Query         034691
Match_columns 87
No_of_seqs    32 out of 34
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:29:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034691.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034691hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06679 DUF1180:  Protein of u  86.6    0.62 1.3E-05   34.5   2.5   22    6-27     99-120 (163)
  2 PRK11874 petL cytochrome b6-f   72.8     5.1 0.00011   22.6   2.6   20    6-25      9-28  (30)
  3 PF06522 B12D:  NADH-ubiquinone  71.0     5.2 0.00011   25.5   2.7   25    6-30     10-34  (73)
  4 CHL00190 psaM photosystem I su  70.4     6.4 0.00014   22.2   2.7   18    6-23      7-24  (30)
  5 TIGR03053 PS_I_psaM photosyste  69.7     6.8 0.00015   21.8   2.7   18    6-23      6-23  (29)
  6 PF07465 PsaM:  Photosystem I p  68.6     7.7 0.00017   21.7   2.7   18    6-23      6-23  (29)
  7 PRK11878 psaM photosystem I re  67.8     7.5 0.00016   22.5   2.7   18    6-23     10-27  (34)
  8 KOG2592 Tumor differentially e  67.7     2.7 5.8E-05   35.7   1.1   18   49-66     99-116 (426)
  9 PF02411 MerT:  MerT mercuric t  63.7      18 0.00039   25.3   4.5   26    3-28     49-74  (116)
 10 smart00564 PQQ beta-propeller   54.8     1.3 2.8E-05   22.7  -1.9   18   60-77     14-31  (33)
 11 COG3745 CpaB Flp pilus assembl  50.9      21 0.00046   28.8   3.5   28    1-28      1-31  (276)
 12 PF03672 UPF0154:  Uncharacteri  49.4      21 0.00045   23.1   2.6   18    6-23      3-20  (64)
 13 PRK03427 cell division protein  44.9      22 0.00047   29.3   2.7   15    1-15      2-16  (333)
 14 TIGR01843 type_I_hlyD type I s  43.9      23 0.00049   27.0   2.6   26    3-28      3-28  (423)
 15 KOG4583 Membrane-associated ER  43.8      35 0.00075   28.9   3.8   24    4-27    286-309 (391)
 16 PRK13751 putative mercuric tra  42.6      73  0.0016   22.6   4.8   23    3-25     49-71  (116)
 17 PF12270 Cyt_c_ox_IV:  Cytochro  41.4      51  0.0011   24.0   3.9   28    8-35     44-73  (137)
 18 PF01011 PQQ:  PQQ enzyme repea  39.9     2.7 5.9E-05   23.0  -2.2   20   61-80      9-28  (38)
 19 PF10136 SpecificRecomb:  Site-  39.7      20 0.00043   31.6   1.9   14    7-20    478-491 (643)
 20 PRK04335 cell division protein  39.7      22 0.00047   29.0   2.0   27    1-27      1-27  (313)
 21 PF14138 COX16:  Cytochrome c o  38.0      17 0.00036   23.8   0.9   23    4-26      1-23  (80)
 22 PF08520 DUF1748:  Fungal prote  37.7      24 0.00052   22.9   1.6   20    8-29     11-30  (70)
 23 PF10833 DUF2572:  Protein of u  37.3      31 0.00068   26.8   2.4   16    6-21      7-22  (221)
 24 TIGR02833 spore_III_AB stage I  37.1      17 0.00036   26.3   0.9   23    6-28      5-27  (170)
 25 PF04906 Tweety:  Tweety;  Inte  36.9      56  0.0012   26.7   3.9   16   15-30    381-396 (406)
 26 PRK08307 stage III sporulation  36.6      18  0.0004   26.1   1.0   23    6-28      6-28  (171)
 27 PF10066 DUF2304:  Uncharacteri  35.8      50  0.0011   22.1   3.0   26    1-27      1-26  (115)
 28 PF02529 PetG:  Cytochrome B6-F  35.8      47   0.001   19.7   2.5   16    6-21      9-24  (37)
 29 PF09548 Spore_III_AB:  Stage I  34.2      19 0.00042   25.6   0.8   23    6-28      5-27  (170)
 30 PF09615 Cas_Csy3:  CRISPR-asso  33.8     7.6 0.00017   31.8  -1.5   16   65-80    130-145 (331)
 31 PRK10476 multidrug resistance   32.2      38 0.00082   26.0   2.2   23    3-25     13-35  (346)
 32 PF13706 PepSY_TM_3:  PepSY-ass  30.4      52  0.0011   18.3   2.0   13    6-18     19-31  (37)
 33 PF13257 DUF4048:  Domain of un  29.7      29 0.00062   27.5   1.2   13   56-68     90-102 (253)
 34 TIGR02566 cas_Csy3 CRISPR-asso  29.0      10 0.00022   31.4  -1.5   17   65-81    134-150 (341)
 35 PF07543 PGA2:  Protein traffic  28.9      33 0.00071   24.7   1.3   14    4-22     18-31  (140)
 36 CHL00008 petG cytochrome b6/f   28.6      62  0.0013   19.1   2.2   17    6-22      9-25  (37)
 37 cd04235 AAK_CK AAK_CK: Carbama  28.0      17 0.00037   29.1  -0.3   33   52-86    134-166 (308)
 38 TIGR02205 septum_zipA cell div  28.0      39 0.00085   26.9   1.7   12    4-15      2-13  (284)
 39 PRK00665 petG cytochrome b6-f   26.7      71  0.0015   18.9   2.2   17    6-22      9-25  (37)
 40 PF06364 DUF1068:  Protein of u  26.2      50  0.0011   25.3   1.9   18    4-21      8-25  (176)
 41 COG4389 Site-specific recombin  26.2      45 0.00097   29.8   1.8   14    7-20    502-515 (677)
 42 PF13334 DUF4094:  Domain of un  25.9      89  0.0019   21.0   2.9   24    7-30      6-29  (95)
 43 PF01222 ERG4_ERG24:  Ergostero  25.7      43 0.00093   27.8   1.6   57    6-67    304-360 (432)
 44 PRK01844 hypothetical protein;  24.8      90  0.0019   20.7   2.7   17    7-23     11-27  (72)
 45 PF12588 PSDC:  Phophatidylseri  24.7      42 0.00091   24.2   1.2   21    2-22     74-94  (141)
 46 PRK00523 hypothetical protein;  24.6      91   0.002   20.6   2.7   17    7-23     12-28  (72)
 47 PF13808 DDE_Tnp_1_assoc:  DDE_  22.7      66  0.0014   20.7   1.8   17    6-22     24-40  (90)
 48 PF10161 DDDD:  Putative mitoch  22.5      20 0.00043   24.1  -0.8   23    4-26     40-62  (79)
 49 PF05545 FixQ:  Cbb3-type cytoc  22.3 1.1E+02  0.0024   17.6   2.5   19    6-24     13-31  (49)
 50 PF11808 DUF3329:  Domain of un  22.2   1E+02  0.0022   20.0   2.6   12    6-17     12-23  (90)
 51 PF01810 LysE:  LysE type trans  21.9 2.2E+02  0.0049   19.5   4.4   26    5-30     59-84  (191)
 52 PF09527 ATPase_gene1:  Putativ  21.6 1.3E+02  0.0029   17.4   2.8   20    6-25     36-55  (55)
 53 KOG3393 Predicted membrane pro  21.6      32  0.0007   25.8   0.1   17   55-71     26-42  (157)
 54 PF14851 FAM176:  FAM176 family  21.5      99  0.0021   22.8   2.6   18    3-20     19-36  (153)
 55 PF14946 DUF4501:  Domain of un  20.4      87  0.0019   24.1   2.2   25    6-30     99-123 (180)

