Query         034525
Match_columns 92
No_of_seqs    137 out of 252
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 03:48:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034525.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034525hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05024 S-100A10 S-100A10: A s  98.5 4.1E-08 8.9E-13   65.9   2.4   28    1-28     53-80  (91)
  2 PF00036 EF-hand_1:  EF hand;    98.3 1.1E-07 2.5E-12   51.3   0.3   25    1-25      5-29  (29)
  3 cd05022 S-100A13 S-100A13: S-1  98.2 9.2E-07   2E-11   58.4   2.3   28    1-28     52-79  (89)
  4 cd05023 S-100A11 S-100A11: S-1  98.1 1.8E-06 3.9E-11   56.7   2.4   28    1-28     57-84  (89)
  5 cd05026 S-100Z S-100Z: S-100Z   98.0 4.7E-06   1E-10   54.5   2.3   28    1-28     58-85  (93)
  6 PF13202 EF-hand_5:  EF hand; P  97.9 3.8E-06 8.2E-11   43.8   0.9   21    2-22      5-25  (25)
  7 cd05029 S-100A6 S-100A6: S-100  97.7   2E-05 4.3E-10   51.5   2.3   28    1-28     56-83  (88)
  8 cd05027 S-100B S-100B: S-100B   97.6 3.5E-05 7.6E-10   50.3   2.3   28    1-28     56-83  (88)
  9 cd05025 S-100A1 S-100A1: S-100  97.4 9.3E-05   2E-09   47.6   2.2   28    1-28     57-84  (92)
 10 PF13833 EF-hand_8:  EF-hand do  97.4 6.4E-05 1.4E-09   43.6   1.2   24    1-24     30-53  (54)
 11 PF13499 EF-hand_7:  EF-hand do  97.4   5E-05 1.1E-09   45.3   0.6   21    2-22     46-66  (66)
 12 cd05030 calgranulins Calgranul  97.4 0.00012 2.6E-09   47.4   2.4   28    1-28     56-83  (88)
 13 PF13405 EF-hand_6:  EF-hand do  97.2 0.00013 2.8E-09   38.8   0.6   23    2-24      6-28  (31)
 14 cd05031 S-100A10_like S-100A10  96.9 0.00056 1.2E-08   44.2   2.1   27    1-27     56-82  (94)
 15 smart00054 EFh EF-hand, calciu  96.9 0.00041   9E-09   33.2   1.1   24    1-24      5-28  (29)
 16 cd00052 EH Eps15 homology doma  96.6  0.0017 3.6E-08   38.1   2.3   24    2-25     39-62  (67)
 17 cd00213 S-100 S-100: S-100 dom  96.6  0.0016 3.6E-08   41.1   2.3   28    1-28     56-83  (88)
 18 PF14788 EF-hand_10:  EF hand;   96.5   0.001 2.2E-08   40.7   0.6   26    1-26     26-51  (51)
 19 cd00252 SPARC_EC SPARC_EC; ext  96.3  0.0021 4.6E-08   44.3   1.4   22    1-22     85-106 (116)
 20 smart00027 EH Eps15 homology d  96.1  0.0044 9.5E-08   40.0   2.3   28    1-28     49-76  (96)
 21 KOG0034 Ca2+/calmodulin-depend  95.9  0.0035 7.7E-08   46.5   1.4   24    2-25    153-176 (187)
 22 cd00051 EFh EF-hand, calcium b  95.8  0.0046 9.9E-08   34.0   1.1   21    2-22     42-62  (63)
 23 KOG0027 Calmodulin and related  95.7  0.0056 1.2E-07   42.4   1.6   27    1-27     49-75  (151)
 24 PF13499 EF-hand_7:  EF-hand do  95.6  0.0039 8.4E-08   37.0   0.3   26    2-27      6-31  (66)
 25 cd00051 EFh EF-hand, calcium b  95.1   0.017 3.8E-07   31.6   1.9   24    2-25      6-29  (63)
 26 KOG4223 Reticulocalbin, calume  94.4   0.019 4.1E-07   46.3   1.3   23    2-24    206-228 (325)
 27 PTZ00183 centrin; Provisional   94.0   0.034 7.3E-07   37.1   1.7   24    2-25     59-82  (158)
 28 cd00052 EH Eps15 homology doma  94.0   0.039 8.5E-07   32.1   1.8   24    2-25      5-28  (67)
 29 KOG0044 Ca2+ sensor (EF-Hand s  93.8   0.039 8.4E-07   41.3   1.9   23    2-24     70-92  (193)
 30 PTZ00184 calmodulin; Provision  93.6   0.051 1.1E-06   35.6   2.0   24    2-25     53-76  (149)
 31 KOG0044 Ca2+ sensor (EF-Hand s  93.0   0.049 1.1E-06   40.8   1.4   24    1-24    152-175 (193)
 32 PTZ00184 calmodulin; Provision  91.7    0.15 3.3E-06   33.3   2.3   24    2-25     17-40  (149)
 33 smart00027 EH Eps15 homology d  91.4    0.14 3.1E-06   32.9   1.9   23    2-24     16-38  (96)
 34 PTZ00183 centrin; Provisional   91.4    0.14   3E-06   34.1   1.8   24    2-25     96-119 (158)
 35 PLN02964 phosphatidylserine de  90.5    0.14 3.1E-06   44.4   1.6   25    1-25    184-208 (644)
 36 KOG0036 Predicted mitochondria  90.2    0.18 3.8E-06   42.4   1.9   28    1-28     56-83  (463)
 37 PF12763 EF-hand_4:  Cytoskelet  89.3    0.21 4.6E-06   33.8   1.3   21    3-23     50-70  (104)
 38 KOG0027 Calmodulin and related  88.3    0.39 8.4E-06   33.1   2.2   27    2-28     91-117 (151)
 39 cd00252 SPARC_EC SPARC_EC; ext  88.2    0.28   6E-06   33.7   1.4   21    2-22     54-74  (116)
 40 cd00213 S-100 S-100: S-100 dom  87.1    0.48   1E-05   29.6   1.9   23    2-24     14-38  (88)
 41 KOG0034 Ca2+/calmodulin-depend  87.1    0.55 1.2E-05   34.9   2.5   27    2-28    110-136 (187)
 42 KOG0041 Predicted Ca2+-binding  86.0    0.42 9.2E-06   37.1   1.4   26    1-26    140-165 (244)
 43 KOG0038 Ca2+-binding kinase in  85.1    0.54 1.2E-05   35.2   1.6   24    1-24    154-177 (189)
 44 cd05026 S-100Z S-100Z: S-100Z   84.5    0.63 1.4E-05   30.1   1.5   24    2-25     16-41  (93)
 45 KOG2643 Ca2+ binding protein,   84.4    0.82 1.8E-05   38.8   2.5   27    2-28    431-457 (489)
 46 PF14658 EF-hand_9:  EF-hand do  84.3    0.67 1.4E-05   29.5   1.5   24    2-25     41-65  (66)
 47 cd05031 S-100A10_like S-100A10  83.8    0.79 1.7E-05   29.3   1.8   23    2-24     14-38  (94)
 48 PRK12309 transaldolase/EF-hand  82.8    0.88 1.9E-05   37.2   2.0   17    3-19    341-357 (391)
 49 KOG2643 Ca2+ binding protein,   82.3     1.2 2.7E-05   37.7   2.8   23    2-24    239-261 (489)
 50 cd05027 S-100B S-100B: S-100B   82.1     1.1 2.3E-05   29.1   1.9   23    2-24     14-38  (88)
 51 COG5126 FRQ1 Ca2+-binding prot  80.6     1.1 2.4E-05   32.7   1.8   25    2-27     62-86  (160)
 52 cd05025 S-100A1 S-100A1: S-100  80.6     1.3 2.8E-05   28.1   1.9   23    2-24     15-39  (92)
 53 KOG0046 Ca2+-binding actin-bun  79.0     1.6 3.6E-05   37.9   2.5   28    2-29     63-90  (627)
 54 cd05022 S-100A13 S-100A13: S-1  78.5     1.7 3.6E-05   28.4   1.9   23    2-24     14-37  (89)
 55 KOG0041 Predicted Ca2+-binding  78.1     1.3 2.8E-05   34.5   1.5   27    1-27    104-130 (244)
 56 cd05029 S-100A6 S-100A6: S-100  76.2     1.6 3.4E-05   28.2   1.3   23    2-24     16-40  (88)
 57 KOG4223 Reticulocalbin, calume  75.2     1.6 3.4E-05   35.5   1.3   22    2-23    169-190 (325)
 58 cd05023 S-100A11 S-100A11: S-1  74.1     2.6 5.6E-05   27.3   1.9   24    2-25     15-40  (89)
 59 KOG0377 Protein serine/threoni  73.5       2 4.4E-05   37.0   1.6   21    3-23    594-614 (631)
 60 PLN02964 phosphatidylserine de  72.8     2.3 4.9E-05   37.2   1.8   24    2-25    221-244 (644)
 61 PF10591 SPARC_Ca_bdg:  Secrete  70.2    0.57 1.2E-05   31.8  -2.0   22    2-23     60-81  (113)
 62 KOG0028 Ca2+-binding protein (  65.8       4 8.6E-05   30.5   1.6   25    2-26     75-99  (172)
 63 PF01309 EAV_GS:  Equine arteri  64.8      11 0.00025   27.8   3.8   62   21-82     85-159 (196)
 64 PF09546 Spore_III_AE:  Stage I  63.0      24 0.00052   28.2   5.7   67    9-75    165-240 (328)
 65 KOG4251 Calcium binding protei  62.7     1.6 3.4E-05   35.2  -1.1   23    1-23    241-263 (362)
 66 KOG0037 Ca2+-binding protein,   62.3     6.2 0.00013   30.5   2.1   22    3-24    101-122 (221)
 67 PF12174 RST:  RCD1-SRO-TAF4 (R  59.9     4.9 0.00011   25.6   1.0   25    4-28     33-57  (70)
 68 PF05517 p25-alpha:  p25-alpha   58.5     5.2 0.00011   28.4   1.1   23    7-29     52-74  (154)
 69 PF09912 DUF2141:  Uncharacteri  55.6     3.1 6.7E-05   28.1  -0.5   13    5-17     61-73  (112)
 70 KOG3866 DNA-binding protein of  55.6     4.1 8.9E-05   33.8   0.2   21    1-21    301-321 (442)
 71 PF00404 Dockerin_1:  Dockerin   54.5      21 0.00046   17.9   2.7   16    6-21      1-16  (21)
 72 PF06226 DUF1007:  Protein of u  51.6      12 0.00025   27.8   2.0   28    1-28     55-82  (212)
 73 KOG4578 Uncharacterized conser  51.2     9.2  0.0002   31.9   1.5   26    1-26    375-400 (421)
 74 KOG0028 Ca2+-binding protein (  49.4      16 0.00035   27.3   2.5   19    5-23    115-133 (172)
 75 KOG0968 DNA polymerase zeta, c  49.1      11 0.00023   35.9   1.7   46   41-88   1275-1331(1488)
 76 PHA02844 putative transmembran  48.4      18 0.00039   23.7   2.3   17   12-28     17-33  (75)
 77 PF09454 Vps23_core:  Vps23 cor  45.8      37  0.0008   21.1   3.3   21   10-30     37-57  (65)
 78 PF07217 Het-C:  Heterokaryon i  45.1      14  0.0003   32.4   1.7   32   54-85    395-426 (606)
 79 PHA02650 hypothetical protein;  42.7      24 0.00051   23.5   2.2   17   12-28     17-33  (81)
 80 PRK09272 hypothetical protein;  42.6      38 0.00083   23.3   3.3   30   36-69      6-35  (109)
 81 PHA02975 hypothetical protein;  42.3      27 0.00059   22.6   2.4   17   12-28     17-33  (69)
 82 PF06942 GlpM:  GlpM protein;    41.7      24 0.00052   24.5   2.2   46   37-91      3-48  (107)
 83 KOG0751 Mitochondrial aspartat  40.8      20 0.00043   31.5   2.0   25    5-29     83-107 (694)
 84 PHA02692 hypothetical protein;  40.3      20 0.00043   23.2   1.5   15   14-28     19-33  (70)
 85 COG5562 Phage envelope protein  38.9      18 0.00038   26.2   1.2   21    4-24     80-100 (137)
 86 KOG0037 Ca2+-binding protein,   38.7      21 0.00045   27.7   1.7   23    2-24    130-152 (221)
 87 PF12575 DUF3753:  Protein of u  37.5      31 0.00068   22.4   2.1   15   14-28     19-33  (72)
 88 PF10841 DUF2644:  Protein of u  35.4      49  0.0011   20.8   2.7   26    3-28      1-26  (60)
 89 KOG4251 Calcium binding protei  34.8      45 0.00098   27.1   3.1   30    1-30    106-135 (362)
 90 PF09373 PMBR:  Pseudomurein-bi  34.5      55  0.0012   17.5   2.5   17   10-26      2-18  (33)
 91 KOG1029 Endocytic adaptor prot  33.3      55  0.0012   30.3   3.6   18    5-22     58-75  (1118)
 92 KOG3555 Ca2+-binding proteogly  32.6      21 0.00047   29.9   0.9   21    1-21    255-275 (434)
 93 PF00701 DHDPS:  Dihydrodipicol  32.2      46   0.001   25.1   2.6   21    8-28     14-34  (289)
 94 PF06450 NhaB:  Bacterial Na+/H  32.2      92   0.002   26.8   4.6   54    3-58    177-238 (515)
 95 KOG0030 Myosin essential light  32.1      33 0.00072   25.2   1.8   43    2-60     17-59  (152)
 96 COG0329 DapA Dihydrodipicolina  31.8      49  0.0011   25.7   2.8   20    9-28     18-37  (299)
 97 TIGR00774 NhaB Na+/H+ antiport  31.5 1.6E+02  0.0036   25.5   6.0   53    3-55    176-234 (515)
 98 PF13121 DUF3976:  Domain of un  31.3      68  0.0015   18.6   2.6   26    4-29      6-31  (41)
 99 KOG4578 Uncharacterized conser  29.8      44 0.00096   27.9   2.3   27    2-28    339-368 (421)
100 KOG0036 Predicted mitochondria  29.7      40 0.00087   28.7   2.1   22    2-23    124-145 (463)
101 PHA03054 IMV membrane protein;  28.8      59  0.0013   21.2   2.3   17   12-28     17-33  (72)
102 cd00952 CHBPH_aldolase Trans-o  28.5      61  0.0013   25.2   2.8   22    7-28     20-41  (309)
103 cd00408 DHDPS-like Dihydrodipi  28.3      63  0.0014   24.1   2.8   21    8-28     10-30  (281)
104 PF09796 QCR10:  Ubiquinol-cyto  27.5      45 0.00098   21.0   1.6   41   26-69      6-47  (64)
105 KOG0031 Myosin regulatory ligh  27.4      49  0.0011   24.8   2.0   23    4-26     40-62  (171)
106 PF09279 EF-hand_like:  Phospho  27.0      33 0.00072   21.0   0.9   26    2-28      6-31  (83)
107 TIGR00674 dapA dihydrodipicoli  26.6      69  0.0015   24.2   2.8   21    8-28     11-31  (285)
108 PLN02417 dihydrodipicolinate s  26.2      72  0.0016   24.3   2.8   21    8-28     14-34  (280)
109 cd00950 DHDPS Dihydrodipicolin  25.9      74  0.0016   23.8   2.8   21    8-28     13-33  (284)
110 TIGR02313 HpaI-NOT-DapA 2,4-di  25.3      75  0.0016   24.4   2.8   21    8-28     13-33  (294)
111 PF12767 SAGA-Tad1:  Transcript  24.8      95  0.0021   23.4   3.2   33   11-43     40-72  (252)
112 cd00954 NAL N-Acetylneuraminic  24.8      78  0.0017   24.0   2.8   21    8-28     13-33  (288)
113 KOG4004 Matricellular protein   24.2      38 0.00083   26.5   1.0   22    1-22    227-248 (259)
114 PLN00090 photosystem II reacti  24.0 1.7E+02  0.0036   20.4   4.0   46   32-89     40-102 (113)
115 PF14513 DAG_kinase_N:  Diacylg  23.8      59  0.0013   23.2   1.8   34    8-41     44-78  (138)
116 PF10891 DUF2719:  Protein of u  23.6      56  0.0012   21.7   1.5   16   10-25     33-48  (81)
117 PRK03170 dihydrodipicolinate s  23.6      86  0.0019   23.7   2.8   21    8-28     14-34  (292)
118 TIGR02829 spore_III_AE stage I  23.3 1.7E+02  0.0037   24.2   4.6   65   11-75    223-296 (381)
119 KOG4666 Predicted phosphate ac  23.2      60  0.0013   27.2   1.9   24    2-25    337-360 (412)
120 PRK03620 5-dehydro-4-deoxygluc  22.3      93   0.002   24.0   2.8   21    8-28     20-40  (303)
121 PRK04147 N-acetylneuraminate l  22.1      97  0.0021   23.6   2.8   20    8-27     16-35  (293)
122 PHA02819 hypothetical protein;  22.0      67  0.0015   20.9   1.6   17   12-28     17-33  (71)
123 COG3067 NhaB Na+/H+ antiporter  21.8 1.7E+02  0.0037   24.9   4.3   65    3-72    177-250 (516)
124 TIGR03249 KdgD 5-dehydro-4-deo  21.6      98  0.0021   23.6   2.8   21    8-28     18-38  (296)
125 PRK12320 hypothetical protein;  21.5 1.6E+02  0.0034   26.2   4.3   47   15-63    462-508 (699)
126 cd00951 KDGDH 5-dehydro-4-deox  20.1 1.1E+02  0.0024   23.3   2.8   21    8-28     13-33  (289)

