Citrus Sinensis ID: 034528

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MGKRKSRAKPPPKKRVDKLDTVFSCPFCNHGTSVECRIDMKNLIGEAICNICQESFSTTITALTEPIDIYSEWIDECERVNNLEDDGAYEKA
cccccccccccccccccccccccccccccccccEEEEEEccccEEEEEcccccccEEEcccccccHHHHHHHHHHHHHHHHccccccccccc
*****************KLDTVFSCPFCNHGTSVECRIDMKNLIGEAICNICQESFSTTITALTEPIDIYSEWIDECERVN***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKRKSRAKPPPKKRVDKLDTVFSCPFCNHGTSVECRIDMKNLIGEAICNICQESFSTTITALTEPIDIYSEWIDECERVNNLEDDGAYEKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription elongation factor 1 homolog Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.confidentQ8LHP0
Transcription elongation factor 1 homolog Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.probableQ8LEF3
Transcription elongation factor 1 homolog Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.probableQ54KR5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WII, chain A
Confidence level:very confident
Coverage over the Query: 16-83
View the alignment between query and template
View the model in PyMOL