Query         034649
Match_columns 88
No_of_seqs    102 out of 214
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:03:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034649.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034649hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06522 B12D:  NADH-ubiquinone  99.9 4.3E-26 9.4E-31  144.8   4.3   72    6-86      1-72  (73)
  2 PF05251 UPF0197:  Uncharacteri  79.3     3.4 7.5E-05   26.8   3.5   30    7-36     11-42  (77)
  3 PF06679 DUF1180:  Protein of u  68.4     7.1 0.00015   28.3   3.3   38   13-53     97-134 (163)
  4 PF01307 Plant_vir_prot:  Plant  61.3     7.5 0.00016   26.2   2.2   24   14-39     12-35  (104)
  5 PRK11677 hypothetical protein;  58.5      15 0.00032   25.9   3.3   51   16-70      6-58  (134)
  6 PF13056 DUF3918:  Protein of u  56.9      13 0.00028   21.7   2.4   16   16-31      7-22  (43)
  7 PF15114 UPF0640:  Uncharacteri  53.2     8.2 0.00018   24.6   1.2   13   10-22     25-37  (69)
  8 TIGR00847 ccoS cytochrome oxid  52.4      20 0.00043   21.4   2.7   23   11-33      7-29  (51)
  9 PF08216 CTNNBL:  Catenin-beta-  50.7     9.3  0.0002   26.1   1.3   17    8-24     76-92  (108)
 10 KOG2931 Differentiation-relate  48.5     3.7 7.9E-05   33.0  -1.1   37   16-52    123-164 (326)
 11 COG3592 Uncharacterized conser  47.6     8.2 0.00018   24.9   0.6   12   68-79     39-50  (74)
 12 PRK13755 putative mercury tran  46.5      29 0.00064   24.7   3.3   22   11-32     53-74  (139)
 13 PF03672 UPF0154:  Uncharacteri  46.4      42  0.0009   21.0   3.6   20   13-35      4-23  (64)
 14 TIGR03052 PS_I_psaI photosyste  46.2      39 0.00084   18.4   3.0   25    6-30      2-26  (31)
 15 PRK13707 conjugal transfer pil  45.5      28 0.00061   23.1   2.9   19   18-36     47-65  (101)
 16 PF03597 CcoS:  Cytochrome oxid  45.4      31 0.00066   20.0   2.7   22   11-32      6-27  (45)
 17 PF14962 AIF-MLS:  Mitochondria  43.1       8 0.00017   28.7   0.0   27   12-38     46-72  (180)
 18 PF03096 Ndr:  Ndr family;  Int  43.0     2.4 5.1E-05   33.2  -2.9   25   17-41    101-125 (283)
 19 KOG3491 Predicted membrane pro  40.2      61  0.0013   20.3   3.6   21   14-34     42-62  (65)
 20 COG3763 Uncharacterized protei  39.7      22 0.00047   22.8   1.6   22   11-35      9-30  (71)
 21 PF15050 SCIMP:  SCIMP protein   38.6      98  0.0021   22.0   4.9   57   15-81     16-73  (133)
 22 PF14880 COX14:  Cytochrome oxi  38.3      47   0.001   19.8   2.9   26   11-36     18-43  (59)
 23 PF10661 EssA:  WXG100 protein   36.7      43 0.00093   23.6   2.9   20   15-34    125-144 (145)
 24 CHL00186 psaI photosystem I su  36.3      65  0.0014   18.1   3.0   26    5-30      4-29  (36)
 25 PF13400 Tad:  Putative Flp pil  35.7      72  0.0016   17.7   3.3   22   11-32     11-32  (48)
 26 PF07178 TraL:  TraL protein;    35.4      65  0.0014   20.7   3.4   26    9-34     21-57  (95)
 27 PF07444 Ycf66_N:  Ycf66 protei  34.9      67  0.0014   20.9   3.4   25   14-40      9-33  (84)
 28 PF08114 PMP1_2:  ATPase proteo  34.4      66  0.0014   18.7   2.9   28    7-34      6-34  (43)
 29 PF12732 YtxH:  YtxH-like prote  34.1      55  0.0012   19.9   2.8   16   14-29      3-18  (74)
 30 PF14159 CAAD:  CAAD domains of  33.7      51  0.0011   21.4   2.7   19   20-38     55-73  (90)
 31 PRK11877 psaI photosystem I re  31.3      77  0.0017   18.0   2.8   26    5-30      8-33  (38)
 32 PF10907 DUF2749:  Protein of u  30.9      21 0.00045   22.6   0.4   20   57-76     36-56  (66)
 33 PF12606 RELT:  Tumour necrosis  30.6      88  0.0019   18.5   3.1   10   11-20      6-15  (50)
 34 PF11196 DUF2834:  Protein of u  30.5      77  0.0017   20.8   3.2   22   11-32     74-95  (97)
 35 PRK11367 hypothetical protein;  29.2      17 0.00037   30.2  -0.1   23   11-33      6-28  (476)
 36 COG3766 Predicted membrane pro  29.2      47   0.001   23.6   2.0   37   15-51     79-115 (133)
 37 PF09731 Mitofilin:  Mitochondr  27.7      46   0.001   27.4   2.1   26   11-40      8-33  (582)
 38 PLN02949 transferase, transfer  27.7      73  0.0016   25.9   3.2   40    4-45    107-148 (463)
 39 PF12072 DUF3552:  Domain of un  27.0      83  0.0018   22.8   3.1   20   14-33      4-23  (201)
 40 PF14654 Epiglycanin_C:  Mucin,  26.3      69  0.0015   21.9   2.4   22   12-33     23-45  (106)
 41 PF03232 COQ7:  Ubiquinone bios  26.3      97  0.0021   22.4   3.4   30    5-34     59-89  (172)
 42 PF06295 DUF1043:  Protein of u  25.9      77  0.0017   21.6   2.6   16   55-70     39-54  (128)
 43 PRK00523 hypothetical protein;  25.5      94   0.002   19.9   2.8   15   21-35     17-31  (72)
 44 PF12669 P12:  Virus attachment  24.8      57  0.0012   19.6   1.6   15   22-36      8-23  (58)
 45 PLN02777 photosystem I P subun  24.7      61  0.0013   23.9   2.0   19   20-38    130-148 (167)
 46 PF10269 Tmemb_185A:  Transmemb  23.9      81  0.0018   23.5   2.6   23   11-33    150-172 (238)
 47 PF06624 RAMP4:  Ribosome assoc  23.8      53  0.0011   20.3   1.4   28    6-33     34-61  (63)
 48 PRK11089 PTS system glucose-sp  23.7      56  0.0012   27.3   1.9   14   12-25     59-72  (477)
 49 KOG4431 Uncharacterized protei  23.5      67  0.0015   21.8   1.9   22   10-31     30-51  (100)
 50 TIGR02005 PTS-IIBC-alpha PTS s  23.5      53  0.0011   27.8   1.7   14   12-25     65-78  (524)
 51 PF15312 JSRP:  Junctional sarc  23.5 1.5E+02  0.0033   18.6   3.4   22   14-35     15-36  (65)
 52 PF04854 DUF624:  Protein of un  23.5      86  0.0019   18.8   2.3   18   20-37     22-39  (77)
 53 PRK07021 fliL flagellar basal   23.3      83  0.0018   22.0   2.5   14   18-31     29-42  (162)
 54 PF14898 DUF4491:  Domain of un  22.5 1.1E+02  0.0025   20.5   2.9   22   10-31     33-54  (94)
 55 cd00922 Cyt_c_Oxidase_IV Cytoc  22.3 1.3E+02  0.0029   20.9   3.3   19   16-34     81-99  (136)
 56 PF09527 ATPase_gene1:  Putativ  22.2 1.6E+02  0.0035   16.7   3.2   20   13-32     32-53  (55)
 57 PF02936 COX4:  Cytochrome c ox  22.0 1.3E+02  0.0028   21.1   3.2   23   15-37     80-102 (142)
 58 PF11654 DUF2665:  Protein of u  22.0   1E+02  0.0022   18.2   2.3   15   18-32     11-25  (47)
 59 PF05421 DUF751:  Protein of un  21.9 1.5E+02  0.0032   18.2   3.1   33    6-38      2-35  (61)
 60 TIGR02003 PTS-II-BC-unk1 PTS s  21.9      64  0.0014   27.4   1.9   14   12-25     63-76  (548)
 61 COG3105 Uncharacterized protei  21.7 1.4E+02   0.003   21.4   3.3   20   15-34     10-29  (138)
 62 PF05356 Phage_Coat_B:  Phage C  21.6 1.5E+02  0.0033   19.4   3.2   19   15-33     65-83  (83)
 63 MTH00030 ND3 NADH dehydrogenas  21.3 1.3E+02  0.0028   20.7   3.0   27    7-33      1-29  (123)
 64 PF13571 DUF4133:  Domain of un  20.9      62  0.0013   21.8   1.3   35   12-52     41-75  (96)
 65 PRK06287 cobalt transport prot  20.8 1.8E+02   0.004   19.3   3.7   24   12-35     79-102 (107)
 66 PF09574 DUF2374:  Protein  of   20.8 1.9E+02  0.0041   16.8   3.4   16   11-26     16-31  (42)
 67 PF15086 UPF0542:  Uncharacteri  20.7 1.3E+02  0.0028   19.4   2.7   19   11-33     30-48  (74)
 68 PHA02101 hypothetical protein   20.4      69  0.0015   21.5   1.5   33   21-53     60-92  (101)
 69 PF11833 DUF3353:  Protein of u  20.1 1.1E+02  0.0024   22.5   2.6   15   18-32    121-135 (194)
 70 TIGR02161 napC_nirT periplasmi  20.0 1.3E+02  0.0029   21.9   3.1   36    8-43     11-51  (185)
 71 PF08602 Mgr1:  Mgr1-like, i-AA  20.0 1.4E+02  0.0031   24.4   3.5   15   19-33     64-78  (363)

