Query         034663
Match_columns 88
No_of_seqs    41 out of 43
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:12:19 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034663.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034663hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06364 DUF1068:  Protein of u 100.0 5.4E-36 1.2E-40  222.7   2.3   74    4-80      3-76  (176)
  2 KOG1823 DRIM (Down-regulated i  98.1 5.6E-07 1.2E-11   82.6  -1.2   72    6-80   1195-1267(1364)
  3 PF01462 LRRNT:  Leucine rich r  37.2      16 0.00034   19.4   0.6   15   53-67     13-27  (28)
  4 PF14946 DUF4501:  Domain of un  33.6      16 0.00034   28.1   0.3   28   17-51     20-47  (180)
  5 smart00013 LRRNT Leucine rich   33.4      25 0.00055   18.9   1.0   18   52-69     12-29  (33)
  6 PF14342 DUF4396:  Domain of un  30.6      22 0.00047   25.5   0.6   37    2-38    102-138 (139)
  7 PF11027 DUF2615:  Protein of u  29.5      35 0.00075   23.8   1.4   30    8-38     55-84  (103)
  8 PF06463 Mob_synth_C:  Molybden  25.4      38 0.00082   23.3   1.0   30   25-54     46-76  (128)
  9 PF04703 FaeA:  FaeA-like prote  22.1      46   0.001   20.9   0.9    9   26-34     53-61  (62)
 10 PF06869 DUF1258:  Protein of u  20.6      40 0.00088   27.0   0.5   17   38-54    199-215 (258)
 11 PF10999 DUF2839:  Protein of u  20.0      51  0.0011   21.5   0.8   18   14-31     50-67  (68)

No 1  
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=100.00  E-value=5.4e-36  Score=222.70  Aligned_cols=74  Identities=62%  Similarity=1.093  Sum_probs=68.5

Q ss_pred             CchhHHHHHHHHHHHHhheeeeCCcceeeehhhhccccCCCCCCCCCcccCCCCCCCccccccCCCcCccCCCCCCC
Q 034663            4 NQAAIAKVGLSLLGLCLFGYIVGPPLYWHFMEGLDAVSHSSAATCPPCVCDCSSQPLLSIPDGLGNASITGYFPYQN   80 (88)
Q Consensus         4 ~~~~~lr~~Lvllav~~a~yIvGPpLYW~~~e~l~~~~~sss~sCppC~CDCss~~Ll~ip~gL~N~S~~DC~k~~~   80 (88)
                      .+++++||+|||||+++++||+|||||||++|+++++   ++++||||+||||++||++||+||+|+||+||||+|.
T Consensus         3 ~s~~~lr~~l~llal~~a~yivGP~LYWh~~~~~~~~---s~~sCppC~CDCs~~~ll~ip~gl~N~S~~DC~k~dP   76 (176)
T PF06364_consen    3 PSPAALRVVLVLLALCLAGYIVGPPLYWHLSEGLAAV---SSSSCPPCDCDCSSQPLLSIPPGLSNLSFTDCGKHDP   76 (176)
T ss_pred             CChhHHHHHHHHHHHHHHhheeCchHHHHHHHhhhcc---cCCCCCCCCCCCCCHHHHHhcccccccchHhhccCCh
Confidence            3567999999999999999999999999999999864   4568999999999999999999999999999999984


No 2  
>KOG1823 consensus DRIM (Down-regulated in metastasis)-like proteins [Defense mechanisms]
Probab=98.05  E-value=5.6e-07  Score=82.62  Aligned_cols=72  Identities=22%  Similarity=0.406  Sum_probs=62.5

Q ss_pred             hhHHHHHHHHHHHHhheeeeCCcceeeehhhhccccCCCCCCCCCcccCCCCC-CCccccccCCCcCccCCCCCCC
Q 034663            6 AAIAKVGLSLLGLCLFGYIVGPPLYWHFMEGLDAVSHSSAATCPPCVCDCSSQ-PLLSIPDGLGNASITGYFPYQN   80 (88)
Q Consensus         6 ~~~lr~~Lvllav~~a~yIvGPpLYW~~~e~l~~~~~sss~sCppC~CDCss~-~Ll~ip~gL~N~S~~DC~k~~~   80 (88)
                      .+-.+..+++.+.....+|.||++||++++++++..   +.+||+|.|||.++ .+.++.|++.+...+|||..+.
T Consensus      1195 l~~~~~~~~l~~qv~~~li~~~~l~~~~~~~~~~~~---~~~~~~c~~e~~~~~~~~~~~p~~~~~i~~~~~~~d~ 1267 (1364)
T KOG1823|consen 1195 LRSSKFDLVLGAQVAKNLIFGPALLWNLRENLEALI---SEICPACRCECMEKKACSQLLPLFALVIDEDCGQVDD 1267 (1364)
T ss_pred             HccCcHHHHHHHHHhhheeecHHHHHHHHhhcchhh---hhhhhhhhhhhhhhhhhhhhcchhhhccchhhcccCc
Confidence            344567899999999999999999999999997653   23499999999877 8999999999999999999874


