Query         034678
Match_columns 87
No_of_seqs    102 out of 123
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 05:21:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034678.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034678hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00165 hypothetical protein; 100.0 1.2E-52 2.6E-57  279.2   4.8   87    1-87      1-88  (88)
  2 PF12609 DUF3774:  Wound-induce 100.0 1.9E-41   4E-46  220.6   2.1   76   10-86      1-79  (79)
  3 KOG4195 Transient receptor pot  63.4     2.8 6.1E-05   33.0   0.4   14   74-87     99-112 (275)
  4 PF10406 TAF8_C:  Transcription  21.8      49  0.0011   19.5   0.9   13   67-79     39-51  (51)
  5 PHA00665 major capsid protein   18.4      49  0.0011   26.9   0.5   12   76-87    169-180 (329)
  6 PF13540 RCC1_2:  Regulator of   17.7      46   0.001   17.2   0.2    7   81-87     20-26  (30)
  7 PF06554 Olfactory_mark:  Olfac  17.1      47   0.001   24.3   0.1    9   73-81    122-130 (151)
  8 PF06449 DUF1082:  Mitochondria  16.7      49  0.0011   20.1   0.1   11   76-86      7-17  (51)
  9 KOG3292 Predicted membrane pro  15.2      36 0.00078   25.7  -0.9   11   74-84     83-93  (196)
 10 PF02083 Urotensin_II:  Urotens  14.5      56  0.0012   14.6  -0.0    5   25-29      6-10  (12)

No 1  
>PLN00165 hypothetical protein; Provisional
Probab=100.00  E-value=1.2e-52  Score=279.22  Aligned_cols=87  Identities=71%  Similarity=1.090  Sum_probs=77.3

Q ss_pred             CCcchHHHHHHH-HHHHHhhhhccccccchhhhhHHHHHHHhhhhhhhhhccCcchHHhhhhhcchhhhhhhhhhhhhhh
Q 034678            1 MNAKGKAWIVAA-IGAVEALKDQGFARWNYPLRSLKQHAETNLRSLVQANKLSSSSAMALSKVKDEKKIKESEESLRKVM   79 (87)
Q Consensus         1 Ms~~~~~w~vA~-vgaVealKDQG~crwn~alrSl~~~ak~~~~s~sq~~~lsssss~~~~~~~~~~k~kqaEESLR~VM   79 (87)
                      ||+++|+||||+ |||||+|||||+|||||+|||||||++++++|++|+++|+++++...+...+++|.||+||+|||||
T Consensus         1 Ms~~~r~w~vAaSvgaVEalkDQG~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s~~~~~~k~kq~EEsLRtVM   80 (88)
T PLN00165          1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM   80 (88)
T ss_pred             CccchhHHHHHHHHHHHhhccccCeeehhhHHHHHHHHHHhccccccccccCCCcchhhhhhhhccccccchHHhhheee
Confidence            999999999999 9999999999999999999999999999999999999998765423233233448899999999999


Q ss_pred             eeecccCC
Q 034678           80 YLSCWGPN   87 (87)
Q Consensus        80 yLSCWGPn   87 (87)
                      ||||||||
T Consensus        81 yLSCWGPN   88 (88)
T PLN00165         81 YLSCWGPN   88 (88)
T ss_pred             EecccCCC
Confidence            99999998


No 2  
>PF12609 DUF3774:  Wound-induced protein;  InterPro: IPR022251  This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this. 
Probab=100.00  E-value=1.9e-41  Score=220.60  Aligned_cols=76  Identities=67%  Similarity=1.030  Sum_probs=65.0

Q ss_pred             HHH-HHHHHhhhhc-cccccchhhhhHHHHHHHhh-hhhhhhhccCcchHHhhhhhcchhhhhhhhhhhhhhheeecccC
Q 034678           10 VAA-IGAVEALKDQ-GFARWNYPLRSLKQHAETNL-RSLVQANKLSSSSAMALSKVKDEKKIKESEESLRKVMYLSCWGP   86 (87)
Q Consensus        10 vA~-vgaVealKDQ-G~crwn~alrSl~~~ak~~~-~s~sq~~~lsssss~~~~~~~~~~k~kqaEESLR~VMyLSCWGP   86 (87)
                      ||+ |||||+|||| |+|||||+|||+|+++++++ ++.+|++++++++++. .....+++.||+|||||||||||||||
T Consensus         1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~-~~~~~~~~~k~aEEsLRtVMyLSCWGP   79 (79)
T PF12609_consen    1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSS-SAAAEEEKRKQAEESLRTVMYLSCWGP   79 (79)
T ss_pred             CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccc-cccccccccchhhhhhceeEEEeccCc
Confidence            345 9999999999 99999999999999999998 8889999988764322 233445589999999999999999999


No 3  
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=63.35  E-value=2.8  Score=33.02  Aligned_cols=14  Identities=50%  Similarity=0.833  Sum_probs=10.1

Q ss_pred             hhhhhheeecccCC
Q 034678           74 SLRKVMYLSCWGPN   87 (87)
Q Consensus        74 SLR~VMyLSCWGPn   87 (87)
                      .|+--=-|+|||||
T Consensus        99 GL~GRG~LgrwGPN  112 (275)
T KOG4195|consen   99 GLRGRGSLGRWGPN  112 (275)
T ss_pred             cccccccccccCCc
Confidence            34444568999998


No 4  
>PF10406 TAF8_C:  Transcription factor TFIID complex subunit 8 C-term ;  InterPro: IPR019473  This entry represents the C-terminal region of subunit 8 (also known as TAF8) of the transcription factor TFIID []. The adjacent N-terminal region generally contains a histone fold domain (IPR006565 from INTERPRO). This subunit is one of the key subunits of TFIID, being one of several general cofactors which are typically involved in gene activation to bring about the communication between gene-specific transcription factors and components of the general transcription machinery []. 
Probab=21.83  E-value=49  Score=19.48  Aligned_cols=13  Identities=31%  Similarity=0.593  Sum_probs=10.0

Q ss_pred             hhhhhhhhhhhhh
Q 034678           67 KIKESEESLRKVM   79 (87)
Q Consensus        67 k~kqaEESLR~VM   79 (87)
                      ..+++|++|++.|
T Consensus        39 ~~r~~e~aL~~l~   51 (51)
T PF10406_consen   39 QSRLAEKALRKLL   51 (51)
T ss_pred             HHHHHHHHHHHhC
Confidence            4567899998865


No 5  
>PHA00665 major capsid protein
Probab=18.37  E-value=49  Score=26.93  Aligned_cols=12  Identities=42%  Similarity=1.129  Sum_probs=10.2

Q ss_pred             hhhheeecccCC
Q 034678           76 RKVMYLSCWGPN   87 (87)
Q Consensus        76 R~VMyLSCWGPn   87 (87)
                      -|=.||.+||||
T Consensus       169 ~tSiwlv~wg~~  180 (329)
T PHA00665        169 NASIWLVVWGPN  180 (329)
T ss_pred             cceEEEEEEcCC
Confidence            367899999997


No 6  
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=17.68  E-value=46  Score=17.15  Aligned_cols=7  Identities=57%  Similarity=1.678  Sum_probs=3.7

Q ss_pred             eecccCC
Q 034678           81 LSCWGPN   87 (87)
Q Consensus        81 LSCWGPn   87 (87)
                      |-|||-|
T Consensus        20 v~~wG~n   26 (30)
T PF13540_consen   20 VYCWGDN   26 (30)
T ss_dssp             EEEEE--
T ss_pred             EEEEcCC
Confidence            5688865


No 7  
>PF06554 Olfactory_mark:  Olfactory marker protein;  InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=17.06  E-value=47  Score=24.25  Aligned_cols=9  Identities=56%  Similarity=1.047  Sum_probs=7.6

Q ss_pred             hhhhhhhee
Q 034678           73 ESLRKVMYL   81 (87)
Q Consensus        73 ESLR~VMyL   81 (87)
                      ...|||||+
T Consensus       122 AKiRKVMYF  130 (151)
T PF06554_consen  122 AKIRKVMYF  130 (151)
T ss_dssp             HHCTTEEEE
T ss_pred             HHHHhhhee
Confidence            468999997


No 8  
>PF06449 DUF1082:  Mitochondrial domain of unknown function (DUF1082);  InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=16.72  E-value=49  Score=20.15  Aligned_cols=11  Identities=45%  Similarity=1.108  Sum_probs=9.0

Q ss_pred             hhhheeecccC
Q 034678           76 RKVMYLSCWGP   86 (87)
Q Consensus        76 R~VMyLSCWGP   86 (87)
                      |++-++||+|-
T Consensus         7 ~kit~iscFGE   17 (51)
T PF06449_consen    7 RKITLISCFGE   17 (51)
T ss_pred             eEEEEEEEece
Confidence            67889999984


No 9  
>KOG3292 consensus Predicted membrane protein [Function unknown]
Probab=15.20  E-value=36  Score=25.74  Aligned_cols=11  Identities=55%  Similarity=1.165  Sum_probs=9.2

Q ss_pred             hhhhhheeecc
Q 034678           74 SLRKVMYLSCW   84 (87)
Q Consensus        74 SLR~VMyLSCW   84 (87)
                      =+--||||+||
T Consensus        83 lla~vl~l~~~   93 (196)
T KOG3292|consen   83 LLAAVLCLSCW   93 (196)
T ss_pred             HHHHHHHHHHH
Confidence            46679999999


No 10 
>PF02083 Urotensin_II:  Urotensin II;  InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=14.54  E-value=56  Score=14.58  Aligned_cols=5  Identities=40%  Similarity=1.338  Sum_probs=0.0

Q ss_pred             cccch
Q 034678           25 ARWNY   29 (87)
Q Consensus        25 crwn~   29 (87)
                      |-|+|
T Consensus         6 CFWKY   10 (12)
T PF02083_consen    6 CFWKY   10 (12)
T ss_pred             hhhhh


Done!