No 1  
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=98.55  E-value=4.1e-08  Score=65.88  Aligned_cols=28  Identities=29%  Similarity=0.437  Sum_probs=25.9

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|||+||+.||+.++..
T Consensus        53 im~~LD~n~Dg~vdF~EF~~Lv~~l~~a   80 (91)
T cd05024          53 IMKDLDDCRDGKVGFQSFFSLIAGLLIA   80 (91)
T ss_pred             HHHHhCCCCCCcCcHHHHHHHHHHHHHH
Confidence            5899999999999999999999998765


No 2  
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=98.34  E-value=1.1e-07  Score=51.28  Aligned_cols=25  Identities=40%  Similarity=0.709  Sum_probs=22.2

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      +|+.+|+|+||.|||+||..++.++
T Consensus         5 ~F~~~D~d~dG~I~~~Ef~~~~~~L   29 (29)
T PF00036_consen    5 AFREFDKDGDGKIDFEEFKEMMKKL   29 (29)
T ss_dssp             HHHHHSTTSSSEEEHHHHHHHHHHT
T ss_pred             HHHHHCCCCCCcCCHHHHHHHHHhC
Confidence            3688999999999999999998753


No 3  
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=98.20  E-value=9.2e-07  Score=58.36  Aligned_cols=28  Identities=39%  Similarity=0.576  Sum_probs=25.9

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|||+||+.+|.+++..
T Consensus        52 mi~~~D~d~DG~I~F~EF~~l~~~l~~~   79 (89)
T cd05022          52 KMKNLDVNQDSKLSFEEFWELIGELAKA   79 (89)
T ss_pred             HHHHhCCCCCCCCcHHHHHHHHHHHHHH
Confidence            5789999999999999999999998876


No 4  
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=98.11  E-value=1.8e-06  Score=56.65  Aligned_cols=28  Identities=50%  Similarity=0.781  Sum_probs=25.5

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|+|+||+.+|.+++..
T Consensus        57 ll~~~D~d~DG~I~f~EF~~l~~~l~~~   84 (89)
T cd05023          57 MMKKLDLNSDGQLDFQEFLNLIGGLAVA   84 (89)
T ss_pred             HHHHcCCCCCCcCcHHHHHHHHHHHHHH
Confidence            4789999999999999999999998765


No 5  
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=97.97  E-value=4.7e-06  Score=54.55  Aligned_cols=28  Identities=39%  Similarity=0.609  Sum_probs=25.4

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||.|||+||+.++..++..
T Consensus        58 i~~elD~n~dG~Idf~EF~~l~~~l~~~   85 (93)
T cd05026          58 IMNDLDSNKDNEVDFNEFVVLVAALTVA   85 (93)
T ss_pred             HHHHhCCCCCCCCCHHHHHHHHHHHHHH
Confidence            4789999999999999999999998765


No 6  
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=97.92  E-value=3.8e-06  Score=43.80  Aligned_cols=21  Identities=29%  Similarity=0.657  Sum_probs=19.3

Q ss_pred             cccccccCCCCcCHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi   22 (92)
                      |+.+|.|+||.|+++||.+++
T Consensus         5 F~~~D~d~DG~is~~E~~~~~   25 (25)
T PF13202_consen    5 FQQFDTDGDGKISFEEFQRLV   25 (25)
T ss_dssp             HHHHTTTSSSEEEHHHHHHHH
T ss_pred             HHHHcCCCCCcCCHHHHHHHC
Confidence            678999999999999999875


No 7  
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=97.74  E-value=2e-05  Score=51.53  Aligned_cols=28  Identities=32%  Similarity=0.547  Sum_probs=25.4

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||.|+|+||+.++.+++..
T Consensus        56 m~~~~D~d~dG~Idf~EFv~lm~~l~~~   83 (88)
T cd05029          56 LMEDLDRNKDQEVNFQEYVTFLGALALI   83 (88)
T ss_pred             HHHHhcCCCCCCCcHHHHHHHHHHHHHH
Confidence            4789999999999999999999998765


No 8  
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=97.64  E-value=3.5e-05  Score=50.33  Aligned_cols=28  Identities=36%  Similarity=0.612  Sum_probs=24.7

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||.|+|+||+.++...+..
T Consensus        56 ~i~~~D~n~dG~v~f~eF~~li~~~~~~   83 (88)
T cd05027          56 VMETLDSDGDGECDFQEFMAFVAMVTTA   83 (88)
T ss_pred             HHHHhCCCCCCcCcHHHHHHHHHHHHHH
Confidence            4788999999999999999999887654


No 9  
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=97.43  E-value=9.3e-05  Score=47.62  Aligned_cols=28  Identities=50%  Similarity=0.695  Sum_probs=25.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||.|+|+||+.++..++..
T Consensus        57 i~~~~D~d~~G~I~f~eF~~l~~~~~~~   84 (92)
T cd05025          57 IMKELDENGDGEVDFQEFVVLVAALTVA   84 (92)
T ss_pred             HHHHHCCCCCCcCcHHHHHHHHHHHHHH
Confidence            4788999999999999999999987765


No 10 
>PF13833 EF-hand_8:  EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A ....
Probab=97.41  E-value=6.4e-05  Score=43.64  Aligned_cols=24  Identities=29%  Similarity=0.679  Sum_probs=21.3

Q ss_pred             CcccccccCCCCcCHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      +++.+|.|+||.|+|+||+.++..
T Consensus        30 l~~~~D~~~~G~I~~~EF~~~~~~   53 (54)
T PF13833_consen   30 LFREFDTDGDGYISFDEFISMMQR   53 (54)
T ss_dssp             HHHHHTTSSSSSEEHHHHHHHHHH
T ss_pred             HHHhcccCCCCCCCHHHHHHHHHh
Confidence            367899999999999999999864


No 11 
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=97.40  E-value=5e-05  Score=45.33  Aligned_cols=21  Identities=33%  Similarity=0.771  Sum_probs=18.7

Q ss_pred             cccccccCCCCcCHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi   22 (92)
                      ++.+|+|+||.|+|+||..++
T Consensus        46 ~~~~D~d~dG~i~~~Ef~~~~   66 (66)
T PF13499_consen   46 FREFDTDGDGRISFDEFLNFM   66 (66)
T ss_dssp             HHHHTTTSSSSEEHHHHHHHH
T ss_pred             HHHhCCCCcCCCcHHHHhccC
Confidence            678899999999999999875


No 12 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=97.39  E-value=0.00012  Score=47.36  Aligned_cols=28  Identities=32%  Similarity=0.591  Sum_probs=24.5

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+.+|.|+||.|+|+||+.++..++..
T Consensus        56 i~~~~D~d~dG~I~f~eF~~~~~~~~~~   83 (88)
T cd05030          56 IFEDLDTNQDGQLSFEEFLVLVIKVGVA   83 (88)
T ss_pred             HHHHcCCCCCCcCcHHHHHHHHHHHHHH
Confidence            4778999999999999999999887554


No 13 
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=97.18  E-value=0.00013  Score=38.81  Aligned_cols=23  Identities=35%  Similarity=0.472  Sum_probs=20.1

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++.+|.|+||.|+++||..++.+
T Consensus         6 F~~~D~d~dG~I~~~el~~~l~~   28 (31)
T PF13405_consen    6 FKMFDKDGDGFIDFEELRAILRK   28 (31)
T ss_dssp             HHHH-TTSSSEEEHHHHHHHHHH
T ss_pred             HHHHCCCCCCcCcHHHHHHHHHH
Confidence            67899999999999999999974


No 14 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=96.94  E-value=0.00056  Score=44.22  Aligned_cols=27  Identities=41%  Similarity=0.710  Sum_probs=23.3

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~   27 (92)
                      +|+++|.|+||.|+|+||+.++.....
T Consensus        56 ~~~~~D~~~dg~I~f~eF~~l~~~~~~   82 (94)
T cd05031          56 IMKDLDQNRDGKVNFEEFVSLVAGLSI   82 (94)
T ss_pred             HHHHhCCCCCCcCcHHHHHHHHHHHHH
Confidence            467899999999999999999976543


No 15 
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=96.93  E-value=0.00041  Score=33.18  Aligned_cols=24  Identities=29%  Similarity=0.545  Sum_probs=21.1

Q ss_pred             CcccccccCCCCcCHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      +++.+|.|++|.|+++||..++..
T Consensus         5 ~f~~~d~~~~g~i~~~e~~~~~~~   28 (29)
T smart00054        5 AFRLFDKDGDGKIDFEEFKDLLKA   28 (29)
T ss_pred             HHHHHCCCCCCcEeHHHHHHHHHh
Confidence            367899999999999999999864


No 16 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=96.63  E-value=0.0017  Score=38.09  Aligned_cols=24  Identities=33%  Similarity=0.512  Sum_probs=14.2

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|+||.|+|+||+.++...
T Consensus        39 ~~~~d~~~~g~i~~~ef~~~~~~~   62 (67)
T cd00052          39 WDLADTDKDGKLDKEEFAIAMHLI   62 (67)
T ss_pred             HHHhcCCCCCcCCHHHHHHHHHHH
Confidence            445566666666666666655443


No 17 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=96.60  E-value=0.0016  Score=41.07  Aligned_cols=28  Identities=43%  Similarity=0.740  Sum_probs=24.7

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+.+|.|+||.|+|+||+.++...+..
T Consensus        56 i~~~~d~~~~g~I~f~eF~~~~~~~~~~   83 (88)
T cd00213          56 IMKDLDVNKDGKVDFQEFLVLIGKLAVA   83 (88)
T ss_pred             HHHHhccCCCCcCcHHHHHHHHHHHHHH
Confidence            4678999999999999999999887664


