Query         034583
Match_columns 90
No_of_seqs    34 out of 36
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 04:22:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034583.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034583hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12443 AKNA:  AT-hook-contain  47.2      12 0.00027   26.5   1.5   14   30-43     59-72  (106)
  2 PF03735 ENT:  ENT domain;  Int  38.7      58  0.0013   21.3   3.6   26   34-59     32-57  (73)
  3 PF09943 DUF2175:  Uncharacteri  28.0      36 0.00077   24.0   1.3   14   49-62     26-39  (101)
  4 PF00660 SRP1_TIP1:  Seripauper  26.1      48  0.0011   22.9   1.7   20   29-48     17-36  (104)
  5 PF08225 Antimicrobial19:  Pseu  25.4      45 0.00098   18.3   1.1   13   56-68      3-15  (23)
  6 PF14278 TetR_C_8:  Transcripti  24.6      94   0.002   17.6   2.5   25   26-50     25-49  (77)
  7 COG1473 AbgB Metal-dependent a  19.8      69  0.0015   26.3   1.7   26   28-53     10-35  (392)
  8 KOG0105 Alternative splicing f  18.8      64  0.0014   26.0   1.2   10   32-41    129-138 (241)
  9 PF14377 DUF4414:  Domain of un  17.6      48   0.001   22.2   0.3   26   24-49     83-108 (108)
 10 PF06108 DUF952:  Protein of un  17.4      59  0.0013   21.5   0.6   33   31-66     16-48  (93)

No 1  
>PF12443 AKNA:  AT-hook-containing transcription factor;  InterPro: IPR022150  This domain family is found in eukaryotes, and is approximately 110 amino acids in length. This family contains a transcription factor which regulates the expression of the costimulatory molecules on lymphocytes. 
Probab=47.21  E-value=12  Score=26.48  Aligned_cols=14  Identities=36%  Similarity=0.653  Sum_probs=11.4

Q ss_pred             hhhhhhHHHHHHHh
Q 034583           30 SFLEDLRDHIDEFI   43 (90)
Q Consensus        30 tF~edlkDHi~EFi   43 (90)
                      .=++.|||||+||=
T Consensus        59 eqteeLK~kvqe~s   72 (106)
T PF12443_consen   59 EQTEELKDKVQEFS   72 (106)
T ss_pred             HHHHHHHHHHHHHh
Confidence            34789999999984


No 2  
>PF03735 ENT:  ENT domain;  InterPro: IPR005491 This entry represents a protein regulator which is able to repress transcription, possibly via its interaction with a multi protein chromatin re-modeling complex that modifies the chromatin. Its interaction with BRCA2 suggests that it may play a central role in the DNA repair function of BRCA2 []. ; PDB: 1UZ3_B 1UTU_B 2FMM_E.
Probab=38.71  E-value=58  Score=21.32  Aligned_cols=26  Identities=15%  Similarity=0.321  Sum_probs=17.6

Q ss_pred             hhHHHHHHHhhhChHHHHHHHHHHHH
Q 034583           34 DLRDHIDEFIHASMDAHKACFKKTVQ   59 (90)
Q Consensus        34 dlkDHi~EFihASmDEHktCfkkti~   59 (90)
                      .|-.++....|-|-|||+.+.++-++
T Consensus        32 ~lLt~Lr~~L~IS~e~H~~~l~~~~~   57 (73)
T PF03735_consen   32 KLLTELRKELNISDEEHREELRRAVS   57 (73)
T ss_dssp             HHHHHHHHHTT--HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhCCCcHHHHHHHHHHhc
Confidence            34445556679999999999988754


No 3  
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=27.97  E-value=36  Score=24.01  Aligned_cols=14  Identities=29%  Similarity=0.728  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHh
Q 034583           49 AHKACFKKTVQKMF   62 (90)
Q Consensus        49 EHktCfkkti~kmF   62 (90)
                      =|++||...+.+.+
T Consensus        26 VH~~C~~~~~~~k~   39 (101)
T PF09943_consen   26 VHYECFREKASKKL   39 (101)
T ss_pred             EeHHHHHHHHhhhc
Confidence            39999999988887


No 4  
>PF00660 SRP1_TIP1:  Seripauperin and TIP1 family;  InterPro: IPR000992 It has recently been shown [] that three yeast proteins, two of which are known to be induced by various stress conditions, are structurally related and are probably part of a larger family. These proteins include cold-shock inducible protein TIR1 (also known as serine-rich protein 1, SRP1), which is induced by glucose [] and cold shock []; temperature-shock inducible protein 1 (SRP2) []; seripauperins, which are closely related protein of about 13kDa (120 to 124 residues) and are generally encoded at the extremity of yeast chromosomes (eg. PAU1, PAU2, PAU3, PAU4, PAU5, PAU6, YBR301w, YGL261c, YGR294w, YHL046c, YIL176c, YIR041w and YKL224c) []; and hypothetical proteins YIL011w, YJR150c and YJR151c. These proteins all seem to start with a putative signal sequence followed by a conserved domain of about 90 residues. In TIR1, TIR2, TIP1, YIL011w, YJR150c and YJR151c, this domain is followed by a repetitive serine and alanine rich region absent in the other members of this family.; GO: 0006950 response to stress
Probab=26.09  E-value=48  Score=22.87  Aligned_cols=20  Identities=15%  Similarity=0.586  Sum_probs=15.8

Q ss_pred             chhhhhhHHHHHHHhhhChH
Q 034583           29 ASFLEDLRDHIDEFIHASMD   48 (90)
Q Consensus        29 atF~edlkDHi~EFihASmD   48 (90)
                      .-||+|++.|+.|++.--+.
T Consensus        17 ~~~l~Dv~snl~~Y~s~~~~   36 (104)
T PF00660_consen   17 TVLLSDVKSNLNDYMSLQMT   36 (104)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            45899999999999865433