No 1  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=99.92  E-value=4.3e-26  Score=144.84  Aligned_cols=72  Identities=43%  Similarity=0.617  Sum_probs=68.9

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHhhcCCceeEecCCccccchhhhhhhhhhhhhHHHHHhhcCCCCcCccccccCC
Q 034649            6 WIRPEVFPLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLENYAEGEKYSEHFLRKYVRNKTPEIMPKINSFFT   85 (88)
Q Consensus         6 wi~pel~PL~~~vg~a~~~a~~~~~R~l~~nPdVr~~k~~r~~~v~~n~~eG~~y~~h~~R~~~~~~~p~i~p~ln~~f~   85 (88)
                      |.+|||||||+|||+|+++|+|+++|+|++||||+|+|++|       .+++++|++|..|||++.+. +|||.+|++ +
T Consensus         1 ~~~pel~PL~~~vg~a~~~a~~~~~r~l~~~PdV~~~k~~~-------~~pw~~~~~~~~~K~~~~~~-~~~~~~~~~-p   71 (73)
T PF06522_consen    1 KKHPELYPLFVIVGVAVGGATFYLYRLLLTNPDVRWNKKNR-------PEPWEKYKPHEQRKFYSINQ-DYMPLKNNF-P   71 (73)
T ss_pred             CCCccccchHHHHHHHHHHHHHHHHHHHhcCCCeEEEecCC-------cChhhhcCccccEEeecccc-ccccccccC-C
Confidence            89999999999999999999999999999999999999999       56799999999999999988 999999998 6


Q ss_pred             C
Q 034649           86 D   86 (88)
Q Consensus        86 ~   86 (88)
                      |
T Consensus        72 d   72 (73)
T PF06522_consen   72 D   72 (73)
T ss_pred             C
Confidence            5


No 2  
>PF05251 UPF0197:  Uncharacterised protein family (UPF0197);  InterPro: IPR007915 This family of proteins is functionally uncharacterised, but is thought to be a transmembrane protein.
Probab=79.28  E-value=3.4  Score=26.76  Aligned_cols=30  Identities=13%  Similarity=0.391  Sum_probs=21.0

Q ss_pred             CCCcchhHHHHH--HHHHHHHHHHHHHHhhcC
Q 034649            7 IRPEVFPLFAAV--GVAVGICGMQLVRNICIN   36 (88)
Q Consensus         7 i~pel~PL~~~v--g~a~~~a~~~~~R~l~~n   36 (88)
                      ++|++||.+.++  ++|.+..+++....++++
T Consensus        11 V~p~~~p~La~vll~iGl~fta~Ffiyevts~   42 (77)
T PF05251_consen   11 VNPALYPHLAVVLLAIGLFFTAWFFIYEVTST   42 (77)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Confidence            578999998775  445556677777766543


No 3  
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=68.41  E-value=7.1  Score=28.32  Aligned_cols=38  Identities=21%  Similarity=0.340  Sum_probs=26.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcCCceeEecCCccccchhh
Q 034649           13 PLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLEN   53 (88)
Q Consensus        13 PL~~~vg~a~~~a~~~~~R~l~~nPdVr~~k~~r~~~v~~n   53 (88)
                      -++|++|+.+.+..|+++|-+....   =.|+.|+.|++.+
T Consensus        97 ~~~Vl~g~s~l~i~yfvir~~R~r~---~~rktRkYgvl~~  134 (163)
T PF06679_consen   97 ALYVLVGLSALAILYFVIRTFRLRR---RNRKTRKYGVLTT  134 (163)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHhhcc---ccccceeecccCC
Confidence            3678888888999999999553221   1245567777765


No 4  
>PF01307 Plant_vir_prot:  Plant viral movement protein;  InterPro: IPR001896 This family of membrane/coat proteins are found in a number of different ssRNA plant virus families that include Potexvirus, Hordeivirus and Carlavirus.
Probab=61.30  E-value=7.5  Score=26.17  Aligned_cols=24  Identities=38%  Similarity=0.545  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcCCce
Q 034649           14 LFAAVGVAVGICGMQLVRNICINPEV   39 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~~R~l~~nPdV   39 (88)
                      |.+++|+++++++|.+.|+  +-|.|
T Consensus        12 l~~aiG~~lal~i~~ltr~--tlPhv   35 (104)
T PF01307_consen   12 LAAAIGVSLALIIFTLTRS--TLPHV   35 (104)
T ss_pred             hHHHHHHHHHHHHHHhhcC--CCCCC
Confidence            5678899999999999995  45654


No 5  
>PRK11677 hypothetical protein; Provisional
Probab=58.47  E-value=15  Score=25.88  Aligned_cols=51  Identities=31%  Similarity=0.464  Sum_probs=24.4

Q ss_pred             HHHHHHHHHH-HHHHHHHhhcCCceeEecCCccccchhh-hhhhhhhhhhHHHHHhh
Q 034649           16 AAVGVAVGIC-GMQLVRNICINPEVRVTKQNRAAGVLEN-YAEGEKYSEHFLRKYVR   70 (88)
Q Consensus        16 ~~vg~a~~~a-~~~~~R~l~~nPdVr~~k~~r~~~v~~n-~~eG~~y~~h~~R~~~~   70 (88)
                      +++|+.+|+. +|++.| + +++.+  .++.+...-+|. ..|=+.|++-..-||-.
T Consensus         6 a~i~livG~iiG~~~~R-~-~~~~~--~~q~~le~eLe~~k~ele~YkqeV~~HFa~   58 (134)
T PRK11677          6 ALIGLVVGIIIGAVAMR-F-GNRKL--RQQQALQYELEKNKAELEEYRQELVSHFAR   58 (134)
T ss_pred             HHHHHHHHHHHHHHHHh-h-ccchh--hHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444444 444555 4 45554  233333333333 24446677665555543


No 6  
>PF13056 DUF3918:  Protein of unknown function (DUF3918)
Probab=56.87  E-value=13  Score=21.66  Aligned_cols=16  Identities=13%  Similarity=0.347  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034649           16 AAVGVAVGICGMQLVR   31 (88)
Q Consensus        16 ~~vg~a~~~a~~~~~R   31 (88)
                      -.+++|+|+++|++.+
T Consensus         7 Slla~GaG~aAy~~A~   22 (43)
T PF13056_consen    7 SLLAFGAGAAAYQMAQ   22 (43)
T ss_pred             HHHHHhHHHHHHHHHH
Confidence            3577888888998874


No 7  
>PF15114 UPF0640:  Uncharacterised protein family UPF0640
Probab=53.22  E-value=8.2  Score=24.64  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=11.0

Q ss_pred             cchhHHHHHHHHH
Q 034649           10 EVFPLFAAVGVAV   22 (88)
Q Consensus        10 el~PL~~~vg~a~   22 (88)
                      -.+|+|+++|+|+
T Consensus        25 RFLP~FF~lGaal   37 (69)
T PF15114_consen   25 RFLPLFFVLGAAL   37 (69)
T ss_pred             hhhHHHHHhhhhh
Confidence            4689999999875