No 18 
>PF14788 EF-hand_10:  EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A ....
Probab=96.46  E-value=0.001  Score=40.68  Aligned_cols=26  Identities=42%  Similarity=0.848  Sum_probs=22.3

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLT   26 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~   26 (92)
                      ++++||++++|.++.+||.+|...+|
T Consensus        26 LFq~~D~s~~g~Le~~Ef~~Fy~~LT   51 (51)
T PF14788_consen   26 LFQECDKSQSGRLEGEEFEEFYKRLT   51 (51)
T ss_dssp             HHHHH-SSSSSEBEHHHHHHHHHHHS
T ss_pred             HHHHhcccCCCCccHHHHHHHHHHhC
Confidence            47899999999999999999988764


No 19 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=96.27  E-value=0.0021  Score=44.26  Aligned_cols=22  Identities=27%  Similarity=0.694  Sum_probs=20.0

Q ss_pred             CcccccccCCCCcCHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi   22 (92)
                      +|+.+|.|+||.|+++||...+
T Consensus        85 f~~~~D~n~Dg~IS~~Ef~~cl  106 (116)
T cd00252          85 FFESCDLDKDGSISLDEWCYCF  106 (116)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHH
Confidence            3678999999999999999988


No 20 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=96.11  E-value=0.0044  Score=40.04  Aligned_cols=28  Identities=29%  Similarity=0.509  Sum_probs=21.9

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +++.+|.|+||.|+|+||+.++..+...
T Consensus        49 i~~~~d~~~~g~I~~~eF~~~~~~~~~~   76 (96)
T smart00027       49 IWNLADIDNDGELDKDEFALAMHLIYRK   76 (96)
T ss_pred             HHHHhcCCCCCCcCHHHHHHHHHHHHHH
Confidence            3567888888888888888888776655


No 21 
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]
Probab=95.94  E-value=0.0035  Score=46.50  Aligned_cols=24  Identities=38%  Similarity=0.663  Sum_probs=22.0

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      |++.|.++||.|+||||..++.+.
T Consensus       153 ~~e~D~d~DG~IsfeEf~~~v~~~  176 (187)
T KOG0034|consen  153 FEEADTDGDGKISFEEFCKVVEKQ  176 (187)
T ss_pred             HHHhCCCCCCcCcHHHHHHHHHcC
Confidence            689999999999999999999764


No 22 
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=95.78  E-value=0.0046  Score=34.00  Aligned_cols=21  Identities=38%  Similarity=0.806  Sum_probs=13.4

Q ss_pred             cccccccCCCCcCHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi   22 (92)
                      ++.+|.|+||.|+++||..++
T Consensus        42 ~~~~~~~~~~~l~~~ef~~~~   62 (63)
T cd00051          42 IREVDKDGDGKIDFEEFLELM   62 (63)
T ss_pred             HHHhCCCCCCeEeHHHHHHHh
Confidence            455666666777777766554


No 23 
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=95.72  E-value=0.0056  Score=42.35  Aligned_cols=27  Identities=44%  Similarity=0.804  Sum_probs=23.7

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~   27 (92)
                      +++++|.|+||.|+|+||..++.+...
T Consensus        49 ~~~~~D~dg~g~I~~~eF~~l~~~~~~   75 (151)
T KOG0027|consen   49 LIKEIDLDGDGTIDFEEFLDLMEKLGE   75 (151)
T ss_pred             HHHHhCCCCCCeEcHHHHHHHHHhhhc
Confidence            468899999999999999999987654


No 24 
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=95.59  E-value=0.0039  Score=37.00  Aligned_cols=26  Identities=27%  Similarity=0.428  Sum_probs=23.3

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~   27 (92)
                      ++.+|+|+||.|+.+||..++..+..
T Consensus         6 F~~~D~d~~G~i~~~el~~~~~~~~~   31 (66)
T PF13499_consen    6 FKKFDKDGDGYISKEELRRALKHLGR   31 (66)
T ss_dssp             HHHHSTTSSSEEEHHHHHHHHHHTTS
T ss_pred             HHHHcCCccCCCCHHHHHHHHHHhcc
Confidence            67899999999999999999988754


No 25 
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=95.07  E-value=0.017  Score=31.57  Aligned_cols=24  Identities=21%  Similarity=0.378  Sum_probs=21.5

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|++|.++++||..++...
T Consensus         6 f~~~d~~~~g~l~~~e~~~~l~~~   29 (63)
T cd00051           6 FRLFDKDGDGTISADELKAALKSL   29 (63)
T ss_pred             HHHhCCCCCCcCcHHHHHHHHHHh
Confidence            567899999999999999999765


No 26 
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=94.39  E-value=0.019  Score=46.35  Aligned_cols=23  Identities=30%  Similarity=0.499  Sum_probs=19.9

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      |++.|+|+||.|+++||+.=+..
T Consensus       206 l~d~Dkn~DG~I~~eEfigd~~~  228 (325)
T KOG4223|consen  206 LEDIDKNGDGKISLEEFIGDLYS  228 (325)
T ss_pred             HhhcccCCCCceeHHHHHhHHhh
Confidence            67899999999999999876644


No 27 
>PTZ00183 centrin; Provisional
Probab=94.01  E-value=0.034  Score=37.13  Aligned_cols=24  Identities=29%  Similarity=0.584  Sum_probs=19.5

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|+||.|+|+||+.++...
T Consensus        59 ~~~~d~~~~g~i~~~eF~~~~~~~   82 (158)
T PTZ00183         59 IADVDKDGSGKIDFEEFLDIMTKK   82 (158)
T ss_pred             HHHhCCCCCCcEeHHHHHHHHHHH
Confidence            567888999999999998887653


No 28 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=93.97  E-value=0.039  Score=32.10  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=21.1

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|+||.|+.+|+..++.+.
T Consensus         5 F~~~D~~~~G~i~~~el~~~l~~~   28 (67)
T cd00052           5 FRSLDPDGDGLISGDEARPFLGKS   28 (67)
T ss_pred             HHHhCCCCCCcCcHHHHHHHHHHc
Confidence            567999999999999999998653


No 29 
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=93.80  E-value=0.039  Score=41.33  Aligned_cols=23  Identities=30%  Similarity=0.479  Sum_probs=13.3

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++..|+|+||.|+|+||+.-+..
T Consensus        70 F~~fD~~~dg~i~F~Efi~als~   92 (193)
T KOG0044|consen   70 FRTFDKNKDGTIDFLEFICALSL   92 (193)
T ss_pred             HHHhcccCCCCcCHHHHHHHHHH
Confidence            34556666666666665555543


No 30 
>PTZ00184 calmodulin; Provisional
Probab=93.64  E-value=0.051  Score=35.59  Aligned_cols=24  Identities=25%  Similarity=0.573  Sum_probs=19.0

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|+||.++|+||+.++...
T Consensus        53 ~~~~d~~~~g~i~~~ef~~~l~~~   76 (149)
T PTZ00184         53 INEVDADGNGTIDFPEFLTLMARK   76 (149)
T ss_pred             HHhcCcCCCCcCcHHHHHHHHHHh
Confidence            456788888888888888887654


No 31 
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=93.03  E-value=0.049  Score=40.78  Aligned_cols=24  Identities=33%  Similarity=0.511  Sum_probs=21.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      +++++|.|+||+++++||++....
T Consensus       152 if~k~D~n~Dg~lT~eef~~~~~~  175 (193)
T KOG0044|consen  152 IFSKMDKNKDGKLTLEEFIEGCKA  175 (193)
T ss_pred             HHHHcCCCCCCcccHHHHHHHhhh
Confidence            468899999999999999988654


No 32 
>PTZ00184 calmodulin; Provisional
Probab=91.67  E-value=0.15  Score=33.29  Aligned_cols=24  Identities=21%  Similarity=0.335  Sum_probs=20.8

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|++|.|+++||..++..+
T Consensus        17 F~~~D~~~~G~i~~~e~~~~l~~~   40 (149)
T PTZ00184         17 FSLFDKDGDGTITTKELGTVMRSL   40 (149)
T ss_pred             HHHHcCCCCCcCCHHHHHHHHHHh
Confidence            567899999999999999988653


No 33 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=91.45  E-value=0.14  Score=32.88  Aligned_cols=23  Identities=22%  Similarity=0.319  Sum_probs=20.9

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++.+|.|+||.|+++|+..++..
T Consensus        16 F~~~D~d~~G~Is~~el~~~l~~   38 (96)
T smart00027       16 FRSLDKNQDGTVTGAQAKPILLK   38 (96)
T ss_pred             HHHhCCCCCCeEeHHHHHHHHHH
Confidence            56799999999999999999866


No 34 
>PTZ00183 centrin; Provisional
Probab=91.35  E-value=0.14  Score=34.14  Aligned_cols=24  Identities=13%  Similarity=0.304  Sum_probs=21.0

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      ++.+|.|++|.|+++||..++..+
T Consensus        96 F~~~D~~~~G~i~~~e~~~~l~~~  119 (158)
T PTZ00183         96 FRLFDDDKTGKISLKNLKRVAKEL  119 (158)
T ss_pred             HHHhCCCCCCcCcHHHHHHHHHHh
Confidence            678999999999999999998654


No 35 
>PLN02964 phosphatidylserine decarboxylase
Probab=90.51  E-value=0.14  Score=44.38  Aligned_cols=25  Identities=28%  Similarity=0.575  Sum_probs=21.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      +|+.+|.|+||.|+|+||+.++..+
T Consensus       184 mf~~~D~DgdG~IdfdEFl~lL~~l  208 (644)
T PLN02964        184 ILAIVDYDEDGQLSFSEFSDLIKAF  208 (644)
T ss_pred             HHHHhCCCCCCeEcHHHHHHHHHHh
Confidence            3577899999999999999988764


No 36 
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]
Probab=90.23  E-value=0.18  Score=42.43  Aligned_cols=28  Identities=25%  Similarity=0.531  Sum_probs=23.6

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +++.+|.|.||.+||+||.+++...-.+
T Consensus        56 l~~~~d~~~dg~vDy~eF~~Y~~~~E~~   83 (463)
T KOG0036|consen   56 LFSAMDANRDGRVDYSEFKRYLDNKELE   83 (463)
T ss_pred             HHHhcccCcCCcccHHHHHHHHHHhHHH
Confidence            3678999999999999999999764444


No 37 
>PF12763 EF-hand_4:  Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A ....
Probab=89.26  E-value=0.21  Score=33.77  Aligned_cols=21  Identities=38%  Similarity=0.634  Sum_probs=16.8

Q ss_pred             ccccccCCCCcCHHHHHHHHH
Q 034525            3 KECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         3 k~lD~N~DgeIdfeEF~~fi~   23 (92)
                      +-+|.|+||.+|++||..-|.
T Consensus        50 ~LaD~~~dG~L~~~EF~iAm~   70 (104)
T PF12763_consen   50 NLADIDNDGKLDFEEFAIAMH   70 (104)
T ss_dssp             HHH-SSSSSEEEHHHHHHHHH
T ss_pred             hhhcCCCCCcCCHHHHHHHHH
Confidence            347999999999999987663


No 38 
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=88.34  E-value=0.39  Score=33.11  Aligned_cols=27  Identities=22%  Similarity=0.320  Sum_probs=17.8

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      ++.+|.|+||.|+.+|+..++..+-.+
T Consensus        91 F~~fD~d~~G~Is~~el~~~l~~lg~~  117 (151)
T KOG0027|consen   91 FRVFDKDGDGFISASELKKVLTSLGEK  117 (151)
T ss_pred             HHHHccCCCCcCcHHHHHHHHHHhCCc
Confidence            345677777777777777777665444


No 39 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=88.19  E-value=0.28  Score=33.73  Aligned_cols=21  Identities=33%  Similarity=0.537  Sum_probs=18.8

Q ss_pred             cccccccCCCCcCHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi   22 (92)
                      ++.+|.|+||.|+.+|...+.
T Consensus        54 F~~lD~d~DG~Ls~~EL~~~~   74 (116)
T cd00252          54 FNQLDGNYDGKLSHHELAPIR   74 (116)
T ss_pred             HHHHCCCCCCcCCHHHHHHHH
Confidence            678999999999999999774


No 40 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=87.12  E-value=0.48  Score=29.65  Aligned_cols=23  Identities=9%  Similarity=0.203  Sum_probs=20.5

Q ss_pred             cccccc--cCCCCcCHHHHHHHHHH
Q 034525            2 MKECDL--NLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~--N~DgeIdfeEF~~fi~~   24 (92)
                      ++.+|+  |+||.|+++||..++..
T Consensus        14 F~~~D~~~~~~G~Is~~el~~~l~~   38 (88)
T cd00213          14 FHKYSGKEGDKDTLSKKELKELLET   38 (88)
T ss_pred             HHHHhhccCCCCcCcHHHHHHHHHH
Confidence            567899  89999999999999975


No 41 
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]
Probab=87.10  E-value=0.55  Score=34.87  Aligned_cols=27  Identities=22%  Similarity=0.476  Sum_probs=23.9

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      ++-||.|+||-|+++|+...+..+...
T Consensus       110 F~vYD~~~~G~I~reel~~iv~~~~~~  136 (187)
T KOG0034|consen  110 FRVYDLDGDGFISREELKQILRMMVGE  136 (187)
T ss_pred             HHHhcCCCCCcCcHHHHHHHHHHHHcc
Confidence            466999999999999999999988774


