BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034684
(87 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis
Lanata
pdb|2V6G|A Chain A, Structure Of Progesterone 5beta-reductase From Digitalis
Lanata In Complex With Nadp
Length = 364
Score = 25.8 bits (55), Expect = 6.2, Method: Composition-based stats.
Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 4/46 (8%)
Query: 45 PFKTVPG-PFKLFWQCMRSKPGEEPTEPFTYLQL---DPPKREVKL 86
P PG P+K++ R++P P Y+Q DP + KL
Sbjct: 22 PLADTPGGPWKVYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKL 67
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.137 0.454
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,156,322
Number of Sequences: 62578
Number of extensions: 122123
Number of successful extensions: 249
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 248
Number of HSP's gapped (non-prelim): 1
length of query: 87
length of database: 14,973,337
effective HSP length: 55
effective length of query: 32
effective length of database: 11,531,547
effective search space: 369009504
effective search space used: 369009504
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)