No 8  
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=52.38  E-value=20  Score=21.41  Aligned_cols=23  Identities=9%  Similarity=0.043  Sum_probs=18.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHh
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l   33 (88)
                      +||+-+++|+++..+.+-.+|+=
T Consensus         7 LIpiSl~l~~~~l~~f~Wavk~G   29 (51)
T TIGR00847         7 LIPISLLLGGVGLVAFLWSLKSG   29 (51)
T ss_pred             HHHHHHHHHHHHHHHHHHHHccC
Confidence            68888888888888887777743


No 9  
>PF08216 CTNNBL:  Catenin-beta-like, Arm-motif containing nuclear;  InterPro: IPR013180 This domain is found in eukaryotic proteins. A human nuclear protein with this domain (Q8WYA6 from SWISSPROT) is thought to have a role in apoptosis [].
Probab=50.73  E-value=9.3  Score=26.10  Aligned_cols=17  Identities=24%  Similarity=0.675  Sum_probs=13.3

Q ss_pred             CCcchhHHHHHHHHHHH
Q 034649            8 RPEVFPLFAAVGVAVGI   24 (88)
Q Consensus         8 ~pel~PL~~~vg~a~~~   24 (88)
                      .|++||+|+-.|+...+
T Consensus        76 ~P~LYp~lv~l~~v~sL   92 (108)
T PF08216_consen   76 APELYPELVELGAVPSL   92 (108)
T ss_pred             ChhHHHHHHHcCCHHHH
Confidence            58999999988765543


No 10 
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown]
Probab=48.49  E-value=3.7  Score=33.00  Aligned_cols=37  Identities=27%  Similarity=0.349  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhcCCcee-----EecCCccccchh
Q 034649           16 AAVGVAVGICGMQLVRNICINPEVR-----VTKQNRAAGVLE   52 (88)
Q Consensus        16 ~~vg~a~~~a~~~~~R~l~~nPdVr-----~~k~~r~~~v~~   52 (88)
                      .+||+|+|+.+|.++|-++.+|+--     ++-...+.+..|
T Consensus       123 ~vIg~GvGAGAyIL~rFAl~hp~rV~GLvLIn~~~~a~gwie  164 (326)
T KOG2931|consen  123 SVIGMGVGAGAYILARFALNHPERVLGLVLINCDPCAKGWIE  164 (326)
T ss_pred             eEEEecccccHHHHHHHHhcChhheeEEEEEecCCCCchHHH
Confidence            4589999999999999999999933     455555555444


No 11 
>COG3592 Uncharacterized conserved protein [Function unknown]
Probab=47.58  E-value=8.2  Score=24.88  Aligned_cols=12  Identities=33%  Similarity=0.656  Sum_probs=10.0

Q ss_pred             HhhcCCCCcCcc
Q 034649           68 YVRNKTPEIMPK   79 (88)
Q Consensus        68 ~~~~~~p~i~p~   79 (88)
                      |..+++|+|||.
T Consensus        39 F~~~rkPWI~Pd   50 (74)
T COG3592          39 FNLGRKPWIMPD   50 (74)
T ss_pred             cccCCCCccCCC
Confidence            457899999996


No 12 
>PRK13755 putative mercury transport protein MerC; Provisional
Probab=46.48  E-value=29  Score=24.74  Aligned_cols=22  Identities=32%  Similarity=0.514  Sum_probs=18.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHHH
Q 034649           11 VFPLFAAVGVAVGICGMQLVRN   32 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~   32 (88)
                      |+|||+++.+..-+.+|+.-|+
T Consensus        53 LlPlFA~iALlanalgW~sHRQ   74 (139)
T PRK13755         53 LLPLFAAIALLANALGWFSHRQ   74 (139)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            6899999988888888888775


No 13 
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=46.43  E-value=42  Score=20.99  Aligned_cols=20  Identities=25%  Similarity=0.267  Sum_probs=9.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhc
Q 034649           13 PLFAAVGVAVGICGMQLVRNICI   35 (88)
Q Consensus        13 PL~~~vg~a~~~a~~~~~R~l~~   35 (88)
                      .|.+++|++   ++||++|+-+.
T Consensus         4 ilali~G~~---~Gff~ar~~~~   23 (64)
T PF03672_consen    4 ILALIVGAV---IGFFIARKYME   23 (64)
T ss_pred             HHHHHHHHH---HHHHHHHHHHH
Confidence            344444433   34555655543


No 14 
>TIGR03052 PS_I_psaI photosystem I reaction center subunit VIII. Members of this protein family are PsaI, subunit VIII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen.
Probab=46.19  E-value=39  Score=18.39  Aligned_cols=25  Identities=24%  Similarity=0.235  Sum_probs=20.5

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHH
Q 034649            6 WIRPEVFPLFAAVGVAVGICGMQLV   30 (88)
Q Consensus         6 wi~pel~PL~~~vg~a~~~a~~~~~   30 (88)
                      |++.=++||...+-=|+++|..++.
T Consensus         2 ~LPsI~VPlVglvfPai~Ma~lf~y   26 (31)
T TIGR03052         2 WLPSIFVPLVGLVFPAVFMALLFRY   26 (31)
T ss_pred             CCceeehhHHHHHHHHHHHHHHHHh
Confidence            6777789999999888888887754


No 15 
>PRK13707 conjugal transfer pilus assembly protein TraL; Provisional
Probab=45.49  E-value=28  Score=23.14  Aligned_cols=19  Identities=11%  Similarity=0.121  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHhhcC
Q 034649           18 VGVAVGICGMQLVRNICIN   36 (88)
Q Consensus        18 vg~a~~~a~~~~~R~l~~n   36 (88)
                      +|+.+|++.+...|++-.+
T Consensus        47 ~g~i~g~~~~~~~r~lK~g   65 (101)
T PRK13707         47 FGIIAAVLVWFGIRKLKKG   65 (101)
T ss_pred             HHHHHHHHHHHHHHHHHcC
Confidence            5666777888888887544


No 16 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=45.43  E-value=31  Score=19.97  Aligned_cols=22  Identities=14%  Similarity=0.197  Sum_probs=16.8

Q ss_pred             chhHHHHHHHHHHHHHHHHHHH
Q 034649           11 VFPLFAAVGVAVGICGMQLVRN   32 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~   32 (88)
                      ++|+-+++|+++..+.+-.+|+
T Consensus         6 lip~sl~l~~~~l~~f~Wavk~   27 (45)
T PF03597_consen    6 LIPVSLILGLIALAAFLWAVKS   27 (45)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcc
Confidence            5788888888877777777664


No 17 
>PF14962 AIF-MLS:  Mitochondria Localisation Sequence; PDB: 1M6I_A.
Probab=43.15  E-value=8  Score=28.71  Aligned_cols=27  Identities=19%  Similarity=0.294  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcCCc
Q 034649           12 FPLFAAVGVAVGICGMQLVRNICINPE   38 (88)
Q Consensus        12 ~PL~~~vg~a~~~a~~~~~R~l~~nPd   38 (88)
                      +-.+++||+.+.++++|.+|-+..|..
T Consensus        46 ~~Y~l~vG~t~~gag~YaYkTv~~dq~   72 (180)
T PF14962_consen   46 MVYYLVVGVTVSGAGYYAYKTVKSDQA   72 (180)
T ss_dssp             ---------------------------
T ss_pred             EEEEEEECeEEEeeEEEEEEeecchhH
Confidence            456888999999999999998766643


No 18 
>PF03096 Ndr:  Ndr family;  InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted []. The precise molecular and cellular function of members of this family is still unknown, yet they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (Common sunflower), known as Sf21. Interestingly, the highest scoring matches in the noise are all alpha/beta hydrolases (IPR000073 from INTERPRO), suggesting that this family may have an enzymatic function.; PDB: 2QMQ_A 2XMR_B 2XMQ_B 2XMS_A.
Probab=43.02  E-value=2.4  Score=33.23  Aligned_cols=25  Identities=28%  Similarity=0.341  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCceeE
Q 034649           17 AVGVAVGICGMQLVRNICINPEVRV   41 (88)
Q Consensus        17 ~vg~a~~~a~~~~~R~l~~nPdVr~   41 (88)
                      +||+|+|+.++.++|.++.+|+...
T Consensus       101 vIg~GvGAGAnIL~rfAl~~p~~V~  125 (283)
T PF03096_consen  101 VIGFGVGAGANILARFALKHPERVL  125 (283)
T ss_dssp             EEEEEETHHHHHHHHHHHHSGGGEE
T ss_pred             EEEEeeccchhhhhhccccCcccee
Confidence            4788889999999999999998543


No 19 
>KOG3491 consensus Predicted membrane protein [Function unknown]
Probab=40.22  E-value=61  Score=20.31  Aligned_cols=21  Identities=29%  Similarity=0.192  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q 034649           14 LFAAVGVAVGICGMQLVRNIC   34 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~~R~l~   34 (88)
                      |.++|=+.+|+|.|+++|.+.
T Consensus        42 lglFvFVVcGSa~FqIIr~~~   62 (65)
T KOG3491|consen   42 LGLFVFVVCGSALFQIIRTAT   62 (65)
T ss_pred             HHHHHHHhhcHHHHHHHHHHh
Confidence            444455578889999999764


No 20 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.74  E-value=22  Score=22.83  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=12.1

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHhhc
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNICI   35 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l~~   35 (88)
                      +++|.+.+|+.+|   ||++|+.+.
T Consensus         9 ~ivl~ll~G~~~G---~fiark~~~   30 (71)
T COG3763           9 LIVLALLAGLIGG---FFIARKQMK   30 (71)
T ss_pred             HHHHHHHHHHHHH---HHHHHHHHH
Confidence            3444444444443   777777654


No 21 
>PF15050 SCIMP:  SCIMP protein
Probab=38.60  E-value=98  Score=21.95  Aligned_cols=57  Identities=19%  Similarity=0.262  Sum_probs=30.7

Q ss_pred             HHHHHHHHHHHHHHHHHHh-hcCCceeEecCCccccchhhhhhhhhhhhhHHHHHhhcCCCCcCcccc
Q 034649           15 FAAVGVAVGICGMQLVRNI-CINPEVRVTKQNRAAGVLENYAEGEKYSEHFLRKYVRNKTPEIMPKIN   81 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l-~~nPdVr~~k~~r~~~v~~n~~eG~~y~~h~~R~~~~~~~p~i~p~ln   81 (88)
                      +++|++++|+..|-..|.+ .....-.+.|.-++.    +.+|.+.|.+      +-+++|--.|.|+
T Consensus        16 II~vS~~lglIlyCvcR~~lRqGkkweiakp~k~~----~rdeEkmYEN------v~n~~~~~LPpLP   73 (133)
T PF15050_consen   16 IILVSVVLGLILYCVCRWQLRQGKKWEIAKPLKQK----QRDEEKMYEN------VLNQSPVQLPPLP   73 (133)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHccccceeccchhhh----cccHHHHHHH------hhcCCcCCCCCCC
Confidence            4556777777666555544 334444444433332    2455666653      3455665555553


No 22 
>PF14880 COX14:  Cytochrome oxidase c assembly
Probab=38.27  E-value=47  Score=19.80  Aligned_cols=26  Identities=15%  Similarity=0.074  Sum_probs=20.8

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHhhcC
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNICIN   36 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l~~n   36 (88)
                      ++-|+.+.+.|++++++..++....+
T Consensus        18 V~~Lig~T~~~g~~~~~~~y~~~~~~   43 (59)
T PF14880_consen   18 VLGLIGFTVYGGGLTVYTVYSYFKYN   43 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46678888888899999988877655


No 23 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=36.74  E-value=43  Score=23.60  Aligned_cols=20  Identities=10%  Similarity=0.077  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 034649           15 FAAVGVAVGICGMQLVRNIC   34 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l~   34 (88)
                      ++.+-+++|+.+|...|+++
T Consensus       125 i~g~ll~i~~giy~~~r~~~  144 (145)
T PF10661_consen  125 IGGILLAICGGIYVVLRKVW  144 (145)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            33344677888999999875


No 24 
>CHL00186 psaI photosystem I subunit VIII; Validated
Probab=36.28  E-value=65  Score=18.09  Aligned_cols=26  Identities=19%  Similarity=0.227  Sum_probs=21.3

Q ss_pred             CCCCCcchhHHHHHHHHHHHHHHHHH
Q 034649            5 RWIRPEVFPLFAAVGVAVGICGMQLV   30 (88)
Q Consensus         5 ~wi~pel~PL~~~vg~a~~~a~~~~~   30 (88)
                      .|+|.=+.||...+-=|+++|.++++
T Consensus         4 s~LPsI~VPlVGlvfPai~Ma~lf~y   29 (36)
T CHL00186          4 SNLPSILVPLVGLVFPAIAMASLFLY   29 (36)
T ss_pred             ccCchhHHhHHHHHHHHHHHHHHHHH
Confidence            47788889999999888888877654


No 25 
>PF13400 Tad:  Putative Flp pilus-assembly TadE/G-like
Probab=35.66  E-value=72  Score=17.74  Aligned_cols=22  Identities=27%  Similarity=0.564  Sum_probs=14.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHHH
Q 034649           11 VFPLFAAVGVAVGICGMQLVRN   32 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~   32 (88)
                      ++|+++++|+++-..-.+..|.
T Consensus        11 ~~~~l~~~~~~id~~~~~~~r~   32 (48)
T PF13400_consen   11 LVPLLLLIGLAIDVGRAYLART   32 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4677777777776666666553


No 26 
>PF07178 TraL:  TraL protein;  InterPro: IPR009838 This entry represents bacterial TraL proteins. TraL is a predicted peripheral membrane protein involved in bacterial sex pilus assembly []. TraL is part of the type IV secretion system for conjugative plasmid transfer []. The exact function of TraL is unknown.; GO: 0000746 conjugation, 0019867 outer membrane
Probab=35.37  E-value=65  Score=20.71  Aligned_cols=26  Identities=23%  Similarity=0.304  Sum_probs=16.5

Q ss_pred             CcchhHHHH-----------HHHHHHHHHHHHHHHhh
Q 034649            9 PEVFPLFAA-----------VGVAVGICGMQLVRNIC   34 (88)
Q Consensus         9 pel~PL~~~-----------vg~a~~~a~~~~~R~l~   34 (88)
                      -|++|.+++           +|+++|.+.+...|++-
T Consensus        21 De~~~~~~~~~~gi~~~~~~~g~i~g~~~~~~~~k~K   57 (95)
T PF07178_consen   21 DEFIPALILFVIGILSGHFLIGLILGIVLWWGYRKFK   57 (95)
T ss_pred             HHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHH
Confidence            366666655           45556667777777763


No 27 
>PF07444 Ycf66_N:  Ycf66 protein N-terminus;  InterPro: IPR010004 This entry represents Ycf66, a protein that is restricted to the chloroplasts of simple plants and algae. It is also found in the cyanobacteria. The function is unknown. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=34.89  E-value=67  Score=20.95  Aligned_cols=25  Identities=20%  Similarity=0.335  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcCCcee
Q 034649           14 LFAAVGVAVGICGMQLVRNICINPEVR   40 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~~R~l~~nPdVr   40 (88)
                      .++.+++++++.+.|..|..  .|+|+
T Consensus         9 ~iLgi~l~~~~~~Ly~lr~~--~Pev~   33 (84)
T PF07444_consen    9 YILGIILILGGLALYFLRFF--RPEVS   33 (84)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--Ccchh
Confidence            44556777777778877744  77764


No 28 
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=34.40  E-value=66  Score=18.74  Aligned_cols=28  Identities=25%  Similarity=0.465  Sum_probs=17.6

Q ss_pred             CCCcchhHHHHHHHH-HHHHHHHHHHHhh
Q 034649            7 IRPEVFPLFAAVGVA-VGICGMQLVRNIC   34 (88)
Q Consensus         7 i~pel~PL~~~vg~a-~~~a~~~~~R~l~   34 (88)
                      +|-.+|=.|+.+|++ ++..+.+.+|+..
T Consensus         6 lp~GVIlVF~lVglv~i~iva~~iYRKw~   34 (43)
T PF08114_consen    6 LPGGVILVFCLVGLVGIGIVALFIYRKWQ   34 (43)
T ss_pred             CCCCeeeehHHHHHHHHHHHHHHHHHHHH
Confidence            344566667777654 4556677888764


No 29 
>PF12732 YtxH:  YtxH-like protein;  InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved.
Probab=34.06  E-value=55  Score=19.92  Aligned_cols=16  Identities=31%  Similarity=0.216  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034649           14 LFAAVGVAVGICGMQL   29 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~   29 (88)
                      +.+++|+++|+++.++
T Consensus         3 ~g~l~Ga~~Ga~~glL   18 (74)
T PF12732_consen    3 LGFLAGAAAGAAAGLL   18 (74)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3456677777666655


No 30 
>PF14159 CAAD:  CAAD domains of cyanobacterial aminoacyl-tRNA synthetase
Probab=33.66  E-value=51  Score=21.42  Aligned_cols=19  Identities=21%  Similarity=0.361  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHhhcCCc
Q 034649           20 VAVGICGMQLVRNICINPE   38 (88)
Q Consensus        20 ~a~~~a~~~~~R~l~~nPd   38 (88)
                      +|++-.+|+.+|+|...++
T Consensus        55 vGlgyt~wF~~ryLL~~~~   73 (90)
T PF14159_consen   55 VGLGYTGWFVYRYLLFAEN   73 (90)
T ss_pred             HHHHHHhHHHHHHHcChHh
Confidence            4555679999999986543