No 5  
>PF08225 Antimicrobial19:  Pseudin antimicrobial peptide;  InterPro: IPR013156 Pseudins are a subfamily of the FSAP family (Frog Secreted Active Peptides) extracted from the skin of the paradoxical frog Pseudis paradoxa (Paradoxical frog). The pseudins belong to the class of cationic, amphipathic-helical antimicrobial peptides [].; GO: 0006952 defense response
Probab=25.40  E-value=45  Score=18.30  Aligned_cols=13  Identities=31%  Similarity=0.813  Sum_probs=9.8

Q ss_pred             HHHHHHhhhhhhh
Q 034583           56 KTVQKMFAGMSKI   68 (90)
Q Consensus        56 kti~kmF~gmSK~   68 (90)
                      ||++|.|.|+-.+
T Consensus         3 ntlkkv~qglhe~   15 (23)
T PF08225_consen    3 NTLKKVFQGLHEV   15 (23)
T ss_pred             hHHHHHHHHHHHH
Confidence            7889999887543


No 6  
>PF14278 TetR_C_8:  Transcriptional regulator C-terminal region
Probab=24.59  E-value=94  Score=17.55  Aligned_cols=25  Identities=32%  Similarity=0.606  Sum_probs=17.5

Q ss_pred             CCCchhhhhhHHHHHHHhhhChHHH
Q 034583           26 NDDASFLEDLRDHIDEFIHASMDAH   50 (90)
Q Consensus        26 ~d~atF~edlkDHi~EFihASmDEH   50 (90)
                      +.+..|.+.|++.+.+.+....+++
T Consensus        25 ~~~~~f~~~l~~~~~~~~~~~~~~~   49 (77)
T PF14278_consen   25 NGDPNFQERLKELIKEWITEYINEN   49 (77)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHh
Confidence            3477888888888877766555443


No 7  
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only]
Probab=19.81  E-value=69  Score=26.34  Aligned_cols=26  Identities=12%  Similarity=0.129  Sum_probs=23.2

Q ss_pred             CchhhhhhHHHHHHHhhhChHHHHHH
Q 034583           28 DASFLEDLRDHIDEFIHASMDAHKAC   53 (90)
Q Consensus        28 ~atF~edlkDHi~EFihASmDEHktC   53 (90)
                      ....+.++|.|||+|=+-|..|.+|+
T Consensus        10 ~~~~l~~~rr~lH~~PEL~f~E~~Ta   35 (392)
T COG1473          10 LKDELIEWRRDLHEHPELGFEEYRTA   35 (392)
T ss_pred             hhHHHHHHHHHHhhCCccchhHHHHH
Confidence            34568899999999999999999997


No 8  
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=18.81  E-value=64  Score=26.00  Aligned_cols=10  Identities=50%  Similarity=0.963  Sum_probs=8.7

Q ss_pred             hhhhHHHHHH
Q 034583           32 LEDLRDHIDE   41 (90)
Q Consensus        32 ~edlkDHi~E   41 (90)
                      ..|||||++|
T Consensus       129 WQDLKDHmRe  138 (241)
T KOG0105|consen  129 WQDLKDHMRE  138 (241)
T ss_pred             hHHHHHHHHh
Confidence            5799999987


No 9  
>PF14377 DUF4414:  Domain of unknown function (DUF4414)
Probab=17.59  E-value=48  Score=22.15  Aligned_cols=26  Identities=31%  Similarity=0.437  Sum_probs=22.1

Q ss_pred             ccCCCchhhhhhHHHHHHHhhhChHH
Q 034583           24 KKNDDASFLEDLRDHIDEFIHASMDA   49 (90)
Q Consensus        24 k~~d~atF~edlkDHi~EFihASmDE   49 (90)
                      .-.|+++|+..|=-++++=|-++|||
T Consensus        83 ~~~d~asflatl~p~LR~evL~~~~~  108 (108)
T PF14377_consen   83 QEMDNASFLATLPPELRREVLLDMDD  108 (108)
T ss_pred             CCCCHHHHHHhCCHHHHHHHhhccCC
Confidence            34568999999999999999888875


No 10 
>PF06108 DUF952:  Protein of unknown function (DUF952);  InterPro: IPR009297 This family consists of several hypothetical bacterial and plant proteins of unknown function.; PDB: 2O0Q_A 2O0P_A 2JQN_A.
Probab=17.42  E-value=59  Score=21.54  Aligned_cols=33  Identities=30%  Similarity=0.447  Sum_probs=21.3

Q ss_pred             hhhhhHHHHHHHhhhChHHHHHHHHHHHHHHhhhhh
Q 034583           31 FLEDLRDHIDEFIHASMDAHKACFKKTVQKMFAGMS   66 (90)
Q Consensus        31 F~edlkDHi~EFihASmDEHktCfkkti~kmF~gmS   66 (90)
                      +.-.-.|+=+-|||.|..+-   +..|.++.|+|-.
T Consensus        16 y~~~~ld~~dGFIH~St~~Q---v~~ta~~ff~~~~   48 (93)
T PF06108_consen   16 YPGSSLDTSDGFIHLSTAEQ---VPGTANRFFAGQE   48 (93)
T ss_dssp             E---HHHHHHTSEE-EEHHH---HHHHHHHHSTT--
T ss_pred             CCCCccccCCCEEEcCCHHH---HHHHHHHHcCCCC
Confidence            33344555688999998766   6799999997743


Done!