No 42 
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]
Probab=85.96  E-value=0.42  Score=37.13  Aligned_cols=26  Identities=38%  Similarity=0.685  Sum_probs=18.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLT   26 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~   26 (92)
                      ||++.|.|.||.|+|.||+-..++..
T Consensus       140 mikeVded~dgklSfreflLIfrkaa  165 (244)
T KOG0041|consen  140 MIKEVDEDFDGKLSFREFLLIFRKAA  165 (244)
T ss_pred             HHHHhhcccccchhHHHHHHHHHHHh
Confidence            46777777777777777776655533


No 43 
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]
Probab=85.06  E-value=0.54  Score=35.16  Aligned_cols=24  Identities=38%  Similarity=0.657  Sum_probs=21.1

Q ss_pred             CcccccccCCCCcCHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++++.|.|+||.++|.||-.+|.+
T Consensus       154 vieEAD~DgDgkl~~~eFe~~i~r  177 (189)
T KOG0038|consen  154 VIEEADLDGDGKLSFAEFEHVILR  177 (189)
T ss_pred             HHHHhcCCCCCcccHHHHHHHHHh
Confidence            367899999999999999998864


No 44 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=84.46  E-value=0.63  Score=30.13  Aligned_cols=24  Identities=17%  Similarity=0.214  Sum_probs=20.1

Q ss_pred             ccccc-ccCCCC-cCHHHHHHHHHHH
Q 034525            2 MKECD-LNLDGE-LDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD-~N~Dge-IdfeEF~~fi~~l   25 (92)
                      |+.+| .|+||. |+.+|+..++.+.
T Consensus        16 F~~~dd~dgdg~~Is~~EL~~ll~~~   41 (93)
T cd05026          16 FHNYSGKEGDRYKLSKGELKELLQRE   41 (93)
T ss_pred             HHHHHccCCCCCEECHHHHHHHHHHH
Confidence            56778 789985 9999999999763


No 45 
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]
Probab=84.39  E-value=0.82  Score=38.79  Aligned_cols=27  Identities=30%  Similarity=0.486  Sum_probs=23.4

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +.-.|.|+||.++++||+..|.+....
T Consensus       431 F~IFD~N~Dg~LS~~EFl~Vmk~Rmhr  457 (489)
T KOG2643|consen  431 FTIFDENNDGTLSHKEFLAVMKRRMHR  457 (489)
T ss_pred             EEEEccCCCCcccHHHHHHHHHHHhhc
Confidence            455799999999999999999887665


No 46 
>PF14658 EF-hand_9:  EF-hand domain
Probab=84.31  E-value=0.67  Score=29.51  Aligned_cols=24  Identities=17%  Similarity=0.425  Sum_probs=20.3

Q ss_pred             cccccccCC-CCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLD-GELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~D-geIdfeEF~~fi~~l   25 (92)
                      .+++|-|+. |+++|+.|...|+++
T Consensus        41 ~~elDP~g~~~~v~~d~F~~iM~~w   65 (66)
T PF14658_consen   41 INELDPEGRDGSVNFDTFLAIMRDW   65 (66)
T ss_pred             HHHhCCCCCCceEeHHHHHHHHHHh
Confidence            467888877 999999999999875


No 47 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=83.80  E-value=0.79  Score=29.31  Aligned_cols=23  Identities=17%  Similarity=0.274  Sum_probs=19.8

Q ss_pred             cccccc-cC-CCCcCHHHHHHHHHH
Q 034525            2 MKECDL-NL-DGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~-N~-DgeIdfeEF~~fi~~   24 (92)
                      ++.+|. |+ ||.|+.+|+..++..
T Consensus        14 F~~~D~~dg~dG~Is~~El~~~l~~   38 (94)
T cd05031          14 FHRYAGKDGDKNTLSRKELKKLMEK   38 (94)
T ss_pred             HHHHhccCCCCCeECHHHHHHHHHH
Confidence            567887 97 699999999999875


No 48 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=82.76  E-value=0.88  Score=37.25  Aligned_cols=17  Identities=35%  Similarity=0.575  Sum_probs=8.5

Q ss_pred             ccccccCCCCcCHHHHH
Q 034525            3 KECDLNLDGELDHEEFV   19 (92)
Q Consensus         3 k~lD~N~DgeIdfeEF~   19 (92)
                      +-+|.|+||.|+++||+
T Consensus       341 ~~~D~dgdG~Is~~E~~  357 (391)
T PRK12309        341 RLYDLDGDGFITREEWL  357 (391)
T ss_pred             HHhCCCCCCcCcHHHHH
Confidence            34455555555555553


No 49 
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]
Probab=82.28  E-value=1.2  Score=37.72  Aligned_cols=23  Identities=43%  Similarity=0.583  Sum_probs=19.1

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++-+|.|+||+||.|||.....-
T Consensus       239 FKMFD~dgnG~IdkeEF~~v~~l  261 (489)
T KOG2643|consen  239 FKMFDLDGNGEIDKEEFETVQQL  261 (489)
T ss_pred             eeeeecCCCCcccHHHHHHHHHH
Confidence            46689999999999999876643


No 50 
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=82.08  E-value=1.1  Score=29.07  Aligned_cols=23  Identities=17%  Similarity=0.304  Sum_probs=20.4

Q ss_pred             ccccc-ccCCC-CcCHHHHHHHHHH
Q 034525            2 MKECD-LNLDG-ELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD-~N~Dg-eIdfeEF~~fi~~   24 (92)
                      ++.+| .|+|| .|+.+|+..++..
T Consensus        14 F~~fD~~dgdG~~I~~~eL~~ll~~   38 (88)
T cd05027          14 FHQYSGREGDKHKLKKSELKELINN   38 (88)
T ss_pred             HHHhcccCCCcCEECHHHHHHHHHH
Confidence            56787 79999 5999999999987


No 51 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=80.63  E-value=1.1  Score=32.72  Aligned_cols=25  Identities=20%  Similarity=0.294  Sum_probs=18.0

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~   27 (92)
                      |++.|. +.+.|+|+||+.+|.....
T Consensus        62 ~~~~d~-~~~~idf~~Fl~~ms~~~~   86 (160)
T COG5126          62 FEEIDA-GNETVDFPEFLTVMSVKLK   86 (160)
T ss_pred             HHhccC-CCCccCHHHHHHHHHHHhc
Confidence            556666 6678888888888877663


No 52 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=80.58  E-value=1.3  Score=28.14  Aligned_cols=23  Identities=17%  Similarity=0.276  Sum_probs=19.8

Q ss_pred             ccccc-ccCCC-CcCHHHHHHHHHH
Q 034525            2 MKECD-LNLDG-ELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD-~N~Dg-eIdfeEF~~fi~~   24 (92)
                      ++.+| .|+|| .|+.+|+..++..
T Consensus        15 F~~fDd~dg~G~~Is~~El~~~l~~   39 (92)
T cd05025          15 FHAHSGKEGDKYKLSKKELKDLLQT   39 (92)
T ss_pred             HHHHhcccCCCCeECHHHHHHHHHH
Confidence            56786 99999 5999999999975


No 53 
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]
Probab=78.97  E-value=1.6  Score=37.88  Aligned_cols=28  Identities=32%  Similarity=0.582  Sum_probs=23.5

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhhH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSDT   29 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~~   29 (92)
                      +.+.+.|.||+++||||+.....+...+
T Consensus        63 l~~~~~~~~g~v~fe~f~~~~~~l~s~~   90 (627)
T KOG0046|consen   63 LGEVGVDADGRVEFEEFVGIFLNLKSKD   90 (627)
T ss_pred             HhccCCCcCCccCHHHHHHHHHhhhhhh
Confidence            5778999999999999999776666663


No 54 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=78.46  E-value=1.7  Score=28.45  Aligned_cols=23  Identities=13%  Similarity=0.322  Sum_probs=21.2

Q ss_pred             cccccc-cCCCCcCHHHHHHHHHH
Q 034525            2 MKECDL-NLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~-N~DgeIdfeEF~~fi~~   24 (92)
                      |+.+|. +++|.|+.+||..++.+
T Consensus        14 F~~fd~~~~~g~i~~~ELk~ll~~   37 (89)
T cd05022          14 FHKASVKGGKESLTASEFQELLTQ   37 (89)
T ss_pred             HHHHhCCCCCCeECHHHHHHHHHH
Confidence            577899 99999999999999987


No 55 
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]
Probab=78.13  E-value=1.3  Score=34.50  Aligned_cols=27  Identities=33%  Similarity=0.529  Sum_probs=23.5

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~   27 (92)
                      +++.||.+.||=||+.|--.||.++-.
T Consensus       104 ~Fk~yDe~rDgfIdl~ELK~mmEKLga  130 (244)
T KOG0041|consen  104 MFKQYDEDRDGFIDLMELKRMMEKLGA  130 (244)
T ss_pred             HHHHhcccccccccHHHHHHHHHHhCC
Confidence            478999999999999999999887643


No 56 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=76.21  E-value=1.6  Score=28.24  Aligned_cols=23  Identities=22%  Similarity=0.286  Sum_probs=19.8

Q ss_pred             cccccc-cC-CCCcCHHHHHHHHHH
Q 034525            2 MKECDL-NL-DGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~-N~-DgeIdfeEF~~fi~~   24 (92)
                      |..||. |+ +|.|+.+||..++.+
T Consensus        16 F~~y~~~~~~~g~Is~~EL~~~l~~   40 (88)
T cd05029          16 FHKYSGREGDKNTLSKKELKELIQK   40 (88)
T ss_pred             HHHHHccCCCCCEECHHHHHHHHHH
Confidence            567887 77 899999999999964


No 57 
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=75.18  E-value=1.6  Score=35.49  Aligned_cols=22  Identities=41%  Similarity=0.676  Sum_probs=19.6

Q ss_pred             cccccccCCCCcCHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~   23 (92)
                      ++.-|.|+||.++.+||..|+-
T Consensus       169 Fk~AD~d~dg~lt~EEF~aFLH  190 (325)
T KOG4223|consen  169 FKAADQDGDGSLTLEEFTAFLH  190 (325)
T ss_pred             HhhcccCCCCcccHHHHHhccC
Confidence            5678999999999999999874


No 58 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=74.06  E-value=2.6  Score=27.35  Aligned_cols=24  Identities=21%  Similarity=0.451  Sum_probs=19.8

Q ss_pred             ccc-ccccCCC-CcCHHHHHHHHHHH
Q 034525            2 MKE-CDLNLDG-ELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~-lD~N~Dg-eIdfeEF~~fi~~l   25 (92)
                      ++. .|.|+|+ .|+.+||..++.+.
T Consensus        15 F~~y~~~dg~~~~Ls~~Elk~ll~~e   40 (89)
T cd05023          15 FQKYAGKDGDSYQLSKTEFLSFMNTE   40 (89)
T ss_pred             HHHHhccCCCcCeECHHHHHHHHHHh
Confidence            345 5788886 99999999999886


No 59 
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]
Probab=73.49  E-value=2  Score=37.02  Aligned_cols=21  Identities=38%  Similarity=0.718  Sum_probs=17.7

Q ss_pred             ccccccCCCCcCHHHHHHHHH
Q 034525            3 KECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         3 k~lD~N~DgeIdfeEF~~fi~   23 (92)
                      +..|-|+||.||+.||++-.+
T Consensus       594 ~~mD~NkDG~IDlNEfLeAFr  614 (631)
T KOG0377|consen  594 RSMDLNKDGKIDLNEFLEAFR  614 (631)
T ss_pred             HhhccCCCCcccHHHHHHHHh
Confidence            356999999999999998653


No 60 
>PLN02964 phosphatidylserine decarboxylase
Probab=72.76  E-value=2.3  Score=37.18  Aligned_cols=24  Identities=29%  Similarity=0.436  Sum_probs=21.9

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      |+.+|.|+||.|+++||..++...
T Consensus       221 Fk~fDkDgdG~Is~dEL~~vL~~~  244 (644)
T PLN02964        221 FKAADLNGDGVVTIDELAALLALQ  244 (644)
T ss_pred             HHHhCCCCCCcCCHHHHHHHHHhc
Confidence            678999999999999999999884


No 61 
>PF10591 SPARC_Ca_bdg:  Secreted protein acidic and rich in cysteine Ca binding region;  InterPro: IPR019577  This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.
Probab=70.23  E-value=0.57  Score=31.83  Aligned_cols=22  Identities=32%  Similarity=0.403  Sum_probs=12.5

Q ss_pred             cccccccCCCCcCHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~   23 (92)
                      |.++|.|+||.++..|...+-.
T Consensus        60 F~~LD~n~d~~L~~~El~~l~~   81 (113)
T PF10591_consen   60 FCQLDRNKDGVLDRSELKPLRR   81 (113)
T ss_dssp             HHHH--T-SSEE-TTTTGGGGS
T ss_pred             HhhhcCCCCCccCHHHHHHHHH
Confidence            4577888888888777766544


No 62 
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]
Probab=65.77  E-value=4  Score=30.52  Aligned_cols=25  Identities=16%  Similarity=0.357  Sum_probs=18.8

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLT   26 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~   26 (92)
                      +.+.|+++-|.|+|++|...+....
T Consensus        75 l~d~dk~~~g~i~fe~f~~~mt~k~   99 (172)
T KOG0028|consen   75 LADVDKEGSGKITFEDFRRVMTVKL   99 (172)
T ss_pred             HHhhhhccCceechHHHHHHHHHHH
Confidence            5577888888888888888876543


No 63 
>PF01309 EAV_GS:  Equine arteritis virus small envelope glycoprotein ;  InterPro: IPR001913  Equine arteritis virus small envelope glycoprotein (GS) is a class I transmembrane protein which adopts a number of different conformations [, ].
Probab=64.79  E-value=11  Score=27.80  Aligned_cols=62  Identities=37%  Similarity=0.400  Sum_probs=43.4

Q ss_pred             HHHHHHhhHHHHhhhhhhh-------hhhhhhh------HHHhhhhccCCCCccchhhhhcCchhHHHHHHHHHH
Q 034525           21 FIQKLTSDTFIVVSQGLLI-------TLVVAPT------VAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVV   82 (92)
Q Consensus        21 fi~~l~~~~~~~~~~~~li-------~~~aaP~------~A~~aKra~e~VP~vg~~v~~vP~~v~~~~~T~~~v   82 (92)
                      ||...-...++.++++++.       -.+++|+      +|-++-.|+-.||-+|.+--....++|++++-.++-
T Consensus        85 finayrqailsqysqellleainckllavvapalyhnyhlanltgpatwvvptvgqlhyyasssifassvevlaa  159 (196)
T PF01309_consen   85 FINAYRQAILSQYSQELLLEAINCKLLAVVAPALYHNYHLANLTGPATWVVPTVGQLHYYASSSIFASSVEVLAA  159 (196)
T ss_pred             HHHHHHHHHHHhccHHHHHHHhccchhhhhhHHHHhhhhhhccCCCceEEecccceeeeeehhhHHHHHHHHHHH
Confidence            3333333334556666654       2356776      367788999999999998888899999998876554


No 64 
>PF09546 Spore_III_AE:  Stage III sporulation protein AE (spore_III_AE);  InterPro: IPR014194 This entry represents the stage III sporulation protein AE, which is encoded in a spore formation operon spoIIIAABCDEFGH under the control of sigma G []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. 
Probab=62.97  E-value=24  Score=28.16  Aligned_cols=67  Identities=19%  Similarity=0.291  Sum_probs=45.0

Q ss_pred             CCCCcCHHHHHHHHHHHHhhH---H-HHhhhhhhhhhhhhhhHHHhh----h-hccCCCCccchhhhhcCchhHHH
Q 034525            9 LDGELDHEEFVKFIQKLTSDT---F-IVVSQGLLITLVVAPTVAMAT----K-RATEGVPHVGKVVQRVPNSIYAS   75 (92)
Q Consensus         9 ~DgeIdfeEF~~fi~~l~~~~---~-~~~~~~~li~~~aaP~~A~~a----K-ra~e~VP~vg~~v~~vP~~v~~~   75 (92)
                      =.+|..+.+..+++++...-.   + ...---..|=++++|.+=-++    | +.++-+|++|+.+...=+.+.-+
T Consensus       165 is~e~~ls~la~ll~~~~~w~l~~~ltvf~Gi~~iqg~~~~~~D~v~~rtak~~~~~~IPvVG~~~sda~~~v~g~  240 (328)
T PF09546_consen  165 ISKEFKLSKLAELLKKVILWSLGTMLTVFVGILTIQGMIAPAADGVKLRTAKFATGNFIPVVGKALSDAAETVLGS  240 (328)
T ss_pred             cCccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHcCCCcccHHHHHHHHHHHHH
Confidence            346778888888887765553   2 223344445677888875555    3 44689999999988777666544


No 65 
>KOG4251 consensus Calcium binding protein [General function prediction only]
Probab=62.73  E-value=1.6  Score=35.24  Aligned_cols=23  Identities=22%  Similarity=0.406  Sum_probs=20.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~   23 (92)
                      +|.+||+|+|.+++-.||+.++-
T Consensus       241 ivrdlDqdgDkqlSvpeFislpv  263 (362)
T KOG4251|consen  241 IVRDLDQDGDKQLSVPEFISLPV  263 (362)
T ss_pred             HHHHhccCCCeeecchhhhcCCC
Confidence            46789999999999999998764


No 66 
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=62.29  E-value=6.2  Score=30.53  Aligned_cols=22  Identities=18%  Similarity=0.276  Sum_probs=14.2

Q ss_pred             ccccccCCCCcCHHHHHHHHHH
Q 034525            3 KECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         3 k~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      .-+|.+.+|.|+|+||..|-..
T Consensus       101 ~mfd~~~~G~i~f~EF~~Lw~~  122 (221)
T KOG0037|consen  101 SMFDRDNSGTIGFKEFKALWKY  122 (221)
T ss_pred             HHhcCCCCCccCHHHHHHHHHH
Confidence            3456777777777777666543


No 67 
>PF12174 RST:  RCD1-SRO-TAF4 (RST) plant domain;  InterPro: IPR022003  This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors. 
Probab=59.95  E-value=4.9  Score=25.56  Aligned_cols=25  Identities=20%  Similarity=0.399  Sum_probs=20.3

Q ss_pred             cccccCCCCcCHHHHHHHHHHHHhh
Q 034525            4 ECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         4 ~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      .|+.=+.++|+++||+..++.++-+
T Consensus        33 ~Y~~~k~~kIsR~~fvr~lR~IVGD   57 (70)
T PF12174_consen   33 HYEEFKKKKISREEFVRKLRQIVGD   57 (70)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHH
Confidence            3455567899999999999988776


No 68 
>PF05517 p25-alpha:  p25-alpha ;  InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase []. It has been described as a brain specific protein, but it is found in Tetrahymena thermophila.; PDB: 1WLM_A 1PUL_A 2JRF_A.
Probab=58.48  E-value=5.2  Score=28.38  Aligned_cols=23  Identities=13%  Similarity=0.291  Sum_probs=17.5

Q ss_pred             ccCCCCcCHHHHHHHHHHHHhhH
Q 034525            7 LNLDGELDHEEFVKFIQKLTSDT   29 (92)
Q Consensus         7 ~N~DgeIdfeEF~~fi~~l~~~~   29 (92)
                      ..+...|+|++|.+.|.+++...
T Consensus        52 ~k~~~~I~f~~F~~aL~~lA~~~   74 (154)
T PF05517_consen   52 AKGARKITFEQFLEALAELAEKK   74 (154)
T ss_dssp             -SS-SEEEHHHHHHHHHHHHHHH
T ss_pred             cCCCcccCHHHHHHHHHHHHHHh
Confidence            34445699999999999988873


No 69 
>PF09912 DUF2141:  Uncharacterized protein conserved in bacteria (DUF2141);  InterPro: IPR018673  This family of conserved hypothetical proteins has no known function. 
Probab=55.63  E-value=3.1  Score=28.12  Aligned_cols=13  Identities=38%  Similarity=0.396  Sum_probs=11.5

Q ss_pred             ccccCCCCcCHHH
Q 034525            5 CDLNLDGELDHEE   17 (92)
Q Consensus         5 lD~N~DgeIdfeE   17 (92)
                      ||.|+||++|+..
T Consensus        61 hD~N~NgklD~n~   73 (112)
T PF09912_consen   61 HDENGNGKLDTNF   73 (112)
T ss_pred             EeCCCCCcCCcCC
Confidence            7999999999865


No 70 
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only]
Probab=55.63  E-value=4.1  Score=33.77  Aligned_cols=21  Identities=38%  Similarity=0.469  Sum_probs=18.8

Q ss_pred             CcccccccCCCCcCHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKF   21 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~f   21 (92)
                      +|+..|+|+|.-|+.+||+.-
T Consensus       301 VMk~vDtNqDRlvtleEFL~~  321 (442)
T KOG3866|consen  301 VMKQVDTNQDRLVTLEEFLND  321 (442)
T ss_pred             HHHhcccchhhhhhHHHHHhh
Confidence            489999999999999999864


No 71 
>PF00404 Dockerin_1:  Dockerin type I repeat;  InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ]. The cellulosome contains at least 30 polypeptides, the majority of the enzymes are endoglucanases (3.2.1.4 from EC), but there are also some xylanases (3.2.1.8 from EC), beta-glucosidases (3.2.1.21 from EC) and endo-beta-1,3-1,4-glucanases (3.2.1.73 from EC). Complete sequence data for many of these enzymes has been obtained. A majority of these proteins contain a highly conserved type I dockerin domain of about 65 to 70 residues, which is generally (but not always) located in the C terminus. The dockerin domain is the binding partner of the cohesin domain (see IPR002102 from INTERPRO). The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome []. The dockerin domain contains a tandem repeat of two calcium-binding loop-helix motifs (distinct from EF-hand Ca-binding motifs). These motifs are about 24 amino acids in length. This entry represents these repeated Ca-binding motifs.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3P0D_J 1OHZ_B 2CCL_B 1DAV_A 1DAQ_A 2VN5_B 2VN6_B.
Probab=54.51  E-value=21  Score=17.86  Aligned_cols=16  Identities=25%  Similarity=0.493  Sum_probs=11.3

Q ss_pred             cccCCCCcCHHHHHHH
Q 034525            6 DLNLDGELDHEEFVKF   21 (92)
Q Consensus         6 D~N~DgeIdfeEF~~f   21 (92)
                      |.|+||.|+=-.|..+
T Consensus         1 DvN~DG~vna~D~~~l   16 (21)
T PF00404_consen    1 DVNGDGKVNAIDLALL   16 (21)
T ss_dssp             -TTSSSSSSHHHHHHH
T ss_pred             CCCCCCcCCHHHHHHH
Confidence            7899999986655544


No 72 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=51.61  E-value=12  Score=27.77  Aligned_cols=28  Identities=25%  Similarity=0.490  Sum_probs=22.6

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +++++|.|+||+.+-+|-..+.......
T Consensus        55 ll~~~D~~~dg~~~~~el~~l~~~~~~~   82 (212)
T PF06226_consen   55 LLEGLDKDGDGKLDPEELAALAKEIFDN   82 (212)
T ss_pred             HHHhhhhcccCCCCHHHHHHHHHHHHhh
Confidence            3678999999999999988877665544


No 73 
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only]
Probab=51.16  E-value=9.2  Score=31.86  Aligned_cols=26  Identities=27%  Similarity=0.452  Sum_probs=21.2

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLT   26 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~   26 (92)
                      +++-||-|+|..|++.|++.-+..--
T Consensus       375 ~~~yCDlNkDKkISl~Ew~~CL~~~~  400 (421)
T KOG4578|consen  375 FFKYCDLNKDKKISLDEWRGCLGVEK  400 (421)
T ss_pred             cchhcccCCCceecHHHHhhhhcccc
Confidence            45779999999999999998775433


No 74 
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]
Probab=49.35  E-value=16  Score=27.29  Aligned_cols=19  Identities=11%  Similarity=0.307  Sum_probs=8.2

Q ss_pred             ccccCCCCcCHHHHHHHHH
Q 034525            5 CDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         5 lD~N~DgeIdfeEF~~fi~   23 (92)
                      .|.+++|.|++.+|..+..
T Consensus       115 ~D~D~~Gkis~~~lkrvak  133 (172)
T KOG0028|consen  115 FDDDKTGKISQRNLKRVAK  133 (172)
T ss_pred             ccccCCCCcCHHHHHHHHH
Confidence            3444444444444444433


No 75 
>KOG0968 consensus DNA polymerase zeta, catalytic subunit [Replication, recombination and repair]
Probab=49.06  E-value=11  Score=35.91  Aligned_cols=46  Identities=30%  Similarity=0.398  Sum_probs=35.6

Q ss_pred             hhhhhhHHHhhhhc-----------cCCCCccchhhhhcCchhHHHHHHHHHHHHhccc
Q 034525           41 LVVAPTVAMATKRA-----------TEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSG   88 (92)
Q Consensus        41 ~~aaP~~A~~aKra-----------~e~VP~vg~~v~~vP~~v~~~~~T~~~v~~~~~~   88 (92)
                      .=++|+.|++|+|.           ||+||.|  +|+..|-+.++..+-.--.|+++..
T Consensus      1275 ~~~~pP~avva~r~i~~DpR~EPqygERVPYv--II~G~pG~~L~~~vvsP~efL~~~~ 1331 (1488)
T KOG0968|consen 1275 ASAAPPGAVVARRRITKDPRHEPQYGERVPYV--IIDGVPGSTLYSRVVSPEEFLRNPT 1331 (1488)
T ss_pred             cccCCchHHHHHHHhccCCccCccccccCCeE--EEeCCCCCcHHHHhcCHHHHhcCCc
Confidence            34688888888863           8999999  8999999888877666666666554


No 76 
>PHA02844 putative transmembrane protein; Provisional
Probab=48.38  E-value=18  Score=23.73  Aligned_cols=17  Identities=24%  Similarity=0.536  Sum_probs=13.4

Q ss_pred             CcCHHHHHHHHHHHHhh
Q 034525           12 ELDHEEFVKFIQKLTSD   28 (92)
Q Consensus        12 eIdfeEF~~fi~~l~~~   28 (92)
                      +-||+||++-++....+
T Consensus        17 DdDFnnFI~vVksVLtd   33 (75)
T PHA02844         17 NEDFNNFIDVVKSVLSD   33 (75)
T ss_pred             hHHHHHHHHHHHHHHcC
Confidence            45799999999886555


No 77 
>PF09454 Vps23_core:  Vps23 core domain;  InterPro: IPR017916 The Endosomal Sorting Complex Required for Transport (ESCRT) complexes form the machinery driving protein sorting from endosomes to lysosomes. ESCRT complexes are central to receptor down-regulation, lysosome biogenesis, and budding of HIV. Yeast ESCRT-I consists of three protein subunits, VPS23, VPS28, and VPS37. In humans, ESCRT-I comprises TSG101, VPS28, and one of four potential human VPS37 homologues. The main role of ESCRT-I is to recognise ubiquitinated cargo via the UEV domain of the VPS23/TSG101 subunit. The assembly of the ESCRT-I complex is directed by the C-terminal steadiness box (SB) of VPS23, the N-terminal half of VPS28, and the C-terminal half of VPS37. The structure is primarily composed of three long, parallel helical hairpins, each corresponding to a different subunit. The additional domains and motifs extending beyond the core serve as gripping tools for ESCRT-I critical functions [, ]. This entry represents the Steadiness box domain.; PDB: 2CAZ_A 2F66_D 2F6M_A 2P22_A.
Probab=45.76  E-value=37  Score=21.14  Aligned_cols=21  Identities=29%  Similarity=0.681  Sum_probs=18.0

