Citrus Sinensis ID: 034660


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MEEELIDAVPCSSLAVDAILRIGTAGAIWGLCAGPQLARKRGLSGITRASFVAKSIGKYGFQCGLVAGVFSSTRCGIQRYRKQNDWMG
cHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHcHHcccccEEEEEEEEEEEEEEEEcccccccc
****LIDAVPCSSLAVDAILRIGTAGAIWGLCAGPQLARKRGLSGITRASFVAKSIGKYGFQCGLVAGVFSSTRCGIQRYRK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEELIDAVPCSSLAVDAILRIGTAGAIWGLCAGPQLARKRGLSGITRASFVAKSIGKYGFQCGLVAGVFSSTRCGIQRYRKQNDWMG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope pore protein 16-4, chloroplastic Voltage-dependent high-conductance channel with a slightly cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars (By similarity). Non-essential amino acid-selective channel protein and translocation pore for NADPH:protochlorophyllide oxidoreductase A (PORA) and possibly PORB.probableQ9LZH8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted