Citrus Sinensis ID: 034636


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNILAK
cccCEEccccccccCEEEEEECcHHHHHcccccccccHHHHHHHcccccccCEEEECcccccCEEEECcccccHHHHHHHHHHHHHHc
*GQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNILAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinases regulatory subunit 1 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentQ6PS57
Cyclin-dependent kinases regulatory subunit 2 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentQ9SJJ5
Cyclin-dependent kinases regulatory subunit 1 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentA2XCH8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CKS, chain A
Confidence level:very confident
Coverage over the Query: 2-73
View the alignment between query and template
View the model in PyMOL