Q ss_pred             CCCcCHHHHHHHHHHHHhhHH
Q 034525           10 DGELDHEEFVKFIQKLTSDTF   30 (92)
Q Consensus        10 DgeIdfeEF~~fi~~l~~~~~   30 (92)
                      .|.|++++|+.-++.++++-|
T Consensus        37 ~g~I~~d~~lK~vR~LaReQF   57 (65)
T PF09454_consen   37 RGSIDLDTFLKQVRSLAREQF   57 (65)
T ss_dssp             TTSS-HHHHHHHHHHHHHHHH
T ss_pred             cCCCCHHHHHHHHHHHHHHHH
Confidence            578999999999999999866


No 78 
>PF07217 Het-C:  Heterokaryon incompatibility protein Het-C;  InterPro: IPR010816 In filamentous fungi, het loci (for heterokaryon incompatibility) are believed to regulate self/nonself-recognition during vegetative growth. As filamentous fungi grow, hyphal fusion occurs within an individual colony to form a network. Hyphal fusion can occur also between different individuals to form a heterokaryon, in which genetically distinct nuclei occupy a common cytoplasm. However, heterokaryotic cells are viable only if the individuals involved have identical alleles at all het loci [].
Probab=45.13  E-value=14  Score=32.44  Aligned_cols=32  Identities=13%  Similarity=0.391  Sum_probs=28.5

Q ss_pred             ccCCCCccchhhhhcCchhHHHHHHHHHHHHh
Q 034525           54 ATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQ   85 (92)
Q Consensus        54 a~e~VP~vg~~v~~vP~~v~~~~~T~~~v~~~   85 (92)
                      +-|.+|++.++++++-+.+=+-++|+++-++.
T Consensus       395 ~IekIPgL~~l~e~i~e~l~~fVfs~laPfi~  426 (606)
T PF07217_consen  395 AIEKIPGLESLIEKISEQLTVFVFSLLAPFIR  426 (606)
T ss_pred             HHhcCCCcHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34899999999999999999999999988664


No 79 
>PHA02650 hypothetical protein; Provisional
Probab=42.70  E-value=24  Score=23.50  Aligned_cols=17  Identities=24%  Similarity=0.548  Sum_probs=13.4

Q ss_pred             CcCHHHHHHHHHHHHhh
Q 034525           12 ELDHEEFVKFIQKLTSD   28 (92)
Q Consensus        12 eIdfeEF~~fi~~l~~~   28 (92)
                      +-||+||++-++....+
T Consensus        17 DdDFnnFI~VVkSVLtD   33 (81)
T PHA02650         17 DDDFNNFIDVVKSVLSD   33 (81)
T ss_pred             HHHHHHHHHHHHHHHcC
Confidence            45799999999886555


No 80 
>PRK09272 hypothetical protein; Provisional
Probab=42.64  E-value=38  Score=23.30  Aligned_cols=30  Identities=23%  Similarity=0.534  Sum_probs=24.5

Q ss_pred             hhhhhhhhhhhHHHhhhhccCCCCccchhhhhcC
Q 034525           36 GLLITLVVAPTVAMATKRATEGVPHVGKVVQRVP   69 (92)
Q Consensus        36 ~~li~~~aaP~~A~~aKra~e~VP~vg~~v~~vP   69 (92)
                      |++++...+=.+.-++||   . |.+|.++-.+|
T Consensus         6 K~lisa~iIv~iSeiAkR---~-p~~ggliAaLP   35 (109)
T PRK09272          6 KYLISALIIVAITEIAKR---S-PTLGGLIAALP   35 (109)
T ss_pred             HHHHHHHHHHHHHHHHHh---c-chHHHHHHHhH
Confidence            567777777778888999   5 99999998887


No 81 
>PHA02975 hypothetical protein; Provisional
Probab=42.29  E-value=27  Score=22.56  Aligned_cols=17  Identities=24%  Similarity=0.503  Sum_probs=13.2

Q ss_pred             CcCHHHHHHHHHHHHhh
Q 034525           12 ELDHEEFVKFIQKLTSD   28 (92)
Q Consensus        12 eIdfeEF~~fi~~l~~~   28 (92)
                      +-||+||++-++....+
T Consensus        17 DdDF~nFI~vVksVLtd   33 (69)
T PHA02975         17 DSDFEDFIDTIMHVLTG   33 (69)
T ss_pred             hHHHHHHHHHHHHHHcC
Confidence            45799999999875554


No 82 
>PF06942 GlpM:  GlpM protein;  InterPro: IPR009707 This family consists of several bacterial GlpM membrane proteins. GlpM is a hydrophobic protein containing 109 amino acids. It is thought that GlpM may play a role in alginate biosynthesis in Pseudomonas aeruginosa [].
Probab=41.72  E-value=24  Score=24.54  Aligned_cols=46  Identities=20%  Similarity=0.257  Sum_probs=34.7

Q ss_pred             hhhhhhhhhhHHHhhhhccCCCCccchhhhhcCchhHHHHHHHHHHHHhcccCCC
Q 034525           37 LLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSGRQI   91 (92)
Q Consensus        37 ~li~~~aaP~~A~~aKra~e~VP~vg~~v~~vP~~v~~~~~T~~~v~~~~~~~~~   91 (92)
                      .++-+.++=.+|+++|+-..-++|+      +|   .+|.+++.+..++.+..|.
T Consensus         3 ~llGa~~VllIalLsKsk~~yiaGL------vP---LFPTFALIahyiVg~er~~   48 (107)
T PF06942_consen    3 ALLGALVVLLIALLSKSKNYYIAGL------VP---LFPTFALIAHYIVGSERGM   48 (107)
T ss_pred             HHHhHHHHHHHHHHHhchhhHHhhH------HH---HhHHHHHHHHHHHHhcCCH
Confidence            3455566667888999888888888      44   7889999988887766653


No 83 
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]
Probab=40.80  E-value=20  Score=31.50  Aligned_cols=25  Identities=28%  Similarity=0.405  Sum_probs=21.1

Q ss_pred             ccccCCCCcCHHHHHHHHHHHHhhH
Q 034525            5 CDLNLDGELDHEEFVKFIQKLTSDT   29 (92)
Q Consensus         5 lD~N~DgeIdfeEF~~fi~~l~~~~   29 (92)
                      -|+-+||-|||+||.-|=.-++.++
T Consensus        83 aD~tKDglisf~eF~afe~~lC~pD  107 (694)
T KOG0751|consen   83 ADQTKDGLISFQEFRAFESVLCAPD  107 (694)
T ss_pred             hhhcccccccHHHHHHHHhhccCch
Confidence            4788999999999999887777773


No 84 
>PHA02692 hypothetical protein; Provisional
Probab=40.33  E-value=20  Score=23.23  Aligned_cols=15  Identities=27%  Similarity=0.722  Sum_probs=12.5

Q ss_pred             CHHHHHHHHHHHHhh
Q 034525           14 DHEEFVKFIQKLTSD   28 (92)
Q Consensus        14 dfeEF~~fi~~l~~~   28 (92)
                      ||+||++-++....+
T Consensus        19 DF~~Fi~vVksVLtD   33 (70)
T PHA02692         19 DFEEFLNIVRTVMTE   33 (70)
T ss_pred             HHHHHHHHHHHHHcC
Confidence            899999999876555


No 85 
>COG5562 Phage envelope protein [General function prediction only]
Probab=38.95  E-value=18  Score=26.21  Aligned_cols=21  Identities=19%  Similarity=0.300  Sum_probs=16.9

Q ss_pred             cccccCCCCcCHHHHHHHHHH
Q 034525            4 ECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         4 ~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      .++..+-||.+|+||..=+.+
T Consensus        80 al~~~qsGqttF~ef~~~la~  100 (137)
T COG5562          80 ALRRHQSGQTTFEEFCSALAE  100 (137)
T ss_pred             HHHHHhcCCccHHHHHHHHHh
Confidence            356778899999999987754


No 86 
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=38.73  E-value=21  Score=27.66  Aligned_cols=23  Identities=17%  Similarity=0.404  Sum_probs=14.9

Q ss_pred             cccccccCCCCcCHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQK   24 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~   24 (92)
                      ++++|+|+.|.|+..|+..-+..
T Consensus       130 F~~~D~D~SG~I~~sEL~~Al~~  152 (221)
T KOG0037|consen  130 FRTYDRDRSGTIDSSELRQALTQ  152 (221)
T ss_pred             HHhcccCCCCcccHHHHHHHHHH
Confidence            45677777777777776655543


No 87 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=37.55  E-value=31  Score=22.40  Aligned_cols=15  Identities=20%  Similarity=0.640  Sum_probs=12.8

Q ss_pred             CHHHHHHHHHHHHhh
Q 034525           14 DHEEFVKFIQKLTSD   28 (92)
Q Consensus        14 dfeEF~~fi~~l~~~   28 (92)
                      ||+||++-+.....+
T Consensus        19 Df~~Fi~vVksVltd   33 (72)
T PF12575_consen   19 DFNNFINVVKSVLTD   33 (72)
T ss_pred             HHHHHHHHHHHHHcC
Confidence            899999999886655


No 88 
>PF10841 DUF2644:  Protein of unknown function (DUF2644);  InterPro: IPR020300 This entry is represented by Bacteriophage PY100, Orf49. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This entry contains membrane proteins with no known function.
Probab=35.41  E-value=49  Score=20.84  Aligned_cols=26  Identities=35%  Similarity=0.502  Sum_probs=22.1

Q ss_pred             ccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            3 KECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         3 k~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+=+|.||+++=--|++|.+-+...
T Consensus         1 ~ELiTN~dGrLSTT~~iQffg~lv~a   26 (60)
T PF10841_consen    1 KELITNADGRLSTTAFIQFFGALVMA   26 (60)
T ss_pred             CccccCCCCcEehHHHHHHHHHHHHH
Confidence            46778999999999999999887766


No 89 
>KOG4251 consensus Calcium binding protein [General function prediction only]
Probab=34.84  E-value=45  Score=27.07  Aligned_cols=30  Identities=23%  Similarity=0.535  Sum_probs=20.0

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhhHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSDTF   30 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~~~   30 (92)
                      |+++.|.|.|+.|+=.|-.+-|++.+.+-|
T Consensus       106 iFsKvDVNtDrkisAkEmqrwImektaEHf  135 (362)
T KOG4251|consen  106 IFSKVDVNTDRKISAKEMQRWIMEKTAEHF  135 (362)
T ss_pred             HHhhcccCccccccHHHHHHHHHHHHHHHH
Confidence            356667777777777777777766666544


No 90 
>PF09373 PMBR:  Pseudomurein-binding repeat;  InterPro: IPR018975  Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) is a methanogenic Gram-positive microorganism with a cell wall consisting of pseudomurein. This repeat specifically binds to pseudomurein. This repeat is found at the N terminus of PeiW and PeiP which are pseudomurein binding phage proteins. 
Probab=34.51  E-value=55  Score=17.54  Aligned_cols=17  Identities=18%  Similarity=0.618  Sum_probs=14.0

Q ss_pred             CCCcCHHHHHHHHHHHH
Q 034525           10 DGELDHEEFVKFIQKLT   26 (92)
Q Consensus        10 DgeIdfeEF~~fi~~l~   26 (92)
                      .|.|+++||..+..+..
T Consensus         2 ~~~i~~~~~~d~a~rv~   18 (33)
T PF09373_consen    2 SGTISKEEYLDMASRVN   18 (33)
T ss_pred             CceecHHHHHHHHHHHH
Confidence            57899999999987743


No 91 
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=33.32  E-value=55  Score=30.34  Aligned_cols=18  Identities=39%  Similarity=0.630  Sum_probs=15.3

Q ss_pred             ccccCCCCcCHHHHHHHH
Q 034525            5 CDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         5 lD~N~DgeIdfeEF~~fi   22 (92)
                      .|.|+||..|-.||---|
T Consensus        58 sDldkDGrmdi~EfSIAm   75 (1118)
T KOG1029|consen   58 SDLDKDGRMDIREFSIAM   75 (1118)
T ss_pred             hhcCccccchHHHHHHHH
Confidence            589999999999996544


No 92 
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=32.63  E-value=21  Score=29.88  Aligned_cols=21  Identities=33%  Similarity=0.404  Sum_probs=17.2

Q ss_pred             CcccccccCCCCcCHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKF   21 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~f   21 (92)
                      ||..+|.|.|+.+|..|-..+
T Consensus       255 MFnklD~N~Dl~Ld~sEl~~I  275 (434)
T KOG3555|consen  255 MFNKLDTNYDLLLDQSELRAI  275 (434)
T ss_pred             hhhccccccccccCHHHhhhh
Confidence            678899999999998886543


No 93 
>PF00701 DHDPS:  Dihydrodipicolinate synthetase family;  InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue []. Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Rhizobium meliloti (Sinorhizobium meliloti) protein mosA [], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry []. Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 3B4U_B 3S8H_A 3QZE_B 1XXX_F 3L21_F 3IRD_A 3A5F_B 3G0S_B 3DAQ_C 3UQN_A ....
Probab=32.23  E-value=46  Score=25.09  Aligned_cols=21  Identities=29%  Similarity=0.550  Sum_probs=17.2

