Query         034721
Match_columns 86
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:46:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034721.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034721hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02523 galacturonosyltransfe  99.3 3.5E-12 7.6E-17  105.4   5.5   62    1-63      1-62  (559)
  2 PRK10119 putative hydrolase; P  73.3     3.3 7.2E-05   30.5   2.5   33   50-83    149-181 (231)
  3 PF12911 OppC_N:  N-terminal TM  53.9      20 0.00044   19.6   2.8   26   18-43      9-34  (56)
  4 PHA02673 ORF109 EEV glycoprote  44.9      41  0.0009   24.9   4.0   28   19-46     29-56  (161)
  5 PHA03093 EEV glycoprotein; Pro  43.8      43 0.00092   25.3   3.9   36   10-45     15-58  (185)
  6 COG1149 MinD superfamily P-loo  39.3      18 0.00038   28.7   1.4   13    1-13      2-14  (284)
  7 PLN02687 flavonoid 3'-monooxyg  39.1      49  0.0011   24.8   3.6   25   29-53      6-30  (517)
  8 MTH00077 COX1 cytochrome c oxi  36.6      91   0.002   25.6   5.1   16   56-74    497-512 (514)
  9 PF06783 UPF0239:  Uncharacteri  35.3      42 0.00091   22.6   2.5   22   18-39     18-39  (85)
 10 PTZ00067 40S ribosomal S23; Pr  35.1      23  0.0005   25.8   1.3   18    2-19     99-119 (143)
 11 KOG2204 Mannosyl-oligosacchari  29.4 1.1E+02  0.0024   27.0   4.7   47   10-56      5-51  (625)
 12 PF03772 Competence:  Competenc  28.9      32 0.00069   23.7   1.2   61   26-86    118-187 (271)
 13 PLN03153 hypothetical protein;  28.2 1.1E+02  0.0023   26.3   4.3   26   17-42     30-55  (537)
 14 PF09967 DUF2201:  VWA-like dom  28.1      25 0.00053   22.9   0.5   19    7-25     62-80  (126)
 15 MTH00037 COX1 cytochrome c oxi  27.2 1.8E+02  0.0038   24.0   5.3   15   56-73    498-512 (517)
 16 MTH00183 COX1 cytochrome c oxi  26.8 1.8E+02   0.004   23.8   5.3   16   55-73    496-511 (516)
 17 PF01712 dNK:  Deoxynucleoside   26.5      46   0.001   21.5   1.5   16   19-34     26-42  (146)
 18 MTH00116 COX1 cytochrome c oxi  26.1 1.8E+02  0.0038   23.9   5.1   15   56-73    497-511 (515)
 19 MTH00153 COX1 cytochrome c oxi  26.0 1.6E+02  0.0035   24.2   4.8   16   55-73    494-509 (511)
 20 PTZ00474 tryptophan/threonine-  25.5 1.1E+02  0.0024   23.9   3.7   20   25-44     33-52  (316)
 21 PLN02971 tryptophan N-hydroxyl  24.2 1.6E+02  0.0035   22.4   4.3   30   10-41     11-40  (543)
 22 PF14937 DUF4500:  Domain of un  23.8      32 0.00069   23.3   0.4   21   12-32      9-29  (86)
 23 MTH00167 COX1 cytochrome c oxi  23.5   2E+02  0.0044   23.5   5.0   16   55-73    496-511 (512)
 24 MTH00026 COX1 cytochrome c oxi  23.0 2.2E+02  0.0048   23.5   5.2   14   56-72    513-526 (534)
 25 PF14992 TMCO5:  TMCO5 family    21.7 1.1E+02  0.0023   24.1   3.0   29   19-47    210-238 (280)
 26 MTH00103 COX1 cytochrome c oxi  21.6 2.2E+02  0.0047   23.5   4.8   16   55-73    496-511 (513)
 27 COG0114 FumC Fumarase [Energy   21.0      39 0.00085   28.7   0.5   16    9-24    226-241 (462)
 28 cd03367 Ribosomal_S23 S12-like  20.9      60  0.0013   22.9   1.3   17    3-19     75-94  (115)
 29 PF00689 Cation_ATPase_C:  Cati  20.8 1.6E+02  0.0035   18.6   3.2   23   59-81    146-168 (182)
 30 TIGR01478 STEVOR variant surfa  20.7      35 0.00075   27.3   0.1   16   11-26    248-263 (295)
 31 TIGR02891 CtaD_CoxA cytochrome  20.4 2.2E+02  0.0047   22.6   4.5   15   55-72    491-505 (506)