No 31 
>PRK11877 psaI photosystem I reaction center subunit VIII; Reviewed
Probab=31.29  E-value=77  Score=17.98  Aligned_cols=26  Identities=23%  Similarity=0.138  Sum_probs=20.9

Q ss_pred             CCCCCcchhHHHHHHHHHHHHHHHHH
Q 034649            5 RWIRPEVFPLFAAVGVAVGICGMQLV   30 (88)
Q Consensus         5 ~wi~pel~PL~~~vg~a~~~a~~~~~   30 (88)
                      .|+|.=++||...+-=|+.++..++.
T Consensus         8 s~LPsI~VPlVGlvfPai~Mallf~y   33 (38)
T PRK11877          8 SWLPWIFVPLVGWVFPAVFMVLLGRY   33 (38)
T ss_pred             HhCchHHHHHHHHHHHHHHHHHHHHH
Confidence            47888889999999888888876653


No 32 
>PF10907 DUF2749:  Protein of unknown function (DUF2749);  InterPro: IPR024475 This bacterial family of proteins represent the TrbJ and TrbK genes of the Ti plasmid conjugative transfer operon [].
Probab=30.89  E-value=21  Score=22.64  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=11.7

Q ss_pred             hhhhhhhHHHHHhhcCC-CCc
Q 034649           57 GEKYSEHFLRKYVRNKT-PEI   76 (88)
Q Consensus        57 G~~y~~h~~R~~~~~~~-p~i   76 (88)
                      ++..++|+=+.|-.+.. |.|
T Consensus        36 ~eeQr~~re~ff~~~~~l~~i   56 (66)
T PF10907_consen   36 SEEQRAHREKFFGGDKDLRDI   56 (66)
T ss_pred             hHHHHHHHHHHcCCCCCCCCC
Confidence            45566776666665555 444


No 33 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=30.59  E-value=88  Score=18.54  Aligned_cols=10  Identities=20%  Similarity=0.757  Sum_probs=7.6

Q ss_pred             chhHHHHHHH
Q 034649           11 VFPLFAAVGV   20 (88)
Q Consensus        11 l~PL~~~vg~   20 (88)
                      ++|+|+++|+
T Consensus         6 iV~i~iv~~l   15 (50)
T PF12606_consen    6 IVSIFIVMGL   15 (50)
T ss_pred             HHHHHHHHHH
Confidence            6788887776


No 34 
>PF11196 DUF2834:  Protein of unknown function (DUF2834);  InterPro: IPR021362  This is a bacterial family of uncharacterised proteins. 
Probab=30.47  E-value=77  Score=20.80  Aligned_cols=22  Identities=27%  Similarity=0.265  Sum_probs=19.0

Q ss_pred             chhHHHHHHHHHHHHHHHHHHH
Q 034649           11 VFPLFAAVGVAVGICGMQLVRN   32 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~   32 (88)
                      .+|+-+++|+++|..-|...|.
T Consensus        74 ~i~~t~~vgvs~glPLyL~lRe   95 (97)
T PF11196_consen   74 YIVLTFFVGVSFGLPLYLYLRE   95 (97)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            6888999999999998888874


No 35 
>PRK11367 hypothetical protein; Provisional
Probab=29.22  E-value=17  Score=30.19  Aligned_cols=23  Identities=17%  Similarity=0.004  Sum_probs=20.3

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHh
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l   33 (88)
                      ..=++|++|++.++++||+..++
T Consensus         6 a~gVIVaLga~wtGgsWYTGk~i   28 (476)
T PRK11367          6 ATGVIVALAVIWGGGTWYTGTQI   28 (476)
T ss_pred             hhhhhhhhhhhhccccceechHH
Confidence            46678999999999999999876


No 36 
>COG3766 Predicted membrane protein [Function unknown]
Probab=29.15  E-value=47  Score=23.64  Aligned_cols=37  Identities=22%  Similarity=0.370  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcCCceeEecCCccccch
Q 034649           15 FAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVL   51 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l~~nPdVr~~k~~r~~~v~   51 (88)
                      ..++|+.+-+.+|+..|.++.|=|.++...|...|.+
T Consensus        79 Wg~~~~vvqLl~f~i~~~l~p~l~~~I~ngn~AaG~~  115 (133)
T COG3766          79 WGAIALVVQLLVFFIVRLLMPDLDEKIENGNVAAGFI  115 (133)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCccHHHHhcCcchHHHH
Confidence            3568888899999999999998888888777776644


No 37 
>PF09731 Mitofilin:  Mitochondrial inner membrane protein;  InterPro: IPR019133  Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex []. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence (residues 1-43) rich in positive-charged and hydroxylated residues and a membrane anchor domain (residues 47-66). In addition, it has three centrally located coiled coil domains (residues 200-240,280-310 and 400-420) []. ; GO: 0031305 integral to mitochondrial inner membrane
Probab=27.73  E-value=46  Score=27.43  Aligned_cols=26  Identities=19%  Similarity=0.043  Sum_probs=19.5

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHhhcCCcee
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNICINPEVR   40 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l~~nPdVr   40 (88)
                      |+-+++++|+|.|+++||...    ||+++
T Consensus         8 l~~~~l~~~~~ygG~v~yA~~----n~~f~   33 (582)
T PF09731_consen    8 LLYTTLLGGVGYGGGVYYAKQ----NDNFR   33 (582)
T ss_pred             HHHHHHHHHHHHHHHHHHhhc----ChHHH
Confidence            566778888888888888765    65554


No 38 
>PLN02949 transferase, transferring glycosyl groups
Probab=27.65  E-value=73  Score=25.89  Aligned_cols=40  Identities=18%  Similarity=0.425  Sum_probs=25.9

Q ss_pred             CCCCCCcchhHHHHHHHHH--HHHHHHHHHHhhcCCceeEecCC
Q 034649            4 NRWIRPEVFPLFAAVGVAV--GICGMQLVRNICINPEVRVTKQN   45 (88)
Q Consensus         4 ~~wi~pel~PL~~~vg~a~--~~a~~~~~R~l~~nPdVr~~k~~   45 (88)
                      +.|+++.++|-|-.+|-.+  ..++|..+++  .-|+|-+|--.
T Consensus       107 ~~~~~~~~~~~~t~~~~~~~~~~l~~~~~~~--~~p~v~vDt~~  148 (463)
T PLN02949        107 RKWIEEETYPRFTMIGQSLGSVYLAWEALCK--FTPLYFFDTSG  148 (463)
T ss_pred             ccccccccCCceehHHHHHHHHHHHHHHHHh--cCCCEEEeCCC
Confidence            6899999999955555444  3444444443  35778777655


No 39 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=27.05  E-value=83  Score=22.77  Aligned_cols=20  Identities=40%  Similarity=0.391  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q 034649           14 LFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~~R~l   33 (88)
                      |++++|+++|+++.|+++..
T Consensus         4 i~~i~~~~vG~~~G~~~~~~   23 (201)
T PF12072_consen    4 IIAIVALIVGIGIGYLVRKK   23 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44555555555555555444


No 40 
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=26.33  E-value=69  Score=21.94  Aligned_cols=22  Identities=27%  Similarity=0.120  Sum_probs=14.5

Q ss_pred             hhHH-HHHHHHHHHHHHHHHHHh
Q 034649           12 FPLF-AAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        12 ~PL~-~~vg~a~~~a~~~~~R~l   33 (88)
                      |-|+ |++++|...+.|+++|+.
T Consensus        23 ItLasVvvavGl~aGLfFcvR~~   45 (106)
T PF14654_consen   23 ITLASVVVAVGLFAGLFFCVRNS   45 (106)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhc
Confidence            4444 345667777788898874


No 41 
>PF03232 COQ7:  Ubiquinone biosynthesis protein COQ7;  InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ]. It has been implicated in the aging process as mutations in the Caenorhabditis elegans gene lead to increased lifespan []. Coq7 is a membrane-bound protein that functions as a monooxygenase to hydroxylate demethoxyubiquinone (2-methoxy-5-methyl-6-polyprenyl-1,4-benzoquinone) in the penultimate step of ubiquinone biosynthesis []. Biochemical studies indicate that NADH can serve directly as a reductant for catalytic activation of dioxygen and substrate oxidation by the enzyme, with no requirement for an additional reductase protein component []. This direct reaction with NADH is so far unique amongst members of the di-iron carboxylate protein family. This entry is specific for the bacterial Coq7 proteins.; GO: 0006744 ubiquinone biosynthetic process, 0055114 oxidation-reduction process
Probab=26.31  E-value=97  Score=22.38  Aligned_cols=30  Identities=27%  Similarity=0.406  Sum_probs=23.2