No 1  
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=86.60  E-value=0.62  Score=34.48  Aligned_cols=22  Identities=36%  Similarity=0.490  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCC
Q 034691            6 LILIFLSATLAGFFVIRNLKSP   27 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~   27 (87)
                      .||+.||+++..||++|.+|..
T Consensus        99 ~Vl~g~s~l~i~yfvir~~R~r  120 (163)
T PF06679_consen   99 YVLVGLSALAILYFVIRTFRLR  120 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Confidence            5889999999999999999876


No 2  
>PRK11874 petL cytochrome b6-f complex subunit PetL; Reviewed
Probab=72.78  E-value=5.1  Score=22.64  Aligned_cols=20  Identities=25%  Similarity=0.426  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHhhcC
Q 034691            6 LILIFLSATLAGFFVIRNLK   25 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~   25 (87)
                      ++.+|+.+.++-||.+|..+
T Consensus         9 ~l~~~~g~A~gl~fgLrsiK   28 (30)
T PRK11874          9 YLGVFTGIALGLYFGLRAAK   28 (30)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            67889999999999999865


No 3  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=70.99  E-value=5.2  Score=25.50  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCCCc
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQQQ   30 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~pe~   30 (87)
                      |+.|-+-+++|+|+..|.+...||.
T Consensus        10 ~~~vg~a~~~a~~~~~r~l~~~PdV   34 (73)
T PF06522_consen   10 FVIVGVAVGGATFYLYRLLLTNPDV   34 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCe
Confidence            5667788999999999999999977


No 4  
>CHL00190 psaM photosystem I subunit XII; Provisional
Probab=70.37  E-value=6.4  Score=22.23  Aligned_cols=18  Identities=22%  Similarity=0.436  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034691            6 LILIFLSATLAGFFVIRN   23 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~   23 (87)
                      ++..++.|.++|++++|-
T Consensus         7 i~iAL~~Al~~~iLA~rL   24 (30)
T CHL00190          7 IFIALFLALTTGILAIRL   24 (30)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566788999999999973


No 5  
>TIGR03053 PS_I_psaM photosystem I reaction center subunit XII. Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. The seed alignment for this model includes sequences from Pfam model pfam07465 and additional sequences, as from Prochlorococcus.
Probab=69.72  E-value=6.8  Score=21.84  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034691            6 LILIFLSATLAGFFVIRN   23 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~   23 (87)
                      +++.++.|.++|++++|-
T Consensus         6 i~iaL~~Al~~~iLA~rL   23 (29)
T TIGR03053         6 IFIALVIALIAGILALRL   23 (29)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566788999999999973


No 6  
>PF07465 PsaM:  Photosystem I protein M (PsaM);  InterPro: IPR010010 Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction centre. PsaM forms part of the photosystem I complex and its binding is stabilised by PsaI []. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen.; GO: 0015979 photosynthesis, 0009522 photosystem I, 0030094 plasma membrane-derived photosystem I; PDB: 3PCQ_M 1JB0_M.
Probab=68.63  E-value=7.7  Score=21.71  Aligned_cols=18  Identities=17%  Similarity=0.492  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034691            6 LILIFLSATLAGFFVIRN   23 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~   23 (87)
                      ++..++.|.++|++++|-
T Consensus         6 i~iAL~~Al~~~iLA~rL   23 (29)
T PF07465_consen    6 IFIALVIALITGILALRL   23 (29)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            567788999999999873


No 7  
>PRK11878 psaM photosystem I reaction center subunit XII; Reviewed
Probab=67.81  E-value=7.5  Score=22.47  Aligned_cols=18  Identities=22%  Similarity=0.399  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034691            6 LILIFLSATLAGFFVIRN   23 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~   23 (87)
                      +++.++.|.++|++++|-
T Consensus        10 i~iaL~~Al~~giLA~RL   27 (34)
T PRK11878         10 VFVALVVALHAGVLALRL   27 (34)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456788999999999983


No 8  
>KOG2592 consensus Tumor differentially expressed (TDE) protein [Function unknown]
Probab=67.68  E-value=2.7  Score=35.69  Aligned_cols=18  Identities=33%  Similarity=0.774  Sum_probs=14.7