No 1  
>PLN02523 galacturonosyltransferase
Probab=99.29  E-value=3.5e-12  Score=105.43  Aligned_cols=62  Identities=58%  Similarity=0.934  Sum_probs=56.8

Q ss_pred             CeeeeecCCCCcccCcchhhhHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCCCCCCccc
Q 034721            1 MAVAIRGGRGGTAVGPGLRSLFSYRIFVSAMFSLLFLATLSVILTSHPSTSHHDPVSPPPLHS   63 (86)
Q Consensus         1 mavairggrggtavgpglrslfsyrifvsamfsllflatlsviltshpstshhdpvsppplhs   63 (86)
                      ||+|-||||||...| |+|+.|+||+|.||+|.+||+|++|+.|++||..+|||-.-|---+.
T Consensus         1 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   62 (559)
T PLN02523          1 MAVAHRGGRGGGGPG-GLRSFFSYRILASAIFLFLFLATTSVLLNTSPHPPHHDHLLPSSGNA   62 (559)
T ss_pred             CchhhhcccCCCCCc-ccccchhHHHHHHHHHHHHHHHHHHHHHcCCCCCccccccccccccc
Confidence            899999999999888 99999999999999999999999999999999999999876654443


No 2  
>PRK10119 putative hydrolase; Provisional
Probab=73.32  E-value=3.3  Score=30.48  Aligned_cols=33  Identities=21%  Similarity=0.274  Sum_probs=20.8

Q ss_pred             CCCCCCCCCCCcccccccCCcchHHHHHHHHHhh
Q 034721           50 TSHHDPVSPPPLHSFFHLSEMPFINYFYEKLLSI   83 (86)
Q Consensus        50 tshhdpvsppplhsffhlsempfinyfyekllsi   83 (86)
                      ...+||-.||..+..-- ..-.-||.|||||+.+
T Consensus       149 r~~~d~~~~~~~~~~~~-~~~~~i~HF~eKLl~L  181 (231)
T PRK10119        149 VALFDAEDPFAQHRPLD-DKQYALDHFQTKLLKL  181 (231)
T ss_pred             CCCCCCCCcchhhcccc-CchhHHHHHHHHHHhh
Confidence            45577777665543221 1124699999999875


No 3  
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=53.86  E-value=20  Score=19.64  Aligned_cols=26  Identities=23%  Similarity=0.377  Sum_probs=16.4

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHH
Q 034721           18 LRSLFSYRIFVSAMFSLLFLATLSVI   43 (86)
Q Consensus        18 lrslfsyrifvsamfsllflatlsvi   43 (86)
                      +|.+++.|..+-++.-++++..++++
T Consensus         9 ~~~f~~nk~a~~gl~il~~~vl~ai~   34 (56)
T PF12911_consen    9 WRRFRRNKLAVIGLIILLILVLLAIF   34 (56)
T ss_pred             HHHHHhCchHHHHHHHHHHHHHHHHH
Confidence            45666777766666666666555554


No 4  
>PHA02673 ORF109 EEV glycoprotein; Provisional
Probab=44.88  E-value=41  Score=24.89  Aligned_cols=28  Identities=29%  Similarity=0.344  Sum_probs=20.7

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHhcc
Q 034721           19 RSLFSYRIFVSAMFSLLFLATLSVILTS   46 (86)
Q Consensus        19 rslfsyrifvsamfsllflatlsvilts   46 (86)
                      |..+.--+=++++.|++-|++|.|+|..
T Consensus        29 ~R~i~l~~Ri~~~iSIisL~~l~v~LaL   56 (161)
T PHA02673         29 RRYIKLFFRLMAAIAIIVLAILVVILAL   56 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4445555557889999999999998853