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||+++|.+++..+...
T Consensus        14 ~~dg~id~~~~~~~i~~l~~~   34 (289)
T PF00701_consen   14 NADGSIDEDALKRLIDFLIEA   34 (289)
T ss_dssp             ETTSSB-HHHHHHHHHHHHHT
T ss_pred             CCCcCcCHHHHHHHHHHHHHc
Confidence            568999999999999888766


No 94 
>PF06450 NhaB:  Bacterial Na+/H+ antiporter B (NhaB);  InterPro: IPR004671 The Escherichia coli NhaB Na+:H+ Antiporter (NhaB) protein has 12 predicted TMS, and catalyses sodium/proton exchange. Unlike NhaA, IPR004670 from INTERPRO, this activity is not pH dependent.; GO: 0015385 sodium:hydrogen antiporter activity, 0006814 sodium ion transport, 0016021 integral to membrane
Probab=32.19  E-value=92  Score=26.81  Aligned_cols=54  Identities=26%  Similarity=0.381  Sum_probs=37.1

Q ss_pred             ccccccCCCCcC------HHHHHHHHHHHHhhHHHHhhhhh--hhhhhhhhhHHHhhhhccCCC
Q 034525            3 KECDLNLDGELD------HEEFVKFIQKLTSDTFIVVSQGL--LITLVVAPTVAMATKRATEGV   58 (92)
Q Consensus         3 k~lD~N~DgeId------feEF~~fi~~l~~~~~~~~~~~~--li~~~aaP~~A~~aKra~e~V   58 (92)
                      +++|.+.|.+++      .|+|..|++.+.++  +.+.+-+  ..|.++=|-=-+.+|+||=+-
T Consensus       177 ~~~d~~~D~~v~~~~r~~Le~FRaFLRsLmMH--~~VGTALGGV~TmVGEPQNLiIa~~agW~F  238 (515)
T PF06450_consen  177 DDHDHTDDSKVDELNREDLEQFRAFLRSLMMH--AAVGTALGGVMTMVGEPQNLIIAKQAGWDF  238 (515)
T ss_pred             CccCCccchhhhhhhHHHHHHHHHHHHHHHHh--cccchhhcceeeecCCchhhhhhhhcCCCH
Confidence            356776666554      68999999999988  4333322  236677777778888888653


No 95 
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]
Probab=32.14  E-value=33  Score=25.22  Aligned_cols=43  Identities=19%  Similarity=0.127  Sum_probs=28.7

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhhHHHHhhhhhhhhhhhhhhHHHhhhhccCCCCc
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPH   60 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~~~~~~~~~~li~~~aaP~~A~~aKra~e~VP~   60 (92)
                      +.-+|.++||.|+++.--.-++                ++=.-|+=|++.|..|+-.+.
T Consensus        17 F~lfD~~gD~ki~~~q~gdvlR----------------alG~nPT~aeV~k~l~~~~~~   59 (152)
T KOG0030|consen   17 FLLFDRTGDGKISGSQVGDVLR----------------ALGQNPTNAEVLKVLGQPKRR   59 (152)
T ss_pred             HHHHhccCcccccHHHHHHHHH----------------HhcCCCcHHHHHHHHcCcccc
Confidence            4457888888888776543332                223348888888888776654


No 96 
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=31.75  E-value=49  Score=25.73  Aligned_cols=20  Identities=25%  Similarity=0.494  Sum_probs=17.3

Q ss_pred             CCCCcCHHHHHHHHHHHHhh
Q 034525            9 LDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         9 ~DgeIdfeEF~~fi~~l~~~   28 (92)
                      .||+|||+.+.+++..+...
T Consensus        18 ~dg~vD~~a~~~lv~~li~~   37 (299)
T COG0329          18 EDGSVDEEALRRLVEFLIAA   37 (299)
T ss_pred             CCCCcCHHHHHHHHHHHHHc
Confidence            36899999999999888776


No 97 
>TIGR00774 NhaB Na+/H+ antiporter NhaB. These proteins are members of the NhaB Na+:H+ Antiporter (NhaB) Family (TC 2.A.34). The only characterised member of this family is the Escherichia coli NhaB protein, which has 12 GES predicted transmembrane regions, and catalyses sodium/proton exchange. Unlike NhaA this activity is not pH dependent.
Probab=31.50  E-value=1.6e+02  Score=25.49  Aligned_cols=53  Identities=23%  Similarity=0.311  Sum_probs=39.0

Q ss_pred             ccccccCCCCc------CHHHHHHHHHHHHhhHHHHhhhhhhhhhhhhhhHHHhhhhcc
Q 034525            3 KECDLNLDGEL------DHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRAT   55 (92)
Q Consensus         3 k~lD~N~DgeI------dfeEF~~fi~~l~~~~~~~~~~~~li~~~aaP~~A~~aKra~   55 (92)
                      +++|.++|.++      |-|+|..|++.+..+..--.+=.=..|.++-|.=.+.+...+
T Consensus       176 ~~~d~~~d~~~~~~~~~~l~~fr~fl~~LLM~~aiaAnLGGvlTpIGnPQNLiias~~g  234 (515)
T TIGR00774       176 GDHDHTDDDTITELTRDDLENFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIADQAG  234 (515)
T ss_pred             hhcCCCccchhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhcccCCCCCchHHHHHHHhC
Confidence            45666777744      677888888888877433344445678889999999999988


No 98 
>PF13121 DUF3976:  Domain of unknown function (DUF3976)
Probab=31.34  E-value=68  Score=18.61  Aligned_cols=26  Identities=27%  Similarity=0.281  Sum_probs=22.3

Q ss_pred             cccccCCCCcCHHHHHHHHHHHHhhH
Q 034525            4 ECDLNLDGELDHEEFVKFIQKLTSDT   29 (92)
Q Consensus         4 ~lD~N~DgeIdfeEF~~fi~~l~~~~   29 (92)
                      +-|..+|+.+...-|..++++++...
T Consensus         6 rkdit~~ntltkrgfykligclvvmf   31 (41)
T PF13121_consen    6 RKDITKDNTLTKRGFYKLIGCLVVMF   31 (41)
T ss_pred             EeeccCCCeeehhhHHHHHHHHHHHH
Confidence            44777899999999999999998873


No 99 
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only]
Probab=29.80  E-value=44  Score=27.93  Aligned_cols=27  Identities=19%  Similarity=0.416  Sum_probs=20.1

Q ss_pred             cccccccCCCCcCHHH---HHHHHHHHHhh
Q 034525            2 MKECDLNLDGELDHEE---FVKFIQKLTSD   28 (92)
Q Consensus         2 mk~lD~N~DgeIdfeE---F~~fi~~l~~~   28 (92)
                      |..+|+|+++.|++.|   |-.++.+..+.
T Consensus       339 F~qLdkN~nn~i~rrEwKpFK~~l~k~s~~  368 (421)
T KOG4578|consen  339 FNQLDKNSNNDIERREWKPFKRVLLKKSKP  368 (421)
T ss_pred             eeeecccccCccchhhcchHHHHHHhhccH
Confidence            6789999999999888   55555554443


No 100
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]
Probab=29.72  E-value=40  Score=28.73  Aligned_cols=22  Identities=18%  Similarity=0.299  Sum_probs=13.6

Q ss_pred             cccccccCCCCcCHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQ   23 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~   23 (92)
                      ++..|+++++.|+++||..++.
T Consensus       124 ~e~~d~~g~~~I~~~e~rd~~l  145 (463)
T KOG0036|consen  124 FEHMDKDGKATIDLEEWRDHLL  145 (463)
T ss_pred             HHHhccCCCeeeccHHHHhhhh
Confidence            4555666666666666666654


No 101
>PHA03054 IMV membrane protein; Provisional
Probab=28.82  E-value=59  Score=21.18  Aligned_cols=17  Identities=29%  Similarity=0.577  Sum_probs=13.6

Q ss_pred             CcCHHHHHHHHHHHHhh
Q 034525           12 ELDHEEFVKFIQKLTSD   28 (92)
Q Consensus        12 eIdfeEF~~fi~~l~~~   28 (92)
                      +-||+||++-++....+
T Consensus        17 d~Df~~Fi~vV~sVl~d   33 (72)
T PHA03054         17 EDDLTDFIEIVKSVLSD   33 (72)
T ss_pred             hHHHHHHHHHHHHHHcC
Confidence            56899999999876555


No 102
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=28.54  E-value=61  Score=25.15  Aligned_cols=22  Identities=14%  Similarity=0.359  Sum_probs=18.2

Q ss_pred             ccCCCCcCHHHHHHHHHHHHhh
Q 034525            7 LNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         7 ~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      .|.||+||++.+.+++..+...
T Consensus        20 ~~~~g~iD~~~l~~lv~~li~~   41 (309)
T cd00952          20 WRATDTVDLDETARLVERLIAA   41 (309)
T ss_pred             cccCCCcCHHHHHHHHHHHHHc
Confidence            3457999999999999887765


No 103
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=28.28  E-value=63  Score=24.06  Aligned_cols=21  Identities=24%  Similarity=0.493  Sum_probs=16.7

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        10 ~~dg~iD~~~~~~~i~~l~~~   30 (281)
T cd00408          10 TADGEVDLDALRRLVEFLIEA   30 (281)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            456899999998888877664


No 104
>PF09796 QCR10:  Ubiquinol-cytochrome-c reductase complex subunit (QCR10);  InterPro: IPR019182 This entry represents subunit 10 of the cytochrome b-c1 complex (also known as the ubiquinol-cytochrome c reductase complex or complex III). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. Subunit 10 is required for stable association of the iron-sulphur protein with the complex []. 
Probab=27.50  E-value=45  Score=20.99  Aligned_cols=41  Identities=24%  Similarity=0.332  Sum_probs=27.3

Q ss_pred             HhhHHHHhhhhhhhhhhhhhhHHHhhhhccCCCCccc-hhhhhcC
Q 034525           26 TSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVG-KVVQRVP   69 (92)
Q Consensus        26 ~~~~~~~~~~~~li~~~aaP~~A~~aKra~e~VP~vg-~~v~~vP   69 (92)
                      +...+.++.-++...+.|+=..+++-   ++++|.+. .+++|+|
T Consensus         6 t~~~~~~~~p~~a~wG~aa~~~v~~f---~~~vPr~q~dil~KIP   47 (64)
T PF09796_consen    6 TPKTLTRYGPNLALWGGAAGAAVLFF---TSGVPRFQRDILQKIP   47 (64)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHH---hcCCcHHHHHHHHhCC
Confidence            34445566677777777776666654   45888887 4578887


No 105
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]
Probab=27.38  E-value=49  Score=24.76  Aligned_cols=23  Identities=30%  Similarity=0.443  Sum_probs=17.4

Q ss_pred             cccccCCCCcCHHHHHHHHHHHH
Q 034525            4 ECDLNLDGELDHEEFVKFIQKLT   26 (92)
Q Consensus         4 ~lD~N~DgeIdfeEF~~fi~~l~   26 (92)
                      -.|+|+||-|+++.-..+++.+-
T Consensus        40 ~mDqnrDG~IdkeDL~d~~aSlG   62 (171)
T KOG0031|consen   40 LMDQNRDGFIDKEDLRDMLASLG   62 (171)
T ss_pred             HHhccCCCcccHHHHHHHHHHcC
Confidence            46899999999887777765543


No 106
>PF09279 EF-hand_like:  Phosphoinositide-specific phospholipase C, efhand-like;  InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme []. ; PDB: 3OHM_B 3QR0_A 2ZKM_X 2FJU_B 3QR1_D 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B ....
Probab=27.00  E-value=33  Score=21.03  Aligned_cols=26  Identities=15%  Similarity=0.336  Sum_probs=19.1

Q ss_pred             cccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      ++++-. +.+.++.++|.+|+.+.-.+
T Consensus         6 f~~ys~-~~~~mt~~~f~~FL~~eQ~~   31 (83)
T PF09279_consen    6 FRKYSS-DKEYMTAEEFRRFLREEQGE   31 (83)
T ss_dssp             HHHHCT-TSSSEEHHHHHHHHHHTSS-
T ss_pred             HHHHhC-CCCcCCHHHHHHHHHHHhcc
Confidence            455633 57899999999999876555


No 107
>TIGR00674 dapA dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment.
Probab=26.64  E-value=69  Score=24.23  Aligned_cols=21  Identities=24%  Similarity=0.366  Sum_probs=17.0

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        11 ~~~g~iD~~~~~~~i~~l~~~   31 (285)
T TIGR00674        11 KEDGSVDFAALEKLIDFQIEN   31 (285)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            456899999999999887654


No 108
>PLN02417 dihydrodipicolinate synthase
Probab=26.18  E-value=72  Score=24.30  Aligned_cols=21  Identities=19%  Similarity=0.346  Sum_probs=17.4

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        14 ~~~g~iD~~~~~~~i~~l~~~   34 (280)
T PLN02417         14 LPDGRFDLEAYDSLVNMQIEN   34 (280)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            457899999999999887765


No 109
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=25.88  E-value=74  Score=23.84  Aligned_cols=21  Identities=19%  Similarity=0.395  Sum_probs=16.2

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        13 ~~dg~iD~~~~~~~i~~l~~~   33 (284)
T cd00950          13 KDDGSVDFDALERLIEFQIEN   33 (284)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            456789988888888777654


No 110
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
Probab=25.30  E-value=75  Score=24.41  Aligned_cols=21  Identities=19%  Similarity=0.403  Sum_probs=17.3

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        13 ~~dg~iD~~~l~~lv~~~~~~   33 (294)
T TIGR02313        13 KRNGDIDEEALRELIEFQIEG   33 (294)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            566899999999999887765