Q ss_pred             CCCchhHHHHHhhhhhhh
Q 034691           49 QSPCSKVRLALESGFWTF   66 (87)
Q Consensus        49 ~~~~skv~~~i~sGFWt~   66 (87)
                      .+...+++.+||||||.|
T Consensus        99 Vkss~D~R~~iqng~W~f  116 (426)
T KOG2592|consen   99 VKSSKDPRAAIQNGFWFF  116 (426)
T ss_pred             cCcCCCHHHHHHcCcHHH
Confidence            344667999999999986


No 9  
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=63.72  E-value=18  Score=25.26  Aligned_cols=26  Identities=23%  Similarity=0.384  Sum_probs=22.6

Q ss_pred             chHHHHHHHHHHHHHHHHHhhcCCCC
Q 034691            3 PLRLILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         3 PLR~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      |.|-++|.++..+=||--||..|.++
T Consensus        49 pyRp~fi~~tl~~lg~a~~~~yr~~~   74 (116)
T PF02411_consen   49 PYRPYFIALTLLFLGYAFWRLYRPRK   74 (116)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHcccc
Confidence            89999999999999999999887543


No 10 
>smart00564 PQQ beta-propeller repeat. Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
Probab=54.77  E-value=1.3  Score=22.66  Aligned_cols=18  Identities=28%  Similarity=0.591  Sum_probs=15.6

Q ss_pred             hhhhhhheeccchhHHHH
Q 034691           60 ESGFWTFVDMASGKYLWR   77 (87)
Q Consensus        60 ~sGFWt~VDMASGrYLWr   77 (87)
                      .+|....+|..+|+-+|+
T Consensus        14 ~~g~l~a~d~~~G~~~W~   31 (33)
T smart00564       14 TDGTLYALDAKTGEILWT   31 (33)
T ss_pred             CCCEEEEEEcccCcEEEE
Confidence            358889999999999996


No 11 
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion]
Probab=50.87  E-value=21  Score=28.85  Aligned_cols=28  Identities=36%  Similarity=0.496  Sum_probs=22.5

Q ss_pred             CcchH---HHHHHHHHHHHHHHHHhhcCCCC
Q 034691            1 MCPLR---LILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         1 MCPLR---~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      |-|.|   +|++..+|.+|||+++..-..+|
T Consensus         1 M~~~rliil~~~~~~ag~ag~la~~~~~a~~   31 (276)
T COG3745           1 MRPKRLIILIVALAAAGLAGVLAASIWLAPA   31 (276)
T ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHhccCCc
Confidence            77888   34567799999999998877774


No 12 
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=49.36  E-value=21  Score=23.09  Aligned_cols=18  Identities=33%  Similarity=0.820  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034691            6 LILIFLSATLAGFFVIRN   23 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~   23 (87)
                      .||.|+=+.++|||+-|.
T Consensus         3 iilali~G~~~Gff~ar~   20 (64)
T PF03672_consen    3 IILALIVGAVIGFFIARK   20 (64)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            577788888999998764


No 13 
>PRK03427 cell division protein ZipA; Provisional
Probab=44.92  E-value=22  Score=29.28  Aligned_cols=15  Identities=53%  Similarity=0.660  Sum_probs=12.0

Q ss_pred             CcchHHHHHHHHHHH
Q 034691            1 MCPLRLILIFLSATL   15 (87)
Q Consensus         1 MCPLR~ILIFlSAtL   15 (87)
                      |==||+|||.+.|+-
T Consensus         2 MqdLrLiLivvGAIA   16 (333)
T PRK03427          2 MQDLRLILIIVGAIA   16 (333)
T ss_pred             chhhhhHHHHHHHHH
Confidence            445999999999863


No 14 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=43.92  E-value=23  Score=26.96  Aligned_cols=26  Identities=19%  Similarity=0.254  Sum_probs=20.9

Q ss_pred             chHHHHHHHHHHHHHHHHHhhcCCCC
Q 034691            3 PLRLILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         3 PLR~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      +.|+|++++.+++.++++|-.+-.-|
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~   28 (423)
T TIGR01843         3 FARLITWLIAGLVVIFFLWAYFAPLD   28 (423)
T ss_pred             chhhHHHHHHHHHHHHHHHHhheecc
Confidence            57999999999999999995554433


No 15 
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones]
Probab=43.77  E-value=35  Score=28.89  Aligned_cols=24  Identities=13%  Similarity=0.151  Sum_probs=15.0

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCCC
Q 034691            4 LRLILIFLSATLAGFFVIRNLKSP   27 (87)
Q Consensus         4 LR~ILIFlSAtLAGffv~r~l~s~   27 (87)
                      .||+||..+|.+-=+.=++-++.+
T Consensus       286 ~RfllVm~aal~iYl~q~g~~r~r  309 (391)
T KOG4583|consen  286 SRFLLVMGAALFIYLHQLGWFRFR  309 (391)
T ss_pred             HHHHHHHHHHHHHHHHHhcccccc
Confidence            699999998876433334434433


No 16 
>PRK13751 putative mercuric transport protein; Provisional
Probab=42.59  E-value=73  Score=22.57  Aligned_cols=23  Identities=26%  Similarity=0.150  Sum_probs=17.3

Q ss_pred             chHHHHHHHHHHHHHHHHHhhcC
Q 034691            3 PLRLILIFLSATLAGFFVIRNLK   25 (87)
Q Consensus         3 PLR~ILIFlSAtLAGffv~r~l~   25 (87)
                      |.|.++|.++.+.-||--|+..|
T Consensus        49 pyr~~fi~~a~~~l~~a~~~~yr   71 (116)
T PRK13751         49 PYRPIFIGAALVALFFAWRRIYR   71 (116)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHc
Confidence            88999988887777766566555


No 17 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=41.40  E-value=51  Score=23.97  Aligned_cols=28  Identities=11%  Similarity=0.059  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHH--hhcCCCCCcccccc
Q 034691            8 LIFLSATLAGFFVI--RNLKSPQQQLSDDV   35 (87)
Q Consensus         8 LIFlSAtLAGffv~--r~l~s~pe~~~dd~   35 (87)
                      ...|+.++++||-.  |.+.-+||+..|.+
T Consensus        44 s~~l~~mig~yl~~~~rr~~~rPED~~daE   73 (137)
T PF12270_consen   44 SGGLALMIGFYLRFTARRIGPRPEDREDAE   73 (137)
T ss_pred             HHHHHHHHHHHHHHHHhhCCCCCccccccc
Confidence            34567777777655  33444577633333


No 18 
>PF01011 PQQ:  PQQ enzyme repeat family.;  InterPro: IPR002372 Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [, ]. A number of bacterial quinoproteins belong to this family. Enzymes in this group have repeats of a beta propeller.; PDB: 1H4I_C 1H4J_E 1W6S_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A 1G72_A ....
Probab=39.88  E-value=2.7  Score=22.96  Aligned_cols=20  Identities=30%  Similarity=0.684  Sum_probs=16.1

Q ss_pred             hhhhhheeccchhHHHHhhc
Q 034691           61 SGFWTFVDMASGKYLWRHLG   80 (87)
Q Consensus        61 sGFWt~VDMASGrYLWr~L~   80 (87)
                      +|+=..+|..+|+.+|+.=.
T Consensus         9 ~g~l~AlD~~TG~~~W~~~~   28 (38)
T PF01011_consen    9 DGYLYALDAKTGKVLWKFQT   28 (38)
T ss_dssp             TSEEEEEETTTTSEEEEEES
T ss_pred             CCEEEEEECCCCCEEEeeeC
Confidence            56667899999999998543


No 19 
>PF10136 SpecificRecomb:  Site-specific recombinase;  InterPro: IPR011385 This group represents a site-specific recombinase Gcr. Please see the following relevant reference: [].
Probab=39.75  E-value=20  Score=31.62  Aligned_cols=14  Identities=43%  Similarity=0.918  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHH
Q 034691            7 ILIFLSATLAGFFV   20 (87)
Q Consensus         7 ILIFlSAtLAGffv   20 (87)
                      ++.|+|+++||||=
T Consensus       478 V~LF~SglIaG~~d  491 (643)
T PF10136_consen  478 VWLFLSGLIAGYFD  491 (643)
T ss_pred             HHHHHHHHHHhhHH
Confidence            68899999999974


No 20 
>PRK04335 cell division protein ZipA; Provisional
Probab=39.65  E-value=22  Score=28.96  Aligned_cols=27  Identities=26%  Similarity=0.384  Sum_probs=19.3

Q ss_pred             CcchHHHHHHHHHHHHHHHHHhhcCCC
Q 034691            1 MCPLRLILIFLSATLAGFFVIRNLKSP   27 (87)
Q Consensus         1 MCPLR~ILIFlSAtLAGffv~r~l~s~   27 (87)
                      |==||||||.+-|+.=--+++-+||.+
T Consensus         1 MQeLRlvLiivGAlAI~ALL~HGlWts   27 (313)
T PRK04335          1 MQELRFVLIVVGALAIAALLFHGLWTS   27 (313)
T ss_pred             CcceeehHHHHHHHHHHHHHHhccccc
Confidence            556999999999875555555566655


No 21 
>PF14138 COX16:  Cytochrome c oxidase assembly protein COX16
Probab=38.02  E-value=17  Score=23.77  Aligned_cols=23  Identities=30%  Similarity=0.440  Sum_probs=18.9

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCC
Q 034691            4 LRLILIFLSATLAGFFVIRNLKS   26 (87)
Q Consensus         4 LR~ILIFlSAtLAGffv~r~l~s   26 (87)
                      |||=|=|++-|++|.|.++.+..
T Consensus         1 l~~GlPf~~liV~GS~gL~~ftq   23 (80)
T PF14138_consen    1 LRFGLPFLLLIVGGSFGLSEFTQ   23 (80)
T ss_pred             CcccccHHHHHHHHHHHHHHHHH
Confidence            46778899999999999987654


No 22 
>PF08520 DUF1748:  Fungal protein of unknown function (DUF1748);  InterPro: IPR013726 This is a family of fungal proteins of unknown function. 
Probab=37.69  E-value=24  Score=22.90  Aligned_cols=20  Identities=30%  Similarity=0.406  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHhhcCCCCC
Q 034691            8 LIFLSATLAGFFVIRNLKSPQQ   29 (87)
Q Consensus         8 LIFlSAtLAGffv~r~l~s~pe   29 (87)
                      ++++|++|||.  =||-.-+|.
T Consensus        11 ~vLiS~~LAGi--rR~TGl~~~   30 (70)
T PF08520_consen   11 AVLISTFLAGI--RRNTGLTPK   30 (70)
T ss_pred             HHHHHHHHHHH--hhccCCccC
Confidence            67889999995  344333443


No 23 
>PF10833 DUF2572:  Protein of unknown function (DUF2572);  InterPro: IPR022543  This bacterial family of proteins has no known function. 
Probab=37.30  E-value=31  Score=26.84  Aligned_cols=16  Identities=38%  Similarity=0.494  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034691            6 LILIFLSATLAGFFVI   21 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~   21 (87)
                      .+||+||++|+-.|+.
T Consensus         7 ~~LillS~~L~l~~L~   22 (221)
T PF10833_consen    7 TILILLSGLLTLIMLF   22 (221)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            5899999999988875


No 24 
>TIGR02833 spore_III_AB stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB.
Probab=37.11  E-value=17  Score=26.27  Aligned_cols=23  Identities=35%  Similarity=0.531  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCC
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      -+||++|++..||-.-+.++.+|
T Consensus         5 a~LIi~s~~~~G~~~a~~~~~R~   27 (170)
T TIGR02833         5 ALLIVLSSTWIGFLYANRFKERP   27 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            37999999999999999998888


No 25 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=36.90  E-value=56  Score=26.72  Aligned_cols=16  Identities=0%  Similarity=-0.020  Sum_probs=10.0

Q ss_pred             HHHHHHHhhcCCCCCc
Q 034691           15 LAGFFVIRNLKSPQQQ   30 (87)
Q Consensus        15 LAGffv~r~l~s~pe~   30 (87)
                      .+.-=+|+.++.++++
T Consensus       381 ~~~~~~W~~~~~~~~d  396 (406)
T PF04906_consen  381 CVVSHAWKYFRRRDRD  396 (406)
T ss_pred             HHhhHHHHHhcCCccc
Confidence            3333348888888743


No 26 
>PRK08307 stage III sporulation protein SpoAB; Provisional
Probab=36.63  E-value=18  Score=26.06  Aligned_cols=23  Identities=26%  Similarity=0.463  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCC
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      -+||++|++..||-.-+.++.+|
T Consensus         6 a~LIi~s~~~~G~~~a~~~~~R~   28 (171)
T PRK08307          6 AVLIIAASTWIGFLYAKRYKERP   28 (171)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            37999999999999999998888


No 27 
>PF10066 DUF2304:  Uncharacterized conserved protein (DUF2304);  InterPro: IPR019277  This entry represents hypothetical archaeal and bacterial proteins that have no known function. 
Probab=35.81  E-value=50  Score=22.15  Aligned_cols=26  Identities=31%  Similarity=0.528  Sum_probs=18.6

Q ss_pred             CcchHHHHHHHHHHHHHHHHHhhcCCC
Q 034691            1 MCPLRLILIFLSATLAGFFVIRNLKSP   27 (87)
Q Consensus         1 MCPLR~ILIFlSAtLAGffv~r~l~s~   27 (87)
                      |-++++|+|.++..+.++ +.+.+|.+
T Consensus         1 M~~~qii~i~~~v~~~~~-ii~~vr~~   26 (115)
T PF10066_consen    1 MTILQIILIIIAVLFLLF-IIRLVRKR   26 (115)
T ss_pred             ChHHHHHHHHHHHHHHHH-HHHHHHHh
Confidence            778999999888766555 55556554


No 28 
>PF02529 PetG:  Cytochrome B6-F complex subunit 5;  InterPro: IPR003683 This family consists of cytochrome b6/f complex subunit 5 (PetG). The cytochrome bf complex, found in green plants, eukaryotic algae and cyanobacteria, connects photosystem I to photosystem II in the electron transport chain, functioning as a plastoquinol:plastocyanin/cytochrome c6 oxidoreductase []. The purified complex from the unicellular alga Chlamydomonas reinhardtii contains seven subunits; namely four high molecular weight subunits (cytochrome f, Rieske iron-sulphur protein, cytochrome b6, and subunit IV) and three approximately miniproteins (PetG, PetL, and PetX) []. Stoichiometry measurements are consistent with every subunit being present as two copies per b6/f dimer. The absence of PetG affects either the assembly or stability of the cytochrome bf complex in C. reinhardtii [].; GO: 0009512 cytochrome b6f complex; PDB: 1Q90_G 2ZT9_G 1VF5_G 2D2C_G 2E74_G 2E75_G 2E76_G.
Probab=35.76  E-value=47  Score=19.66  Aligned_cols=16  Identities=44%  Similarity=0.787  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034691            6 LILIFLSATLAGFFVI   21 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~   21 (87)
                      +||=.++-|+||.|+-
T Consensus         9 iVlGli~vtl~Glfv~   24 (37)
T PF02529_consen    9 IVLGLIPVTLAGLFVA   24 (37)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHhHHHHHHHHHHH
Confidence            5677889999999975


No 29 
>PF09548 Spore_III_AB:  Stage III sporulation protein AB (spore_III_AB);  InterPro: IPR014198  This entry represents the stage III sporulation protein AB, which is encoded in a spore formation operon: spoIIIAABCDEFGH that is under sigma G regulation []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species.
Probab=34.17  E-value=19  Score=25.64  Aligned_cols=23  Identities=35%  Similarity=0.470  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCC
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQ   28 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~p   28 (87)
                      .|||++|++..||-.-+.++.+|
T Consensus         5 ~~LIi~a~~~~G~~~a~~~~~R~   27 (170)
T PF09548_consen    5 AILIIAASSGIGFLYARRLKRRV   27 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            58999999999999998888887


No 30 
>PF09615 Cas_Csy3:  CRISPR-associated protein (Cas_Csy3);  InterPro: IPR013399 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.
Probab=33.75  E-value=7.6  Score=31.81  Aligned_cols=16  Identities=31%  Similarity=0.711  Sum_probs=13.2

Q ss_pred             hheeccchhHHHHhhc
Q 034691           65 TFVDMASGKYLWRHLG   80 (87)
Q Consensus        65 t~VDMASGrYLWr~L~   80 (87)
                      -..-.|.||.||||-+
T Consensus       130 Ya~NIanGrwLWRNR~  145 (331)
T PF09615_consen  130 YAKNIANGRWLWRNRV  145 (331)
T ss_pred             HHHHhhcCeeEeeccc
Confidence            3567899999999974


No 31 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=32.19  E-value=38  Score=25.98  Aligned_cols=23  Identities=17%  Similarity=0.145  Sum_probs=18.7

Q ss_pred             chHHHHHHHHHHHHHHHHHhhcC
Q 034691            3 PLRLILIFLSATLAGFFVIRNLK   25 (87)
Q Consensus         3 PLR~ILIFlSAtLAGffv~r~l~   25 (87)
                      ++.+++|++.-++++|+.|.+-.
T Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~   35 (346)
T PRK10476         13 LPALAIVALAIVALVFVIWRTDS   35 (346)
T ss_pred             chhHHHHHHHHHHHHHHheccCc
Confidence            46788999999999999996533


No 32 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=30.44  E-value=52  Score=18.33  Aligned_cols=13  Identities=38%  Similarity=0.749  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHH
Q 034691            6 LILIFLSATLAGF   18 (87)
Q Consensus         6 ~ILIFlSAtLAGf   18 (87)
                      ++++|+|++++-|
T Consensus        19 l~~~~~tG~~~~f   31 (37)
T PF13706_consen   19 LFVIFLTGAVMVF   31 (37)
T ss_pred             HHHHHHHhHHHHH
Confidence            5677888877765


No 33 
>PF13257 DUF4048:  Domain of unknown function (DUF4048)
Probab=29.66  E-value=29  Score=27.51  Aligned_cols=13  Identities=38%  Similarity=0.976  Sum_probs=9.9

Q ss_pred             HHHHhhhhhhhee
Q 034691           56 RLALESGFWTFVD   68 (87)
Q Consensus        56 ~~~i~sGFWt~VD   68 (87)
                      ..-++.|||+||.
T Consensus        90 AeDfK~GLWTFvE  102 (253)
T PF13257_consen   90 AEDFKEGLWTFVE  102 (253)
T ss_pred             HHHHHHHHHHHHH
Confidence            3347889999984


No 34 
>TIGR02566 cas_Csy3 CRISPR-associated protein, Csy3 family. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) family strictly associated with the Ypest subtype of CRISPR/Cas locus. This family is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.
Probab=29.04  E-value=10  Score=31.38  Aligned_cols=17  Identities=29%  Similarity=0.673  Sum_probs=13.4

Q ss_pred             hheeccchhHHHHhhcc
Q 034691           65 TFVDMASGKYLWRHLGS   81 (87)
Q Consensus        65 t~VDMASGrYLWr~L~~   81 (87)
                      -..-.|.||.||||=+.
T Consensus       134 Ya~NianGrwLWRNr~g  150 (341)
T TIGR02566       134 YAENIANGRWLWRNRVG  150 (341)
T ss_pred             HHHHhhcCeeEeecccc
Confidence            45678999999999543


No 35 
>PF07543 PGA2:  Protein trafficking PGA2;  InterPro: IPR011431 A Saccharomyces cerevisiae (Baker's yeast) member of this family (PGA2, P53903 from SWISSPROT) is a single pass membrane protein which has been implicated in protein trafficking [, ].
Probab=28.90  E-value=33  Score=24.67  Aligned_cols=14  Identities=29%  Similarity=0.978  Sum_probs=10.5

Q ss_pred             hHHHHHHHHHHHHHHHHHh
Q 034691            4 LRLILIFLSATLAGFFVIR   22 (87)
Q Consensus         4 LR~ILIFlSAtLAGffv~r   22 (87)
                      +|+|+     ++.||+++|
T Consensus        18 iRLVi-----IVggYiLlR   31 (140)
T PF07543_consen   18 IRLVI-----IVGGYILLR   31 (140)
T ss_pred             hhhhh-----hhhHHHHHH
Confidence            46665     478999999


No 36 
>CHL00008 petG cytochrome b6/f complex subunit V
Probab=28.59  E-value=62  Score=19.15  Aligned_cols=17  Identities=41%  Similarity=0.716  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 034691            6 LILIFLSATLAGFFVIR   22 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r   22 (87)
                      ++|=++..||||.||--
T Consensus         9 iVLGlipvTl~GlfvaA   25 (37)
T CHL00008          9 IVLGLIPITLAGLFVTA   25 (37)
T ss_pred             HHHHhHHHHHHHHHHHH
Confidence            46667788999999853


No 37 
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP. Both CK (this CD) and nonhomologous CP synthetase synthesize carbamoyl phosphate, an essential precursor of arginine and pyrimidine bases, in the presence of ATP, bicarbonate, and ammonia. CK is a homodimer of 33 kDa subunits and is a member of the Amino Acid Kinase Superfamily (AAK).
Probab=28.03  E-value=17  Score=29.05  Aligned_cols=33  Identities=24%  Similarity=0.308  Sum_probs=24.0

Q ss_pred             chhHHHHHhhhhhhheeccchhHHHHhhccCCCCC
Q 034691           52 CSKVRLALESGFWTFVDMASGKYLWRHLGSSSKRS   86 (87)
Q Consensus        52 ~skv~~~i~sGFWt~VDMASGrYLWr~L~~ss~~~   86 (87)
                      +.+.+...+.-=|+++.-+ ||| ||..|.||++.
T Consensus       134 ~~~a~~~~~~~g~~~~~d~-~~g-~rrvV~SP~P~  166 (308)
T cd04235         134 EEEAEELAAEKGWTFKEDA-GRG-YRRVVPSPKPK  166 (308)
T ss_pred             HHHHHHHHHHcCCEEEEeC-CCC-ceeeeCCCCCc
Confidence            3445555555458999887 888 99999998863


No 38 
>TIGR02205 septum_zipA cell division protein ZipA. This model represents the full length of bacterial cell division protein ZipA. The N-terminal hydrophobic stretch is an uncleaved signal-anchor sequence. This is followed by an unconserved, variable length, low complexity region, and then a conserved C-terminal region of about 140 amino acids (see pfam04354) that interacts with the tubulin-like cell division protein FtsZ.
Probab=27.98  E-value=39  Score=26.91  Aligned_cols=12  Identities=42%  Similarity=0.650  Sum_probs=10.1

Q ss_pred             hHHHHHHHHHHH
Q 034691            4 LRLILIFLSATL   15 (87)
Q Consensus         4 LR~ILIFlSAtL   15 (87)
                      ||+|||.+-|+.
T Consensus         2 Lr~iLIIvGaia   13 (284)
T TIGR02205         2 LRIILIIVGILA   13 (284)
T ss_pred             ceehHHHHHHHH
Confidence            899999998764


No 39 
>PRK00665 petG cytochrome b6-f complex subunit PetG; Reviewed
Probab=26.68  E-value=71  Score=18.90  Aligned_cols=17  Identities=41%  Similarity=0.729  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 034691            6 LILIFLSATLAGFFVIR   22 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r   22 (87)
                      ++|=++.-||||.||--
T Consensus         9 iVLGlipiTl~GlfvaA   25 (37)
T PRK00665          9 IVLGLIPVTLAGLFVAA   25 (37)
T ss_pred             HHHHhHHHHHHHHHHHH
Confidence            45667778999999853


No 40 
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=26.21  E-value=50  Score=25.27  Aligned_cols=18  Identities=44%  Similarity=0.816  Sum_probs=16.3