Q ss_pred             CCCCCcc-hhHHHHHHHHHHHHHHHHHHHhh
Q 034649            5 RWIRPEV-FPLFAAVGVAVGICGMQLVRNIC   34 (88)
Q Consensus         5 ~wi~pel-~PL~~~vg~a~~~a~~~~~R~l~   34 (88)
                      +-++|.+ .||+-+.|+++|+++-.+.++..
T Consensus        59 ~~~RpS~l~Plw~~~g~~LG~~tal~G~~~~   89 (172)
T PF03232_consen   59 LRVRPSLLNPLWYVAGFALGALTALLGDKAA   89 (172)
T ss_pred             cCCCCcHHHHHHHHHHHHHHHHHHhhchHHH
Confidence            4456654 69999999999998887777653


No 42 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=25.93  E-value=77  Score=21.56  Aligned_cols=16  Identities=19%  Similarity=0.380  Sum_probs=9.5

Q ss_pred             hhhhhhhhhHHHHHhh
Q 034649           55 AEGEKYSEHFLRKYVR   70 (88)
Q Consensus        55 ~eG~~y~~h~~R~~~~   70 (88)
                      .|=+.|++-.-.+|..
T Consensus        39 ~el~~yk~~V~~HF~~   54 (128)
T PF06295_consen   39 QELEQYKQEVNDHFAQ   54 (128)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4446777666655554


No 43 
>PRK00523 hypothetical protein; Provisional
Probab=25.52  E-value=94  Score=19.89  Aligned_cols=15  Identities=20%  Similarity=0.313  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHhhc
Q 034649           21 AVGICGMQLVRNICI   35 (88)
Q Consensus        21 a~~~a~~~~~R~l~~   35 (88)
                      +++..+||.+|+.+.
T Consensus        17 ~G~~~Gffiark~~~   31 (72)
T PRK00523         17 VGGIIGYFVSKKMFK   31 (72)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333456777776654


No 44 
>PF12669 P12:  Virus attachment protein p12 family
Probab=24.80  E-value=57  Score=19.58  Aligned_cols=15  Identities=7%  Similarity=0.005  Sum_probs=7.2

Q ss_pred             HHHHHHH-HHHHhhcC
Q 034649           22 VGICGMQ-LVRNICIN   36 (88)
Q Consensus        22 ~~~a~~~-~~R~l~~n   36 (88)
                      +.++++| ++|++.++
T Consensus         8 i~~~~~~v~~r~~~k~   23 (58)
T PF12669_consen    8 ILAAVAYVAIRKFIKD   23 (58)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3333444 34666544


No 45 
>PLN02777 photosystem I P subunit (PSI-P)
Probab=24.72  E-value=61  Score=23.87  Aligned_cols=19  Identities=26%  Similarity=0.606  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHhhcCCc
Q 034649           20 VAVGICGMQLVRNICINPE   38 (88)
Q Consensus        20 ~a~~~a~~~~~R~l~~nPd   38 (88)
                      +|++-.+||.+|+|+..++
T Consensus       130 VGigYs~WF~yRyLLfke~  148 (167)
T PLN02777        130 VGIGYTGWFAYKNLVFKPD  148 (167)
T ss_pred             hhhhhhhhhhhhHhcCccc
Confidence            3455569999999987654


No 46 
>PF10269 Tmemb_185A:  Transmembrane Fragile-X-F protein ;  InterPro: IPR019396  This entry represents conserved transmembrane proteins that in humans are expressed from a region upstream of the FragileXF site and appear to be intimately linked with Fragile-X syndrome. The absence of the human TMEM185A protein does not necessarily lead to developmental delay, but might, in combination with other, currently unknown, factors. Alternatively, the TMEM185A protein is either redundant, or its function can be complemented by the highly similar chromosome 2 retro-pseudogene product, TMEM185B []. 
Probab=23.85  E-value=81  Score=23.48  Aligned_cols=23  Identities=30%  Similarity=0.592  Sum_probs=19.1

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHh
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l   33 (88)
                      .+|++++.|++...+.+++.+.+
T Consensus       150 FiPl~i~~~~~~~~~~~~~i~~~  172 (238)
T PF10269_consen  150 FIPLWIADGLAFLVCLYSIIMSI  172 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            48999999999998888876655


No 47 
>PF06624 RAMP4:  Ribosome associated membrane protein RAMP4;  InterPro: IPR010580 This entry contains Serp1/Ramp4, which has been shown to interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It has also been shown to protect unfolded target proteins against degradation during ER stress. It may facilitate glycosylation of target proteins after termination of ER stress and may modulate the use of N-glycosylation sites on target proteins [, ].
Probab=23.82  E-value=53  Score=20.31  Aligned_cols=28  Identities=21%  Similarity=0.110  Sum_probs=20.5

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHh
Q 034649            6 WIRPEVFPLFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus         6 wi~pel~PL~~~vg~a~~~a~~~~~R~l   33 (88)
                      ..+..-+-|.+++=+.+|+++|.++|.+
T Consensus        34 k~pVgp~~L~l~iFVV~Gs~ifqiir~i   61 (63)
T PF06624_consen   34 KYPVGPWLLGLFIFVVCGSAIFQIIRSI   61 (63)
T ss_pred             cCCcCHHHHhhhheeeEcHHHHHHHHHH
Confidence            3455556667777778888999999965


No 48 
>PRK11089 PTS system glucose-specific transporter subunits  IIBC; Provisional
Probab=23.75  E-value=56  Score=27.28  Aligned_cols=14  Identities=50%  Similarity=0.921  Sum_probs=12.4

Q ss_pred             hhHHHHHHHHHHHH
Q 034649           12 FPLFAAVGVAVGIC   25 (88)
Q Consensus        12 ~PL~~~vg~a~~~a   25 (88)
                      +||++|||+|+|+|
T Consensus        59 LpllFavgia~g~a   72 (477)
T PRK11089         59 MPLIFAIGVALGFT   72 (477)
T ss_pred             cHHHHHHHHHHHHh
Confidence            69999999998876


No 49 
>KOG4431 consensus Uncharacterized protein, induced by hypoxia  [General function prediction only]
Probab=23.52  E-value=67  Score=21.75  Aligned_cols=22  Identities=23%  Similarity=0.170  Sum_probs=19.1

Q ss_pred             cchhHHHHHHHHHHHHHHHHHH
Q 034649           10 EVFPLFAAVGVAVGICGMQLVR   31 (88)
Q Consensus        10 el~PL~~~vg~a~~~a~~~~~R   31 (88)
                      .++||.+...+|+..++.|.+|
T Consensus        30 P~VPlG~l~t~aal~~g~y~~r   51 (100)
T KOG4431|consen   30 PLVPLGCLGTTAALTAGLYKFR   51 (100)
T ss_pred             CCeeehHHHHHHHHHHHhhhhh
Confidence            5789999999999888888888


No 50 
>TIGR02005 PTS-IIBC-alpha PTS system, alpha-glucoside-specific IIBC component. This model represents a family of fused PTS enzyme II B and C domains. A gene from Clostridium has been partially characterized as a maltose transporter, while genes from Fusobacterium and Klebsiella have been proposed to transport the five non-standard isomers of sucrose.
Probab=23.51  E-value=53  Score=27.77  Aligned_cols=14  Identities=36%  Similarity=0.883  Sum_probs=11.9

Q ss_pred             hhHHHHHHHHHHHH
Q 034649           12 FPLFAAVGVAVGIC   25 (88)
Q Consensus        12 ~PL~~~vg~a~~~a   25 (88)
                      +||++|||+|+|+|
T Consensus        65 LpllFAvgia~Gla   78 (524)
T TIGR02005        65 MPLIFVVGLPIGLA   78 (524)
T ss_pred             chHHHHHHHHHHhc
Confidence            79999999988765


No 51 
>PF15312 JSRP:  Junctional sarcoplasmic reticulum protein
Probab=23.51  E-value=1.5e+02  Score=18.61  Aligned_cols=22  Identities=32%  Similarity=0.202  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Q 034649           14 LFAAVGVAVGICGMQLVRNICI   35 (88)
Q Consensus        14 L~~~vg~a~~~a~~~~~R~l~~   35 (88)
                      |+++..+++-+.+|++.|.+..
T Consensus        15 LvlAslValL~s~fq~~~dav~   36 (65)
T PF15312_consen   15 LVLASLVALLGSGFQLCHDAVR   36 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Confidence            6788889999999999996654