No 3  
>PF01462 LRRNT:  Leucine rich repeat N-terminal domain;  InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats [].  LRRs are often flanked by cysteine-rich domains: an N-terminal LRR domain and a C-terminal LRR domain (IPR000483 from INTERPRO). This entry represents the N-terminal LRR domain. ; PDB: 3E6J_A 1W8A_A 2V9S_C 2V9T_B 3TWI_D 3ZYN_A 3ZYO_A 1OOK_G 1QYY_G 1SQ0_B ....
Probab=37.25  E-value=16  Score=19.36  Aligned_cols=15  Identities=40%  Similarity=0.840  Sum_probs=10.3

Q ss_pred             cCCCCCCCccccccC
Q 034663           53 CDCSSQPLLSIPDGL   67 (88)
Q Consensus        53 CDCss~~Ll~ip~gL   67 (88)
                      =||+.+.|.+||.+|
T Consensus        13 V~C~~~~L~~vP~~l   27 (28)
T PF01462_consen   13 VDCSGRGLTAVPSDL   27 (28)
T ss_dssp             EEETTSS-SSS-STS
T ss_pred             eECCCCCCCccCCCC
Confidence            378888999999865


No 4  
>PF14946 DUF4501:  Domain of unknown function (DUF4501)
Probab=33.62  E-value=16  Score=28.08  Aligned_cols=28  Identities=29%  Similarity=0.656  Sum_probs=20.0

Q ss_pred             HHHhheeeeCCcceeeehhhhccccCCCCCCCCCc
Q 034663           17 GLCLFGYIVGPPLYWHFMEGLDAVSHSSAATCPPC   51 (88)
Q Consensus        17 av~~a~yIvGPpLYW~~~e~l~~~~~sss~sCppC   51 (88)
                      +-|-..-.+||.-|||.+|       ..+.+|-.|
T Consensus        20 aSCpg~slCgPGcyr~~~e-------dgs~sCv~c   47 (180)
T PF14946_consen   20 ASCPGTSLCGPGCYRHWNE-------DGSVSCVQC   47 (180)
T ss_pred             ccCCCCCccCCcceeeecC-------CCCeEEEEc
Confidence            4455667899999999987       234567655


No 5  
>smart00013 LRRNT Leucine rich repeat N-terminal domain.
Probab=33.41  E-value=25  Score=18.87  Aligned_cols=18  Identities=33%  Similarity=0.556  Sum_probs=14.4

Q ss_pred             ccCCCCCCCccccccCCC
Q 034663           52 VCDCSSQPLLSIPDGLGN   69 (88)
Q Consensus        52 ~CDCss~~Ll~ip~gL~N   69 (88)
                      .-||+.+.|..||.++-.
T Consensus        12 ~V~C~~~~L~~vP~~iP~   29 (33)
T smart00013       12 AVDCSGRGLTEVPLDLPP   29 (33)
T ss_pred             EeEeCCCCcCccCCCCCc
Confidence            457888899999998764


No 6  
>PF14342 DUF4396:  Domain of unknown function (DUF4396)
Probab=30.63  E-value=22  Score=25.45  Aligned_cols=37  Identities=11%  Similarity=0.053  Sum_probs=29.5

Q ss_pred             CcCchhHHHHHHHHHHHHhheeeeCCcceeeehhhhc
Q 034663            2 AVNQAAIAKVGLSLLGLCLFGYIVGPPLYWHFMEGLD   38 (88)
Q Consensus         2 ~~~~~~~lr~~Lvllav~~a~yIvGPpLYW~~~e~l~   38 (88)
                      +++++..+-|....+|+.....+-=|.-||+++++..
T Consensus       102 ~~~~~~~~FW~~m~iam~~GF~~a~P~N~wli~~g~K  138 (139)
T PF14342_consen  102 AMPPDDPLFWFMMQIAMLAGFLTAYPVNWWLIKKGIK  138 (139)
T ss_pred             cCCCcchHHHHHHHHHHHHHHHHhcchHHHHHHhcCC
Confidence            4566777788888888887777778999999998763


No 7  
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=29.52  E-value=35  Score=23.81  Aligned_cols=30  Identities=10%  Similarity=0.077  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHhheeeeCCcceeeehhhhc
Q 034663            8 IAKVGLSLLGLCLFGYIVGPPLYWHFMEGLD   38 (88)
Q Consensus         8 ~lr~~Lvllav~~a~yIvGPpLYW~~~e~l~   38 (88)
                      ..-+.++|+.+++++|++.|. -+|-.++..
T Consensus        55 ~~~~~~~w~~~A~~ly~~RP~-s~R~~~~~~   84 (103)
T PF11027_consen   55 MFMMMMLWMVLAMALYLLRPS-SLRSRSADG   84 (103)
T ss_pred             HHHHHHHHHHHHHHHHHcCch-hhcCCCCCC
Confidence            566789999999999999998 344443343