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 034691            4 LRLILIFLSATLAGFFVI   21 (87)
Q Consensus         4 LR~ILIFlSAtLAGffv~   21 (87)
                      ||++|+.|.-.+|||.+-
T Consensus         8 lr~~l~llal~~a~yivG   25 (176)
T PF06364_consen    8 LRVVLVLLALCLAGYIVG   25 (176)
T ss_pred             HHHHHHHHHHHHHhheeC
Confidence            799999999999999863


No 41 
>COG4389 Site-specific recombinase [DNA replication, recombination, and repair]
Probab=26.15  E-value=45  Score=29.80  Aligned_cols=14  Identities=43%  Similarity=0.842  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHH
Q 034691            7 ILIFLSATLAGFFV   20 (87)
Q Consensus         7 ILIFlSAtLAGffv   20 (87)
                      +++|+|+++||||=
T Consensus       502 ~wLf~SgiiaG~fD  515 (677)
T COG4389         502 LWLFCSGIIAGFFD  515 (677)
T ss_pred             HHHHHHHHHHHhhc
Confidence            57899999999984


No 42 
>PF13334 DUF4094:  Domain of unknown function (DUF4094)
Probab=25.92  E-value=89  Score=20.99  Aligned_cols=24  Identities=13%  Similarity=0.328  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHhhcCCCCCc
Q 034691            7 ILIFLSATLAGFFVIRNLKSPQQQ   30 (87)
Q Consensus         7 ILIFlSAtLAGffv~r~l~s~pe~   30 (87)
                      +++.+...+||+++-.-++..||.
T Consensus         6 l~Lc~~SF~~G~lft~R~W~~pe~   29 (95)
T PF13334_consen    6 LLLCIASFCAGMLFTNRMWTVPES   29 (95)
T ss_pred             HHHHHHHHHHHHHHhcccccCCcc
Confidence            344567789999888888888853


No 43 
>PF01222 ERG4_ERG24:  Ergosterol biosynthesis ERG4/ERG24 family;  InterPro: IPR001171 The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol []. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family.; GO: 0016020 membrane
Probab=25.69  E-value=43  Score=27.79  Aligned_cols=57  Identities=19%  Similarity=0.348  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCCCccccccccCCCCCCCCCCCCCCchhHHHHHhhhhhhhe
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQQQLSDDVLLDADDSTDTTKNQSPCSKVRLALESGFWTFV   67 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~pe~~~dd~~~~~~~s~s~~~~~~~~skv~~~i~sGFWt~V   67 (87)
                      .++|++ .-++||.+.|..++|-+..--++. ++.-...   ...+.++=++-+-||+|.++
T Consensus       304 ~~~i~~-l~~~gy~i~r~sn~QK~~FR~~p~-~p~~~~~---~~~~t~~G~~LL~SGwWg~~  360 (432)
T PF01222_consen  304 AAAILA-LGLVGYYIFRGSNSQKNRFRRNPK-DPKVIHL---KYIPTKRGSKLLVSGWWGIA  360 (432)
T ss_pred             HHHHHH-HHHHHHHHHHHhchhHHHhcCCCC-CCccccc---ceeecCCCCeEEEcChhHhh
Confidence            455555 347899999999988543221221 1111111   11111122346889999864


No 44 
>PRK01844 hypothetical protein; Provisional
Probab=24.82  E-value=90  Score=20.68  Aligned_cols=17  Identities=24%  Similarity=0.696  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 034691            7 ILIFLSATLAGFFVIRN   23 (87)
Q Consensus         7 ILIFlSAtLAGffv~r~   23 (87)
                      |+-++=+.+.|||.-|.
T Consensus        11 I~~li~G~~~Gff~ark   27 (72)
T PRK01844         11 VVALVAGVALGFFIARK   27 (72)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44466677788888654


No 45 
>PF12588 PSDC:  Phophatidylserine decarboxylase ;  InterPro: IPR022237  This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF02666 from PFAM. Phosphatidylserine decarboxylase (PSD) is an important enzyme in the synthesis of phosphatidylethanolamine in both prokaryotes and eukaryotes. 
Probab=24.67  E-value=42  Score=24.23  Aligned_cols=21  Identities=24%  Similarity=0.365  Sum_probs=19.6

Q ss_pred             cchHHHHHHHHHHHHHHHHHh
Q 034691            2 CPLRLILIFLSATLAGFFVIR   22 (87)
Q Consensus         2 CPLR~ILIFlSAtLAGffv~r   22 (87)
                      ||+=-||.-..+|-|||.+.+
T Consensus        74 ~P~naiLdwpM~T~sG~a~F~   94 (141)
T PF12588_consen   74 FPMNAILDWPMGTPSGYAFFL   94 (141)
T ss_pred             cChHHHHHhhccChHHHHHHc
Confidence            899999999999999999874


No 46 
>PRK00523 hypothetical protein; Provisional
Probab=24.62  E-value=91  Score=20.65  Aligned_cols=17  Identities=24%  Similarity=0.657  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 034691            7 ILIFLSATLAGFFVIRN   23 (87)
Q Consensus         7 ILIFlSAtLAGffv~r~   23 (87)
                      |+.++=+.+.|||.-|.
T Consensus        12 i~~li~G~~~Gffiark   28 (72)
T PRK00523         12 IPLLIVGGIIGYFVSKK   28 (72)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45567777888888654


No 47 
>PF13808 DDE_Tnp_1_assoc:  DDE_Tnp_1-associated
Probab=22.73  E-value=66  Score=20.70  Aligned_cols=17  Identities=41%  Similarity=0.471  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 034691            6 LILIFLSATLAGFFVIR   22 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r   22 (87)
                      +++|.+.|+|+|.==|+
T Consensus        24 iL~i~~~a~l~G~~~~~   40 (90)
T PF13808_consen   24 ILLIALCAVLCGADSWR   40 (90)
T ss_pred             HHHHHHHHHHHccccHH
Confidence            45788899999965443