No 52 
>PF04854 DUF624:  Protein of unknown function, DUF624;  InterPro: IPR006938 This family consists of uncharacterised or hypothetical bacterial proteins.
Probab=23.48  E-value=86  Score=18.77  Aligned_cols=18  Identities=11%  Similarity=-0.042  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHhhcCC
Q 034649           20 VAVGICGMQLVRNICINP   37 (88)
Q Consensus        20 ~a~~~a~~~~~R~l~~nP   37 (88)
                      +....|.+++.|+...++
T Consensus        22 gPA~~Al~~~~~~~~~~~   39 (77)
T PF04854_consen   22 GPATAALYYVVRKWVRDE   39 (77)
T ss_pred             HHHHHHHHHHHHHHHcCC
Confidence            344556777888777776


No 53 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=23.28  E-value=83  Score=21.99  Aligned_cols=14  Identities=14%  Similarity=-0.052  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHHH
Q 034649           18 VGVAVGICGMQLVR   31 (88)
Q Consensus        18 vg~a~~~a~~~~~R   31 (88)
                      +|+|++++.|++.+
T Consensus        29 ~~~g~gg~~~~~~~   42 (162)
T PRK07021         29 AAAAGAGYSWWLSK   42 (162)
T ss_pred             HHHHHHHHHHHhhc
Confidence            33344444444443


No 54 
>PF14898 DUF4491:  Domain of unknown function (DUF4491)
Probab=22.49  E-value=1.1e+02  Score=20.46  Aligned_cols=22  Identities=23%  Similarity=0.546  Sum_probs=17.3

Q ss_pred             cchhHHHHHHHHHHHHHHHHHH
Q 034649           10 EVFPLFAAVGVAVGICGMQLVR   31 (88)
Q Consensus        10 el~PL~~~vg~a~~~a~~~~~R   31 (88)
                      ...|+|+++|++...++.++.-
T Consensus        33 ~~W~~FL~~Gi~~~~~Sl~~~~   54 (94)
T PF14898_consen   33 RIWPIFLLAGIACIIASLFVSN   54 (94)
T ss_pred             CcHHHHHHHHHHHHHHHHHHcc
Confidence            4679999999998888776543


No 55 
>cd00922 Cyt_c_Oxidase_IV Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform.
Probab=22.32  E-value=1.3e+02  Score=20.86  Aligned_cols=19  Identities=11%  Similarity=-0.017  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 034649           16 AAVGVAVGICGMQLVRNIC   34 (88)
Q Consensus        16 ~~vg~a~~~a~~~~~R~l~   34 (88)
                      +++++++++.+|...|...
T Consensus        81 ~~~~i~~s~~~~~~~r~~~   99 (136)
T cd00922          81 VLAFIGITGVIFGLQRAFV   99 (136)
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            5566777888899999776


No 56 
>PF09527 ATPase_gene1:  Putative F0F1-ATPase subunit (ATPase_gene1)
Probab=22.21  E-value=1.6e+02  Score=16.72  Aligned_cols=20  Identities=20%  Similarity=0.398  Sum_probs=10.5

Q ss_pred             hHHHHHH--HHHHHHHHHHHHH
Q 034649           13 PLFAAVG--VAVGICGMQLVRN   32 (88)
Q Consensus        13 PL~~~vg--~a~~~a~~~~~R~   32 (88)
                      |++..+|  +|++++.+++.|.
T Consensus        32 p~~~~~g~llG~~~g~~~~~~~   53 (55)
T PF09527_consen   32 PWFTLIGLLLGIAAGFYNVYRL   53 (55)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Confidence            4444443  4445556666664


No 57 
>PF02936 COX4:  Cytochrome c oxidase subunit IV;  InterPro: IPR004203 Cytochrome c oxidase, a 13 sub-unit complex (1.9.3.1 from EC) is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit IV. The Dictyostelium discoideum (Slime mould) member of this family is called COX VI. The Saccharomyces cerevisiae protein YGX6_YEAST appears to be the yeast COX IV subunit.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3ABK_Q 3AG1_Q 3ASN_Q 1OCZ_D 2EIN_Q 2OCC_D 2YBB_O 3AG3_D 1OCO_Q 1V55_Q ....
Probab=22.00  E-value=1.3e+02  Score=21.09  Aligned_cols=23  Identities=9%  Similarity=0.005  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcCC
Q 034649           15 FAAVGVAVGICGMQLVRNICINP   37 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l~~nP   37 (88)
                      .+++++++++++|...|.....|
T Consensus        80 ~~~~~i~~s~~l~~~~r~~~~~~  102 (142)
T PF02936_consen   80 GVFIFIGFSVLLFIWQRSYVYPP  102 (142)
T ss_dssp             HHHHHHHHHHHHHHHHHHHT---
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCC
Confidence            45677788888888999775543


No 58 
>PF11654 DUF2665:  Protein of unknown function (DUF2665);  InterPro: IPR024242 This entry represents the non classical export protein 1 family. Family members are Involved in a novel pathway of export of proteins that lack a cleavable signal sequence [].; GO: 0009306 protein secretion
Probab=21.98  E-value=1e+02  Score=18.18  Aligned_cols=15  Identities=27%  Similarity=0.370  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHH
Q 034649           18 VGVAVGICGMQLVRN   32 (88)
Q Consensus        18 vg~a~~~a~~~~~R~   32 (88)
                      +|+++|.++|++.-+
T Consensus        11 ~av~iG~~ayyl~e~   25 (47)
T PF11654_consen   11 FAVFIGTSAYYLYEN   25 (47)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            455667777777654


No 59 
>PF05421 DUF751:  Protein of unknown function (DUF751);  InterPro: IPR008470 This family, Ycf33, contains several plant, cyanobacterial and algal chlorplast encoded proteins of unknown function. The family is exclusively found in phototrophic organisms and may therefore play a role in photosynthesis.
Probab=21.93  E-value=1.5e+02  Score=18.20  Aligned_cols=33  Identities=15%  Similarity=0.293  Sum_probs=21.5

Q ss_pred             CCCCcchhHHHH-HHHHHHHHHHHHHHHhhcCCc
Q 034649            6 WIRPEVFPLFAA-VGVAVGICGMQLVRNICINPE   38 (88)
Q Consensus         6 wi~pel~PL~~~-vg~a~~~a~~~~~R~l~~nPd   38 (88)
                      |-+..=||-|++ +.+|+..+.+.-...+.+||.
T Consensus         2 w~Nv~RYpry~is~~lG~~~~~~~pl~~llk~p~   35 (61)
T PF05421_consen    2 WDNVSRYPRYFISVMLGLFLIIFEPLKPLLKNPV   35 (61)
T ss_pred             chHHHHhhHHHHHHHHHHHHHHHHHHHHHhcCch
Confidence            444445676554 666777777777777777764


No 60 
>TIGR02003 PTS-II-BC-unk1 PTS system, IIBC component. This model represents a family of fused B and C components of PTS enzyme II. This clade is a member of a larger family which contains enzyme II's specific for a variety of sugars including glucose (TIGR02002) and N-acetylglucosamine (TIGR01998). None of the members of this clade have been experimentally characterized. This clade includes sequences from Streptococcus and Enterococcus which also include a C-terminal A domain as well as Bacillus and Clostridium which do not. In nearly all cases, these species also contain an authentic glucose-specific PTS transporter.
Probab=21.89  E-value=64  Score=27.44  Aligned_cols=14  Identities=7%  Similarity=0.180  Sum_probs=12.4

Q ss_pred             hhHHHHHHHHHHHH
Q 034649           12 FPLFAAVGVAVGIC   25 (88)
Q Consensus        12 ~PL~~~vg~a~~~a   25 (88)
                      +||++|||+|+|+|
T Consensus        63 LpllFAigiaiGla   76 (548)
T TIGR02003        63 LHILFALAIGGSWA   76 (548)
T ss_pred             chHHHHHHHHHHHh
Confidence            79999999998876


No 61 
>COG3105 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.69  E-value=1.4e+02  Score=21.39  Aligned_cols=20  Identities=30%  Similarity=0.529  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 034649           15 FAAVGVAVGICGMQLVRNIC   34 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l~   34 (88)
                      ++.+|+.+|.++-+++-.|.
T Consensus        10 ~a~igLvvGi~IG~li~Rlt   29 (138)
T COG3105          10 YALIGLVVGIIIGALIARLT   29 (138)
T ss_pred             HHHHHHHHHHHHHHHHHHHc
Confidence            34455556655555554453