No 5  
>PHA03093 EEV glycoprotein; Provisional
Probab=43.83  E-value=43  Score=25.26  Aligned_cols=36  Identities=28%  Similarity=0.403  Sum_probs=25.1

Q ss_pred             CCcccCcchhh--------hHHHHHHHHHHHHHHHHHHHHHHhc
Q 034721           10 GGTAVGPGLRS--------LFSYRIFVSAMFSLLFLATLSVILT   45 (86)
Q Consensus        10 ggtavgpglrs--------lfsyrifvsamfsllflatlsvilt   45 (86)
                      |.|--|+.|..        .+..-|=+++..|++-|++++++|.
T Consensus        15 gsTiYG~klkkk~~~kk~r~i~i~~RisiiiSIlsL~~i~~~LA   58 (185)
T PHA03093         15 GSTIYGDKLKKKKNKKKVKCIGICIRISIIISILSLIAITATLA   58 (185)
T ss_pred             eeeeechhhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56777887753        3333444677888888888888774


No 6  
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]
Probab=39.30  E-value=18  Score=28.68  Aligned_cols=13  Identities=54%  Similarity=0.981  Sum_probs=11.7

Q ss_pred             CeeeeecCCCCcc
Q 034721            1 MAVAIRGGRGGTA   13 (86)
Q Consensus         1 mavairggrggta   13 (86)
                      |-|||-||.|||.
T Consensus         2 m~vAV~sGKGGtG   14 (284)
T COG1149           2 MQVAVASGKGGTG   14 (284)
T ss_pred             cEEEEeecCCCCC
Confidence            6799999999986


No 7  
>PLN02687 flavonoid 3'-monooxygenase
Probab=39.11  E-value=49  Score=24.78  Aligned_cols=25  Identities=12%  Similarity=0.080  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHhccCCCCCCC
Q 034721           29 SAMFSLLFLATLSVILTSHPSTSHH   53 (86)
Q Consensus        29 samfsllflatlsviltshpstshh   53 (86)
                      +..+..+|+|++++++..|-..++-
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~   30 (517)
T PLN02687          6 PLLLGTVAVSVLVWCLLLRRGGSGK   30 (517)
T ss_pred             hHHHHHHHHHHHHHHHHhccccCCC
Confidence            4455567778888887766555543


No 8  
>MTH00077 COX1 cytochrome c oxidase subunit I; Provisional
Probab=36.62  E-value=91  Score=25.62  Aligned_cols=16  Identities=44%  Similarity=0.972  Sum_probs=12.9

Q ss_pred             CCCCCcccccccCCcchHH
Q 034721           56 VSPPPLHSFFHLSEMPFIN   74 (86)
Q Consensus        56 vsppplhsffhlsempfin   74 (86)
                      -+|||-|+|   .|.||++
T Consensus       497 ~sPPp~hnf---~e~p~~~  512 (514)
T MTH00077        497 GCPPPYHTF---EEPSFVQ  512 (514)
T ss_pred             CCCCCccCC---CCccccc
Confidence            379999997   6888864


No 9  
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=35.34  E-value=42  Score=22.62  Aligned_cols=22  Identities=32%  Similarity=0.754  Sum_probs=17.6

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHH
Q 034721           18 LRSLFSYRIFVSAMFSLLFLAT   39 (86)
Q Consensus        18 lrslfsyrifvsamfsllflat   39 (86)
                      +-.+..|-.|+.|+|-|+.++.
T Consensus        18 ~e~llRYGLf~GAIFQliCilA   39 (85)
T PF06783_consen   18 FENLLRYGLFVGAIFQLICILA   39 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            4567889999999999876544


No 10 
>PTZ00067 40S ribosomal S23; Provisional
Probab=35.05  E-value=23  Score=25.83  Aligned_cols=18  Identities=61%  Similarity=1.162  Sum_probs=14.1

