Citrus Sinensis ID: 034704


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MDSHDSEDPKQNTADMTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASPSLPSKSNDGPDQGSQ
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc
****************TAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSIND****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSHDSEDPKQNTADMTAFVQNLLQQMQSRFQTMSESIIAKxxxxxxxxxxxxxxxxxxxxxMGIEGSASPSLPSKSNDGPDQGSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock factor-binding protein 1 Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.probableQ3ZC22
Heat shock factor-binding protein 1 Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.probableQ8K3X8
Heat shock factor-binding protein 1 Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.probableO75506

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CI9, chain A
Confidence level:very confident
Coverage over the Query: 10-53
View the alignment between query and template
View the model in PyMOL