No 111
>PF12767 SAGA-Tad1:  Transcriptional regulator of RNA polII, SAGA, subunit;  InterPro: IPR024738 The yeast Spt-Ada-Gcn5-Acetyl (SAGA) transferase complex is a multifunctional coactivator involved in multiple cellular processes [], including regulation of transcription by RNA polymerase II [, ]. It is formed of five major modular subunits and shows a high degree of structural conservation to human TFTC and STAGA []. This entry represents Ada1 (known as Tada1 in higher eukaryotes), one of the subunits that constitute the SAGA core. It also functions as a component of the SALSA and SLIK complexes. ; GO: 0070461 SAGA-type complex
Probab=24.81  E-value=95  Score=23.41  Aligned_cols=33  Identities=21%  Similarity=0.419  Sum_probs=26.3

Q ss_pred             CCcCHHHHHHHHHHHHhhHHHHhhhhhhhhhhh
Q 034525           11 GELDHEEFVKFIQKLTSDTFIVVSQGLLITLVV   43 (92)
Q Consensus        11 geIdfeEF~~fi~~l~~~~~~~~~~~~li~~~a   43 (92)
                      |+++++||-.++..+.......+=|.++.+++.
T Consensus        40 ~klsk~Efd~~~~~~L~~~~~~LHN~li~sIl~   72 (252)
T PF12767_consen   40 GKLSKEEFDKECRRILGRENVHLHNQLILSILK   72 (252)
T ss_pred             hccCHHHHHHHHHHHhChhHHHHHHHHHHHHHH
Confidence            789999999999998877666677777776654


No 112
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=24.77  E-value=78  Score=24.03  Aligned_cols=21  Identities=14%  Similarity=0.392  Sum_probs=15.9

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        13 ~~dg~iD~~~~~~~i~~l~~~   33 (288)
T cd00954          13 DENGEINEDVLRAIVDYLIEK   33 (288)
T ss_pred             CCCCCCCHHHHHHHHHHHHhc
Confidence            456788888888888776554


No 113
>KOG4004 consensus Matricellular protein Osteonectin/SPARC/BM-40 [Extracellular structures]
Probab=24.19  E-value=38  Score=26.55  Aligned_cols=22  Identities=23%  Similarity=0.521  Sum_probs=18.4

Q ss_pred             CcccccccCCCCcCHHHHHHHH
Q 034525            1 MMKECDLNLDGELDHEEFVKFI   22 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi   22 (92)
                      .++.||.|+||-|...|+..-+
T Consensus       227 f~e~cd~~nd~~ial~ew~~c~  248 (259)
T KOG4004|consen  227 FFETCDLDNDKYIALDEWAGCF  248 (259)
T ss_pred             hhhcccCCCCCceeHHHhhccc
Confidence            3688999999999999986543


No 114
>PLN00090 photosystem II reaction center M protein; Provisional
Probab=23.97  E-value=1.7e+02  Score=20.42  Aligned_cols=46  Identities=17%  Similarity=0.381  Sum_probs=25.9

Q ss_pred             HhhhhhhhhhhhhhhHHHhhhhccCCCCccchhhhhcCch-----------------hHHHHHHHHHHHHhcccC
Q 034525           32 VVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNS-----------------IYASLVTLAVVWFQNSGR   89 (92)
Q Consensus        32 ~~~~~~li~~~aaP~~A~~aKra~e~VP~vg~~v~~vP~~-----------------v~~~~~T~~~v~~~~~~~   89 (92)
                      |..--+..+.+++|..||=            +.|+.+|+-                 +++|.+-++.+.+|..++
T Consensus        40 k~~~a~~~aa~a~pafa~d------------sivealpt~t~~~EVNiLafIATaLFIlIPTaFLLILYVQT~Sr  102 (113)
T PLN00090         40 KAAGAAIPAAIAAPAFALD------------SIVEALPTNTLALEVQFGAYLAVALGTFLPCLFLINLFIQTESR  102 (113)
T ss_pred             HHhhcccHHHhcccHhHHH------------HHHHHcCccceeeehHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            3334444477777777763            456666653                 345555566666665443


No 115
>PF14513 DAG_kinase_N:  Diacylglycerol kinase N-terminus; PDB: 1TUZ_A.
Probab=23.85  E-value=59  Score=23.16  Aligned_cols=34  Identities=21%  Similarity=0.327  Sum_probs=21.3

Q ss_pred             cCCCCcCHHHHHHHHHHHHhhHH-HHhhhhhhhhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSDTF-IVVSQGLLITL   41 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~~~-~~~~~~~li~~   41 (92)
                      |.++.|||+-|..||......++ ..+.+-++...
T Consensus        44 ~~~~~Id~egF~~Fm~~yLe~d~P~~lc~hLF~sF   78 (138)
T PF14513_consen   44 NPEEPIDYEGFKLFMKTYLEVDLPEDLCQHLFLSF   78 (138)
T ss_dssp             EETTEE-HHHHHHHHHHHTT-S--HHHHHHHHHHS
T ss_pred             CCCCCcCHHHHHHHHHHHHcCCCCHHHHHHHHHHH
Confidence            34569999999999988766554 44455555543


No 116
>PF10891 DUF2719:  Protein of unknown function (DUF2719);  InterPro: IPR020122 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf56; it is a family of uncharacterised viral proteins.
Probab=23.63  E-value=56  Score=21.73  Aligned_cols=16  Identities=19%  Similarity=0.426  Sum_probs=12.4

Q ss_pred             CCCcCHHHHHHHHHHH
Q 034525           10 DGELDHEEFVKFIQKL   25 (92)
Q Consensus        10 DgeIdfeEF~~fi~~l   25 (92)
                      -+.|+||||+.+=.+.
T Consensus        33 PmSIS~eeY~~LH~~f   48 (81)
T PF10891_consen   33 PMSISFEEYIRLHIKF   48 (81)
T ss_pred             ccEeeHHHHHHHHHHH
Confidence            3679999999886553


No 117
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=23.59  E-value=86  Score=23.70  Aligned_cols=21  Identities=24%  Similarity=0.472  Sum_probs=16.5

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        14 ~~dg~iD~~~l~~~i~~l~~~   34 (292)
T PRK03170         14 KEDGSVDFAALRKLVDYLIAN   34 (292)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            456889999998888877654


No 118
>TIGR02829 spore_III_AE stage III sporulation protein AE. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AE.
Probab=23.27  E-value=1.7e+02  Score=24.15  Aligned_cols=65  Identities=20%  Similarity=0.312  Sum_probs=37.8

Q ss_pred             CCcCHHHHHHHHHHHHhh---HH-HHhhhhhhhhhhhhhhHHHh----hhhcc-CCCCccchhhhhcCchhHHH
Q 034525           11 GELDHEEFVKFIQKLTSD---TF-IVVSQGLLITLVVAPTVAMA----TKRAT-EGVPHVGKVVQRVPNSIYAS   75 (92)
Q Consensus        11 geIdfeEF~~fi~~l~~~---~~-~~~~~~~li~~~aaP~~A~~----aKra~-e~VP~vg~~v~~vP~~v~~~   75 (92)
                      +|..+....+++++...-   .+ ...---..|=++.+|.+=-+    +|++. +-+|++|+.+.-+-+.+.-+
T Consensus       223 ~e~~lskLa~llk~~~~w~lg~~ltif~Gi~~IQG~~~~~~D~v~~ktakf~v~~fIPvVG~~~sda~~tV~gs  296 (381)
T TIGR02829       223 DEYKIDKLSKFLKQISIGSQGVFLTIFLGVITIQGITAAVADGVTVKTAKFAVGNFVPVVGKMLTDAVDTVAGA  296 (381)
T ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhccCCCccchHHHHHHHHHHHH
Confidence            445555555555554333   22 22222333456777877655    44444 88999999987776665543


No 119
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]
Probab=23.17  E-value=60  Score=27.17  Aligned_cols=24  Identities=17%  Similarity=0.198  Sum_probs=20.7

Q ss_pred             cccccccCCCCcCHHHHHHHHHHH
Q 034525            2 MKECDLNLDGELDHEEFVKFIQKL   25 (92)
Q Consensus         2 mk~lD~N~DgeIdfeEF~~fi~~l   25 (92)
                      +++.|+..||+|.|++|..|+...
T Consensus       337 f~~i~q~d~~ki~~~~f~~fa~~~  360 (412)
T KOG4666|consen  337 FPSIEQKDDPKIYASNFRKFAATE  360 (412)
T ss_pred             chhhhcccCcceeHHHHHHHHHhC
Confidence            567788999999999999999753


No 120
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=22.31  E-value=93  Score=23.96  Aligned_cols=21  Identities=19%  Similarity=0.430  Sum_probs=17.3

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        20 ~~dg~iD~~~l~~li~~l~~~   40 (303)
T PRK03620         20 DADGSFDEAAYREHLEWLAPY   40 (303)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            567899999999999877665


No 121
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=22.11  E-value=97  Score=23.60  Aligned_cols=20  Identities=15%  Similarity=0.398  Sum_probs=16.2

Q ss_pred             cCCCCcCHHHHHHHHHHHHh
Q 034525            8 NLDGELDHEEFVKFIQKLTS   27 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~   27 (92)
                      |.||+||++.+.+++..+..
T Consensus        16 ~~dg~iD~~~~~~li~~l~~   35 (293)
T PRK04147         16 DEDGQIDEQGLRRLVRFNIE   35 (293)
T ss_pred             CCCCCcCHHHHHHHHHHHHh
Confidence            45688998888888888776


No 122
>PHA02819 hypothetical protein; Provisional
Probab=22.01  E-value=67  Score=20.85  Aligned_cols=17  Identities=12%  Similarity=0.479  Sum_probs=13.2

Q ss_pred             CcCHHHHHHHHHHHHhh
Q 034525           12 ELDHEEFVKFIQKLTSD   28 (92)
Q Consensus        12 eIdfeEF~~fi~~l~~~   28 (92)
                      +-||+||++-++....+
T Consensus        17 DdDFnnFI~VVksVLtd   33 (71)
T PHA02819         17 DDDFNNFINVVKSVLNN   33 (71)
T ss_pred             hhHHHHHHHHHHHHHcC
Confidence            45799999999875544


No 123
>COG3067 NhaB Na+/H+ antiporter [Inorganic ion transport and metabolism]
Probab=21.79  E-value=1.7e+02  Score=24.90  Aligned_cols=65  Identities=25%  Similarity=0.421  Sum_probs=42.7

Q ss_pred             ccccccCCCCcC------HHHHHHHHHHHHhhHHHHhhhhh--hhhhhhhhhHHHhhhhccCCCCccchh-hhhcCchh
Q 034525            3 KECDLNLDGELD------HEEFVKFIQKLTSDTFIVVSQGL--LITLVVAPTVAMATKRATEGVPHVGKV-VQRVPNSI   72 (92)
Q Consensus         3 k~lD~N~DgeId------feEF~~fi~~l~~~~~~~~~~~~--li~~~aaP~~A~~aKra~e~VP~vg~~-v~~vP~~v   72 (92)
                      +++|.-.|.+|+      .|+|..|++.+.++  +-+.+-+  ..+.++-|-=-+.+|.||=+-   |.. ++-.|-.+
T Consensus       177 ~~~D~~~D~~i~e~~~~~LE~fRaFLRSLmMH--agVGTALGGVmTmVGEPQNLiIa~~AgW~F---~eFflrm~PVt~  250 (516)
T COG3067         177 DDTDITDDSHIDEHYKVVLEQFRAFLRSLMMH--AGVGTALGGVMTMVGEPQNLIIAKQAGWHF---GEFFLRMAPVTV  250 (516)
T ss_pred             cccCccccccCChHHHHHHHHHHHHHHHHHHh--hccchhhcceeeeccCchhhhhhhhccccH---HHHHHHhcCchh
Confidence            466777777776      68899999998888  3322221  346677788888899988763   333 44445443


No 124
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=21.55  E-value=98  Score=23.64  Aligned_cols=21  Identities=24%  Similarity=0.371  Sum_probs=17.4

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        18 ~~dg~iD~~~l~~li~~l~~~   38 (296)
T TIGR03249        18 DADGSFDEAAYRENIEWLLGY   38 (296)
T ss_pred             CCCCCcCHHHHHHHHHHHHhc
Confidence            456899999999999887765


No 125
>PRK12320 hypothetical protein; Provisional
Probab=21.46  E-value=1.6e+02  Score=26.17  Aligned_cols=47  Identities=13%  Similarity=0.082  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHhhHHHHhhhhhhhhhhhhhhHHHhhhhccCCCCccch
Q 034525           15 HEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGK   63 (92)
Q Consensus        15 feEF~~fi~~l~~~~~~~~~~~~li~~~aaP~~A~~aKra~e~VP~vg~   63 (92)
                      .++.+.+++....+  +=+.+.+.+.-.+++++++..-.||..+|++|.
T Consensus       462 l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  508 (699)
T PRK12320        462 LEVRIRLLRDRIHQ--GWILTVLWVIDTGVTAATLEHTRAGSAVSGGGM  508 (699)
T ss_pred             HHHHHHHHHHhhhH--HHHHHHHHHHHhhhHHHHHHHhhccCCCCCcCc
Confidence            57778888777777  555555555434478888999999999999974


No 126
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=20.08  E-value=1.1e+02  Score=23.33  Aligned_cols=21  Identities=24%  Similarity=0.450  Sum_probs=17.3

Q ss_pred             cCCCCcCHHHHHHHHHHHHhh
Q 034525            8 NLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         8 N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      |.||+||++.+.+++..+...
T Consensus        13 ~~dg~iD~~~l~~l~~~l~~~   33 (289)
T cd00951          13 DADGSFDEDAYRAHVEWLLSY   33 (289)
T ss_pred             CCCCCcCHHHHHHHHHHHHHc
Confidence            556899999999999887765


Done!