No 8  
>PF06463 Mob_synth_C:  Molybdenum Cofactor Synthesis C;  InterPro: IPR010505 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [, ].  In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner []. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF []. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 (Q39054 from SWISSPROT) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) []. This entry represents MoaA, which belongs to a family of enzymes involved in the synthesis of metallo-cofactors (IPR000385 from INTERPRO). Each subunit of the MoaA dimer is comprised of an N-terminal SAM domain (IPR007197 from INTERPRO) that contains the [4Fe-4S] cluster typical for this family of enzymes, as well as an additional [4Fe-4S] cluster in the C-terminal domain that is unique to MoaA proteins []. The unique Fe site of the C-terminal [4Fe-4S] cluster is thought to be involved in the binding and activation of 5'-GTP. Mutations in the human MoCF biosynthesis proteins MOCS1, MOCS2 or GEPH cause MoCF Deficiency type A (MOCOD), causing the loss of activity of MoCF-containing enzymes, resulting in neurological abnormalities and death [].; GO: 0051539 4 iron, 4 sulfur cluster binding, 0006777 Mo-molybdopterin cofactor biosynthetic process, 0019008 molybdopterin synthase complex; PDB: 2FB2_A 2FB3_A 1TV8_B 1TV7_A.
Probab=25.44  E-value=38  Score=23.33  Aligned_cols=30  Identities=30%  Similarity=0.629  Sum_probs=13.9

Q ss_pred             eCCcceeeehhhhccccCCCCCCCCCcc-cC
Q 034663           25 VGPPLYWHFMEGLDAVSHSSAATCPPCV-CD   54 (88)
Q Consensus        25 vGPpLYW~~~e~l~~~~~sss~sCppC~-CD   54 (88)
                      .||+-||++..+-+.+-=-++.|.|.|. |+
T Consensus        46 ~~pa~~y~~~g~~g~vG~I~~~s~~FC~~CN   76 (128)
T PF06463_consen   46 NGPARYYRIPGGKGRVGFISPVSNPFCSSCN   76 (128)
T ss_dssp             T-SSEEEEETTT--EEEEE-TTTS--GGG--
T ss_pred             CCcceEEEECCCCcEEEEEeCCCCCCCCcCC
Confidence            7999999996654221001345677775 54


No 9  
>PF04703 FaeA:  FaeA-like protein; PDB: 2JT1_A 2HTJ_A.
Probab=22.06  E-value=46  Score=20.89  Aligned_cols=9  Identities=33%  Similarity=1.018  Sum_probs=6.9

Q ss_pred             CCcceeeeh
Q 034663           26 GPPLYWHFM   34 (88)
Q Consensus        26 GPpLYW~~~   34 (88)
                      |.+.||+++
T Consensus        53 G~~~~W~l~   61 (62)
T PF04703_consen   53 GKSTYWRLN   61 (62)
T ss_dssp             SSS-EEEES
T ss_pred             Ccceeeeec
Confidence            888999985


No 10 
>PF06869 DUF1258:  Protein of unknown function (DUF1258);  InterPro: IPR009667 This family represents a conserved region approximately 260 residues long within a number of hypothetical proteins of unknown function that seem to be specific to Caenorhabditis elegans. Note that this family contains a number of conserved cysteine and histidine residues.
Probab=20.59  E-value=40  Score=27.01  Aligned_cols=17  Identities=29%  Similarity=0.593  Sum_probs=13.3

Q ss_pred             ccccCCCCCCCCCcccC
Q 034663           38 DAVSHSSAATCPPCVCD   54 (88)
Q Consensus        38 ~~~~~sss~sCppC~CD   54 (88)
                      +...|+++.|||.|.|.
T Consensus       199 g~r~H~s~~SC~ycls~  215 (258)
T PF06869_consen  199 GMRGHSSSGSCFYCLSQ  215 (258)
T ss_pred             cccccccccceeeEecC
Confidence            44578899999998864


No 11 
>PF10999 DUF2839:  Protein of unknown function (DUF2839);  InterPro: IPR021262  This bacterial family of unknown function appear to be restricted to Cyanobacteria. 
Probab=20.03  E-value=51  Score=21.50  Aligned_cols=18  Identities=22%  Similarity=0.573  Sum_probs=13.8

Q ss_pred             HHHHHHhheeeeCCccee
Q 034663           14 SLLGLCLFGYIVGPPLYW   31 (88)
Q Consensus        14 vllav~~a~yIvGPpLYW   31 (88)
                      ++.++.+++-++||..+|
T Consensus        50 ~l~~~wi~vrfiGp~~gw   67 (68)
T PF10999_consen   50 ILVLIWIIVRFIGPAFGW   67 (68)
T ss_pred             HHHHHHHHHHhhcchhee
Confidence            455566777889999998


Done!