No 62 
>PF05356 Phage_Coat_B:  Phage Coat protein B ;  InterPro: IPR008020 The major coat protein in the capsid of filamentous bacteriophage forms a helical assembly of about 7000 identical protomers, with each protomer comprised of 46 amino acids, after the cleavage of the signal peptide. Each protomer forms a slightly curved helix that combines to form a tubular structure that encapsulates the viral DNA [].; PDB: 1QL1_A 2XKM_A 4IFM_A 1QL2_A 1IFM_A 2KLV_A 1IFN_A 2IFN_A 3IFM_A 2KSJ_A ....
Probab=21.62  E-value=1.5e+02  Score=19.41  Aligned_cols=19  Identities=26%  Similarity=0.015  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q 034649           15 FAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        15 ~~~vg~a~~~a~~~~~R~l   33 (88)
                      .+.+-+++.+.+|.++|+.
T Consensus        65 gvl~~laVaGlI~~l~RKa   83 (83)
T PF05356_consen   65 GVLVILAVAGLIYSLLRKA   83 (83)
T ss_dssp             HHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHhcC
Confidence            4456677888899999974


No 63 
>MTH00030 ND3 NADH dehydrogenase subunit 3; Provisional
Probab=21.26  E-value=1.3e+02  Score=20.68  Aligned_cols=27  Identities=22%  Similarity=0.367  Sum_probs=16.3

Q ss_pred             CCCcchhHHHHHHHHHHHHH--HHHHHHh
Q 034649            7 IRPEVFPLFAAVGVAVGICG--MQLVRNI   33 (88)
Q Consensus         7 i~pel~PL~~~vg~a~~~a~--~~~~R~l   33 (88)
                      .+||..++++.+.+|++.++  ..+.+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l   29 (123)
T MTH00030          1 MNPEFKTIFFSTLLGVGIILLLVSISFTL   29 (123)
T ss_pred             CChHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            36888888777655555544  4444433


No 64 
>PF13571 DUF4133:  Domain of unknown function (DUF4133)
Probab=20.88  E-value=62  Score=21.76  Aligned_cols=35  Identities=11%  Similarity=0.289  Sum_probs=22.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcCCceeEecCCccccchh
Q 034649           12 FPLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLE   52 (88)
Q Consensus        12 ~PL~~~vg~a~~~a~~~~~R~l~~nPdVr~~k~~r~~~v~~   52 (88)
                      +|.++|+++++++++.-..-      ..+++++.-++|+..
T Consensus        41 v~~~ici~~~~~~~~~lv~~------~f~ln~kyGe~GlmK   75 (96)
T PF13571_consen   41 VNQWICIGFGVVSGSLLVWQ------TFRLNRKYGEHGLMK   75 (96)
T ss_pred             cchhhhHHHHHHHhhhhhee------eeeccccccHHHHHH
Confidence            46678888888887765433      456666655555443


No 65 
>PRK06287 cobalt transport protein CbiN; Validated
Probab=20.82  E-value=1.8e+02  Score=19.35  Aligned_cols=24  Identities=13%  Similarity=-0.042  Sum_probs=19.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhc
Q 034649           12 FPLFAAVGVAVGICGMQLVRNICI   35 (88)
Q Consensus        12 ~PL~~~vg~a~~~a~~~~~R~l~~   35 (88)
                      |.+-.++|++++.+..+...++..
T Consensus        79 ~ilsgiiGv~i~l~l~~~~~~~l~  102 (107)
T PRK06287         79 EIIAMVIGTLLVLALAYGVGKIFK  102 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            667789999999999888877763


No 66 
>PF09574 DUF2374:  Protein  of unknown function (Duf2374);  InterPro: IPR014175 This very small protein (about 46 amino acids) consists largely of a single predicted membrane-spanning region. It is found in Photobacterium profundum SS9 and in three species of Vibrio, always near periplasmic nitrate reductase genes, but far from the periplasmic nitrate reductase genes in Aeromonas hydrophila ATCC 7966.
Probab=20.82  E-value=1.9e+02  Score=16.76  Aligned_cols=16  Identities=19%  Similarity=0.308  Sum_probs=8.4

Q ss_pred             chhHHHHHHHHHHHHH
Q 034649           11 VFPLFAAVGVAVGICG   26 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~   26 (88)
                      .+|.++.-|+++.+++
T Consensus        16 AmPvI~L~GF~~Vav~   31 (42)
T PF09574_consen   16 AMPVIILSGFAAVAVA   31 (42)
T ss_pred             cchHHHHhhHHHHHHH
Confidence            3566665555544443


No 67 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=20.70  E-value=1.3e+02  Score=19.44  Aligned_cols=19  Identities=26%  Similarity=0.511  Sum_probs=12.4

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHh
Q 034649           11 VFPLFAAVGVAVGICGMQLVRNI   33 (88)
Q Consensus        11 l~PL~~~vg~a~~~a~~~~~R~l   33 (88)
                      |.|||++.|    .++|.+.+.+
T Consensus        30 LtPlfiisa----~lSwkLaK~i   48 (74)
T PF15086_consen   30 LTPLFIISA----VLSWKLAKAI   48 (74)
T ss_pred             HhHHHHHHH----HHHHHHHHHH
Confidence            567776653    4677777755


No 68 
>PHA02101 hypothetical protein
Probab=20.41  E-value=69  Score=21.50  Aligned_cols=33  Identities=18%  Similarity=0.322  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHhhcCCceeEecCCccccchhh
Q 034649           21 AVGICGMQLVRNICINPEVRVTKQNRAAGVLEN   53 (88)
Q Consensus        21 a~~~a~~~~~R~l~~nPdVr~~k~~r~~~v~~n   53 (88)
                      ++|+|.|+-+-+...-|+|-++|-.+...-+++
T Consensus        60 ~vg~a~y~wi~~~~~~p~ve~t~ikpse~t~~r   92 (101)
T PHA02101         60 RVGLASYEWILARAFTPGVELTKVKPSEVTMSR   92 (101)
T ss_pred             eeecchhhHHHHhcCCCCceEEEeccchhhhHH
Confidence            456666666655667899999998776654554


No 69 
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=20.05  E-value=1.1e+02  Score=22.48  Aligned_cols=15  Identities=27%  Similarity=0.527  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHH
Q 034649           18 VGVAVGICGMQLVRN   32 (88)
Q Consensus        18 vg~a~~~a~~~~~R~   32 (88)
                      +++|+++|+|++.|+
T Consensus       121 Lal~~~~~iyfl~~K  135 (194)
T PF11833_consen  121 LALGLGACIYFLNRK  135 (194)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            566777889999987


No 70 
>TIGR02161 napC_nirT periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family. Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Probab=20.05  E-value=1.3e+02  Score=21.88  Aligned_cols=36  Identities=19%  Similarity=0.101  Sum_probs=17.8

Q ss_pred             CCcchhHHH--HHHHHHHHHHHHHHH---HhhcCCceeEec
Q 034649            8 RPEVFPLFA--AVGVAVGICGMQLVR---NICINPEVRVTK   43 (88)
Q Consensus         8 ~pel~PL~~--~vg~a~~~a~~~~~R---~l~~nPdVr~~k   43 (88)
                      .|.++.|++  ++|+++|+++|..+-   ..+.+|+.+.+=
T Consensus        11 k~~~~~~~~ll~~g~~~G~~~~~~~~~~~~~T~~~~fC~sC   51 (185)
T TIGR02161        11 RPSRLALGTLLLGGFVGGIVFWGGFNTGLEATNTEEFCISC   51 (185)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcchHHHh
Confidence            455544433  334445554444332   345677776643


No 71 
>PF08602 Mgr1:  Mgr1-like, i-AAA protease complex subunit;  InterPro: IPR013911  The Saccharomyces cerevisiae (Baker's yeast) Mgr1 protein has been shown to be required for mitochondrial viability in yeast lacking mitochondrial DNA. It is a mitochondrial inner membrane protein, which interacts with Yme1 and is a new subunit of the i-AAA protease complex [, ]. 
Probab=20.03  E-value=1.4e+02  Score=24.44  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHh
Q 034649           19 GVAVGICGMQLVRNI   33 (88)
Q Consensus        19 g~a~~~a~~~~~R~l   33 (88)
                      =+++|..++.-+|.|
T Consensus        64 Q~~~Gl~~~~r~R~l   78 (363)
T PF08602_consen   64 QTAVGLFCFRRARRL   78 (363)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            346666777777777


Done!