Query 034678
Match_columns 87
No_of_seqs 102 out of 123
Neff 4.4
Searched_HMMs 46136
Date Fri Mar 29 05:21:31 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034678.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034678hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN00165 hypothetical protein; 100.0 1.2E-52 2.6E-57 279.2 4.8 87 1-87 1-88 (88)
2 PF12609 DUF3774: Wound-induce 100.0 1.9E-41 4E-46 220.6 2.1 76 10-86 1-79 (79)
3 KOG4195 Transient receptor pot 63.4 2.8 6.1E-05 33.0 0.4 14 74-87 99-112 (275)
4 PF10406 TAF8_C: Transcription 21.8 49 0.0011 19.5 0.9 13 67-79 39-51 (51)
5 PHA00665 major capsid protein 18.4 49 0.0011 26.9 0.5 12 76-87 169-180 (329)
6 PF13540 RCC1_2: Regulator of 17.7 46 0.001 17.2 0.2 7 81-87 20-26 (30)
7 PF06554 Olfactory_mark: Olfac 17.1 47 0.001 24.3 0.1 9 73-81 122-130 (151)
8 PF06449 DUF1082: Mitochondria 16.7 49 0.0011 20.1 0.1 11 76-86 7-17 (51)
9 KOG3292 Predicted membrane pro 15.2 36 0.00078 25.7 -0.9 11 74-84 83-93 (196)
10 PF02083 Urotensin_II: Urotens 14.5 56 0.0012 14.6 -0.0 5 25-29 6-10 (12)
No 1
>PLN00165 hypothetical protein; Provisional
Probab=100.00 E-value=1.2e-52 Score=279.22 Aligned_cols=87 Identities=71% Similarity=1.090 Sum_probs=77.3
Q ss_pred CCcchHHHHHHH-HHHHHhhhhccccccchhhhhHHHHHHHhhhhhhhhhccCcchHHhhhhhcchhhhhhhhhhhhhhh
Q 034678 1 MNAKGKAWIVAA-IGAVEALKDQGFARWNYPLRSLKQHAETNLRSLVQANKLSSSSAMALSKVKDEKKIKESEESLRKVM 79 (87)
Q Consensus 1 Ms~~~~~w~vA~-vgaVealKDQG~crwn~alrSl~~~ak~~~~s~sq~~~lsssss~~~~~~~~~~k~kqaEESLR~VM 79 (87)
||+++|+||||+ |||||+|||||+|||||+|||||||++++++|++|+++|+++++...+...+++|.||+||+|||||
T Consensus 1 Ms~~~r~w~vAaSvgaVEalkDQG~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s~~~~~~k~kq~EEsLRtVM 80 (88)
T PLN00165 1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM 80 (88)
T ss_pred CccchhHHHHHHHHHHHhhccccCeeehhhHHHHHHHHHHhccccccccccCCCcchhhhhhhhccccccchHHhhheee
Confidence 999999999999 9999999999999999999999999999999999999998765423233233448899999999999
Q ss_pred eeecccCC
Q 034678 80 YLSCWGPN 87 (87)
Q Consensus 80 yLSCWGPn 87 (87)
||||||||
T Consensus 81 yLSCWGPN 88 (88)
T PLN00165 81 YLSCWGPN 88 (88)
T ss_pred EecccCCC
Confidence 99999998
No 2
>PF12609 DUF3774: Wound-induced protein; InterPro: IPR022251 This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this.
Probab=100.00 E-value=1.9e-41 Score=220.60 Aligned_cols=76 Identities=67% Similarity=1.030 Sum_probs=65.0
Q ss_pred HHH-HHHHHhhhhc-cccccchhhhhHHHHHHHhh-hhhhhhhccCcchHHhhhhhcchhhhhhhhhhhhhhheeecccC
Q 034678 10 VAA-IGAVEALKDQ-GFARWNYPLRSLKQHAETNL-RSLVQANKLSSSSAMALSKVKDEKKIKESEESLRKVMYLSCWGP 86 (87)
Q Consensus 10 vA~-vgaVealKDQ-G~crwn~alrSl~~~ak~~~-~s~sq~~~lsssss~~~~~~~~~~k~kqaEESLR~VMyLSCWGP 86 (87)
||+ |||||+|||| |+|||||+|||+|+++++++ ++.+|++++++++++. .....+++.||+|||||||||||||||
T Consensus 1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~-~~~~~~~~~k~aEEsLRtVMyLSCWGP 79 (79)
T PF12609_consen 1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSS-SAAAEEEKRKQAEESLRTVMYLSCWGP 79 (79)
T ss_pred CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccc-cccccccccchhhhhhceeEEEeccCc
Confidence 345 9999999999 99999999999999999998 8889999988764322 233445589999999999999999999
No 3
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=63.35 E-value=2.8 Score=33.02 Aligned_cols=14 Identities=50% Similarity=0.833 Sum_probs=10.1
Q ss_pred hhhhhheeecccCC
Q 034678 74 SLRKVMYLSCWGPN 87 (87)
Q Consensus 74 SLR~VMyLSCWGPn 87 (87)
.|+--=-|+|||||
T Consensus 99 GL~GRG~LgrwGPN 112 (275)
T KOG4195|consen 99 GLRGRGSLGRWGPN 112 (275)
T ss_pred cccccccccccCCc
Confidence 34444568999998
No 4
>PF10406 TAF8_C: Transcription factor TFIID complex subunit 8 C-term ; InterPro: IPR019473 This entry represents the C-terminal region of subunit 8 (also known as TAF8) of the transcription factor TFIID []. The adjacent N-terminal region generally contains a histone fold domain (IPR006565 from INTERPRO). This subunit is one of the key subunits of TFIID, being one of several general cofactors which are typically involved in gene activation to bring about the communication between gene-specific transcription factors and components of the general transcription machinery [].
Probab=21.83 E-value=49 Score=19.48 Aligned_cols=13 Identities=31% Similarity=0.593 Sum_probs=10.0
Q ss_pred hhhhhhhhhhhhh
Q 034678 67 KIKESEESLRKVM 79 (87)
Q Consensus 67 k~kqaEESLR~VM 79 (87)
..+++|++|++.|
T Consensus 39 ~~r~~e~aL~~l~ 51 (51)
T PF10406_consen 39 QSRLAEKALRKLL 51 (51)
T ss_pred HHHHHHHHHHHhC
Confidence 4567899998865
No 5
>PHA00665 major capsid protein
Probab=18.37 E-value=49 Score=26.93 Aligned_cols=12 Identities=42% Similarity=1.129 Sum_probs=10.2
Q ss_pred hhhheeecccCC
Q 034678 76 RKVMYLSCWGPN 87 (87)
Q Consensus 76 R~VMyLSCWGPn 87 (87)
-|=.||.+||||
T Consensus 169 ~tSiwlv~wg~~ 180 (329)
T PHA00665 169 NASIWLVVWGPN 180 (329)
T ss_pred cceEEEEEEcCC
Confidence 367899999997
No 6
>PF13540 RCC1_2: Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=17.68 E-value=46 Score=17.15 Aligned_cols=7 Identities=57% Similarity=1.678 Sum_probs=3.7
Q ss_pred eecccCC
Q 034678 81 LSCWGPN 87 (87)
Q Consensus 81 LSCWGPn 87 (87)
|-|||-|
T Consensus 20 v~~wG~n 26 (30)
T PF13540_consen 20 VYCWGDN 26 (30)
T ss_dssp EEEEE--
T ss_pred EEEEcCC
Confidence 5688865
No 7
>PF06554 Olfactory_mark: Olfactory marker protein; InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=17.06 E-value=47 Score=24.25 Aligned_cols=9 Identities=56% Similarity=1.047 Sum_probs=7.6
Q ss_pred hhhhhhhee
Q 034678 73 ESLRKVMYL 81 (87)
Q Consensus 73 ESLR~VMyL 81 (87)
...|||||+
T Consensus 122 AKiRKVMYF 130 (151)
T PF06554_consen 122 AKIRKVMYF 130 (151)
T ss_dssp HHCTTEEEE
T ss_pred HHHHhhhee
Confidence 468999997
No 8
>PF06449 DUF1082: Mitochondrial domain of unknown function (DUF1082); InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=16.72 E-value=49 Score=20.15 Aligned_cols=11 Identities=45% Similarity=1.108 Sum_probs=9.0
Q ss_pred hhhheeecccC
Q 034678 76 RKVMYLSCWGP 86 (87)
Q Consensus 76 R~VMyLSCWGP 86 (87)
|++-++||+|-
T Consensus 7 ~kit~iscFGE 17 (51)
T PF06449_consen 7 RKITLISCFGE 17 (51)
T ss_pred eEEEEEEEece
Confidence 67889999984
No 9
>KOG3292 consensus Predicted membrane protein [Function unknown]
Probab=15.20 E-value=36 Score=25.74 Aligned_cols=11 Identities=55% Similarity=1.165 Sum_probs=9.2
Q ss_pred hhhhhheeecc
Q 034678 74 SLRKVMYLSCW 84 (87)
Q Consensus 74 SLR~VMyLSCW 84 (87)
=+--||||+||
T Consensus 83 lla~vl~l~~~ 93 (196)
T KOG3292|consen 83 LLAAVLCLSCW 93 (196)
T ss_pred HHHHHHHHHHH
Confidence 46679999999
No 10
>PF02083 Urotensin_II: Urotensin II; InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=14.54 E-value=56 Score=14.58 Aligned_cols=5 Identities=40% Similarity=1.338 Sum_probs=0.0
Q ss_pred cccch
Q 034678 25 ARWNY 29 (87)
Q Consensus 25 crwn~ 29 (87)
|-|+|
T Consensus 6 CFWKY 10 (12)
T PF02083_consen 6 CFWKY 10 (12)
T ss_pred hhhhh
Done!