No 48 
>PF10161 DDDD:  Putative mitochondrial precursor protein;  InterPro: IPR018782 This entry represents a family of small conserved proteins found from nematodes to humans. The C-terminal region is rich in asparagine. These proteins have been putatively designated as mitochondrial precursor proteins but this has not been confirmed. 
Probab=22.53  E-value=20  Score=24.14  Aligned_cols=23  Identities=17%  Similarity=0.317  Sum_probs=17.4

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCC
Q 034691            4 LRLILIFLSATLAGFFVIRNLKS   26 (87)
Q Consensus         4 LR~ILIFlSAtLAGffv~r~l~s   26 (87)
                      +|++.+.+..++.|.++-++.-+
T Consensus        40 ~~v~~vvip~l~~Ga~isk~~A~   62 (79)
T PF10161_consen   40 LRVLAVVIPGLYLGATISKNGAQ   62 (79)
T ss_pred             heeeeeeccHHHHHHHHHHHHHH
Confidence            56777778888888888877654


No 49 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=22.35  E-value=1.1e+02  Score=17.65  Aligned_cols=19  Identities=5%  Similarity=0.093  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q 034691            6 LILIFLSATLAGFFVIRNL   24 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l   24 (87)
                      +.+|++-++..|+.+|--.
T Consensus        13 ~~~v~~~~~F~gi~~w~~~   31 (49)
T PF05545_consen   13 IGTVLFFVFFIGIVIWAYR   31 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHc
Confidence            4577888888898888543


No 50 
>PF11808 DUF3329:  Domain of unknown function (DUF3329);  InterPro: IPR021766  This family of proteins are functionally uncharacterised. This family is only found in bacteria. ; GO: 0004673 protein histidine kinase activity
Probab=22.16  E-value=1e+02  Score=19.99  Aligned_cols=12  Identities=50%  Similarity=0.955  Sum_probs=4.7

Q ss_pred             HHHHHHHHHHHH
Q 034691            6 LILIFLSATLAG   17 (87)
Q Consensus         6 ~ILIFlSAtLAG   17 (87)
                      ++++++-|++.|
T Consensus        12 l~~~~l~~~lvG   23 (90)
T PF11808_consen   12 LLLLLLAAALVG   23 (90)
T ss_pred             HHHHHHHHHHHH
Confidence            334434333333


No 51 
>PF01810 LysE:  LysE type translocator;  InterPro: IPR001123 Lysine exporter protein is involved in the efflux of excess L-lysine as a control for intracellular levels of L-lysine. A number of proteins belong to this family. These include the chemotactic transduction protein from Pseudomonas aeruginosa, the threonine efflux protein and a number of uncharacterised proteins from a variety of sources.; GO: 0006865 amino acid transport, 0016020 membrane
Probab=21.92  E-value=2.2e+02  Score=19.49  Aligned_cols=26  Identities=23%  Similarity=0.211  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhcCCCCCc
Q 034691            5 RLILIFLSATLAGFFVIRNLKSPQQQ   30 (87)
Q Consensus         5 R~ILIFlSAtLAGffv~r~l~s~pe~   30 (87)
                      +-++-.+.+..=-|+.++.+++.++.
T Consensus        59 ~~~l~~~G~~~L~~lg~~~~~~~~~~   84 (191)
T PF01810_consen   59 FMILKLLGALYLLYLGYKLLRSKFSS   84 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcccCc
Confidence            44556666777778889999998765


No 52 
>PF09527 ATPase_gene1:  Putative F0F1-ATPase subunit (ATPase_gene1)
Probab=21.59  E-value=1.3e+02  Score=17.41  Aligned_cols=20  Identities=30%  Similarity=0.303  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHhhcC
Q 034691            6 LILIFLSATLAGFFVIRNLK   25 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~   25 (87)
                      +|.+++..+.+.|-++|.+|
T Consensus        36 ~~g~llG~~~g~~~~~~~~k   55 (55)
T PF09527_consen   36 LIGLLLGIAAGFYNVYRLVK   55 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            35566666677777776554


No 53 
>KOG3393 consensus Predicted membrane protein [Function unknown]
Probab=21.59  E-value=32  Score=25.84  Aligned_cols=17  Identities=24%  Similarity=0.571  Sum_probs=13.3

Q ss_pred             HHHHHhhhhhhheeccc
Q 034691           55 VRLALESGFWTFVDMAS   71 (87)
Q Consensus        55 v~~~i~sGFWt~VDMAS   71 (87)
                      ....--.|+|.+||.|.
T Consensus        26 aG~LFf~GwWi~iDAa~   42 (157)
T KOG3393|consen   26 AGALFFTGWWIMIDAAL   42 (157)
T ss_pred             HHHHHHHHHHHhhhhhh
Confidence            34456799999999984


No 54 
>PF14851 FAM176:  FAM176 family
Probab=21.49  E-value=99  Score=22.76  Aligned_cols=18  Identities=39%  Similarity=0.718  Sum_probs=15.8

Q ss_pred             chHHHHHHHHHHHHHHHH
Q 034691            3 PLRLILIFLSATLAGFFV   20 (87)
Q Consensus         3 PLR~ILIFlSAtLAGffv   20 (87)
                      |=||-|.|+|+|-+|.++
T Consensus        19 PE~~aLYFv~gVC~GLlL   36 (153)
T PF14851_consen   19 PERFALYFVSGVCAGLLL   36 (153)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            668999999999999764


No 55 
>PF14946 DUF4501:  Domain of unknown function (DUF4501)
Probab=20.37  E-value=87  Score=24.06  Aligned_cols=25  Identities=20%  Similarity=0.303  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHhhcCCCCCc
Q 034691            6 LILIFLSATLAGFFVIRNLKSPQQQ   30 (87)
Q Consensus         6 ~ILIFlSAtLAGffv~r~l~s~pe~   30 (87)
                      ||-.+|.--+|+||.++-.+.-|++
T Consensus        99 fIS~~LilSvA~FFYLKrs~kLP~v  123 (180)
T PF14946_consen   99 FISLGLILSVASFFYLKRSSKLPHV  123 (180)
T ss_pred             HHHHHHHHHHhhheeecccccCCcc
Confidence            4555566678999999877776865


Done!