_pred             Eecccccccccccccccceee
Confidence            8999998775433   44443


No 23 
>PHA00542 putative Cro-like protein
Probab=21.36  E-value=78  Score=20.17  Aligned_cols=26  Identities=23%  Similarity=0.204  Sum_probs=17.4

Q ss_pred             CCCccccCCCCcCcCCHHHHHHhhCCcc
Q 034497           61 PNTGNWIPESQFNQIDAADLRDQLLPKI   88 (93)
Q Consensus        61 P~TG~y~Pen~~~e~D~aeLR~~lL~~~   88 (93)
                      |.+|.|||.-+..  ++.++...+..++
T Consensus         6 ~~~~~~Rp~~~~~--~~~~l~~~l~~~g   31 (82)
T PHA00542          6 PATTPTIPAAYTQ--RPDELVCALIRAG   31 (82)
T ss_pred             cccCCcCCcccCc--CHHHHHHHHHHCC
Confidence            5689999997755  3556666655443


No 24 
>PF10848 DUF2655:  Protein of unknown function (DUF2655);  InterPro: IPR020371 This entry contains proteins with no known function.
Probab=21.29  E-value=41  Score=22.54  Aligned_cols=14  Identities=21%  Similarity=0.482  Sum_probs=10.3

Q ss_pred             ccCCCCccccCCCC
Q 034497           58 MRDPNTGNWIPESQ   71 (93)
Q Consensus        58 mpDP~TG~y~Pen~   71 (93)
                      ..--.||||-||-.
T Consensus        14 ls~kq~g~yspe~~   27 (82)
T PF10848_consen   14 LSKKQPGHYSPEIF   27 (82)
T ss_pred             hcccCCCCcCcccc
Confidence            33456999999864


No 25 
>KOG2165 consensus Anaphase-promoting complex (APC), subunit 2 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=20.70  E-value=39  Score=30.89  Aligned_cols=8  Identities=50%  Similarity=0.999  Sum_probs=6.6

Q ss_pred             ccccCCCC
Q 034497           56 FWMRDPNT   63 (93)
Q Consensus        56 ~WmpDP~T   63 (93)
                      -|||||+-
T Consensus       419 ~W~PdPiD  426 (765)
T KOG2165|consen  419 NWMPDPID  426 (765)
T ss_pred             hccCCCcc
Confidence            59999964


No 26 
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=20.63  E-value=54  Score=29.92  Aligned_cols=25  Identities=20%  Similarity=0.391  Sum_probs=19.5

Q ss_pred             CCccccCCCCcCc-CCHHHHHHhhCC
Q 034497           62 NTGNWIPESQFNQ-IDAADLRDQLLP   86 (93)
Q Consensus        62 ~TG~y~Pen~~~e-~D~aeLR~~lL~   86 (93)
                      .+|+|+|+|...- ..+.-.|+.|++
T Consensus       365 ~fg~YrP~Nfd~~F~G~VsvreAL~~  390 (733)
T COG4953         365 RFGDYRPENFDSNFHGPVSVREALIK  390 (733)
T ss_pred             cccCcCCccccccccCcchHHHHHHH
Confidence            4699999998554 578888888874


No 27 
>COG3323 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.34  E-value=38  Score=24.02  Aligned_cols=21  Identities=19%  Similarity=0.194  Sum_probs=14.7

Q ss_pred             ccccccccCCCCccccCCCCcC
Q 034497           52 EKEEFWMRDPNTGNWIPESQFN   73 (93)
Q Consensus        52 ~~~~~WmpDP~TG~y~Pen~~~   73 (93)
                      ...-+|- --.||+|+|...++
T Consensus        35 Y~~C~~~-~~g~G~frP~egAn   55 (109)
T COG3323          35 YDHCTFS-SEGTGQFRPLEGAN   55 (109)
T ss_pred             cceEEEE-eeeeEEEeecCCCC
Confidence            4445564 35899999988764


No 28 
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=20.25  E-value=48  Score=18.26  Aligned_cols=8  Identities=63%  Similarity=0.987  Sum_probs=6.2

Q ss_pred             ccCCCCcc
Q 034497           58 MRDPNTGN   65 (93)
Q Consensus        58 mpDP~TG~   65 (93)
                      -.||+||-
T Consensus        12 Y~DP~T~l   19 (30)
T PF08265_consen   12 YRDPKTGL   19 (30)
T ss_pred             ccCCCCCC
Confidence            36999985


Done!