BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034523
         (92 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2PAN|A Chain A, Crystal Structure Of E. Coli Glyoxylate Carboligase
 pdb|2PAN|B Chain B, Crystal Structure Of E. Coli Glyoxylate Carboligase
 pdb|2PAN|C Chain C, Crystal Structure Of E. Coli Glyoxylate Carboligase
 pdb|2PAN|D Chain D, Crystal Structure Of E. Coli Glyoxylate Carboligase
 pdb|2PAN|E Chain E, Crystal Structure Of E. Coli Glyoxylate Carboligase
 pdb|2PAN|F Chain F, Crystal Structure Of E. Coli Glyoxylate Carboligase
          Length = 616

 Score = 26.9 bits (58), Expect = 3.2,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 13  QALRRALMVSEASTVPKGHLAV---YVGEIEKSRFVVPVSYLKHPSFQNLLSQAEEEFGF 69
           Q L   L V     +P  H+ V   Y+G I +S+      Y    +F+N+ S     +G 
Sbjct: 473 QFLIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDXDYCVQLAFENINSSEVNGYGV 532

Query: 70  DH 71
           DH
Sbjct: 533 DH 534


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,367,209
Number of Sequences: 62578
Number of extensions: 79283
Number of successful extensions: 274
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 274
Number of HSP's gapped (non-prelim): 1
length of query: 92
length of database: 14,973,337
effective HSP length: 59
effective length of query: 33
effective length of database: 11,281,235
effective search space: 372280755
effective search space used: 372280755
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)