Q ss_pred             eeeeec-CCCCcccC--cchh
Q 034721            2 AVAIRG-GRGGTAVG--PGLR   19 (86)
Q Consensus         2 avairg-grggtavg--pglr   19 (86)
                      -|-||| ||-|.++|  ||.|
T Consensus        99 ~VLV~G~Gr~g~~v~DlPGVr  119 (143)
T PTZ00067         99 EVLVSGFGRSGHAVGDIPGVR  119 (143)
T ss_pred             EEEEEecCcCCCccCCCCceE
Confidence            378999 99887877  7765


No 11 
>KOG2204 consensus Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [Carbohydrate transport and metabolism]
Probab=29.43  E-value=1.1e+02  Score=26.98  Aligned_cols=47  Identities=17%  Similarity=-0.119  Sum_probs=35.1

Q ss_pred             CCcccCcchhhhHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCC
Q 034721           10 GGTAVGPGLRSLFSYRIFVSAMFSLLFLATLSVILTSHPSTSHHDPV   56 (86)
Q Consensus        10 ggtavgpglrslfsyrifvsamfsllflatlsviltshpstshhdpv   56 (86)
                      +..+++-+-+.+-.+.+|+..|.+..+...+-.-...+||+++++-.
T Consensus         5 ~~p~~~~~p~~lr~~~~~~~~l~~~~~~~Lc~~a~f~~ps~~~~~~~   51 (625)
T KOG2204|consen    5 IQPAMQLPPDVLRLKQIFLIFLGSSFQETLCLGANFRLPSSSPLLLI   51 (625)
T ss_pred             CCCcCCCChHHHHHHHHHHHHHHHHHHHHhhhhheeeCCCCCchhhe
Confidence            33445445566777888999888887777777778899999998743


No 12 
>PF03772 Competence:  Competence protein;  InterPro: IPR004477 This family is defined to identify a pair of paralogous 3' exoribonucleases in Escherichia coli, plus the set of proteins apparently orthologous to one or the other in other eubacteria. VacB was characterised originally as required for the expression of virulence genes, but is now recognised as the exoribonuclease RNase R (Rnr). Its paralog in Escherichia coli and Haemophilus influenzae is designated exoribonuclease II (Rnb). Both are involved in the degradation of mRNA, and consequently have strong pleiotropic effects that may be difficult to disentangle. Both these proteins share domain-level similarity (RNB, S1) with a considerable number of other proteins, and full-length similarity scoring below the trusted cut off to proteins associated with various phenotypes but uncertain biochemistry; it may be that these latter proteins are also 3' exoribonucleases. Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions [].
Probab=28.93  E-value=32  Score=23.73  Aligned_cols=61  Identities=28%  Similarity=0.443  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhccCCCCCCCCCCCCCC-------cccccccCCcchHHHHHHH--HHhhhhC
Q 034721           26 IFVSAMFSLLFLATLSVILTSHPSTSHHDPVSPPP-------LHSFFHLSEMPFINYFYEK--LLSIIAN   86 (86)
Q Consensus        26 ifvsamfsllflatlsviltshpstshhdpvsppp-------lhsffhlsempfinyfyek--llsiian   86 (86)
                      ...+.-|-|-|+|++.+++...+-...-++..+.-       .--...+.-+|.+-|++.+  +.|+++|
T Consensus       118 ~l~~~gF~LSf~av~~I~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~Pl~~~~f~~~s~~si~~N  187 (271)
T PF03772_consen  118 SLFSIGFQLSFLAVFGIILFYPPLKRLLQKLIKKLRSLLSLAISLAAQLATLPLLLYYFGSISLISILAN  187 (271)
T ss_pred             HHHhcchHHHHHHHHHHHHhchhhhccccccchhhHHHHHhhhHHHHHHHHHHHHHHHcCCCChHHHHHH
Confidence            33445566778899998887755544444433221       2233355566766655554  3444444


No 13 
>PLN03153 hypothetical protein; Provisional
Probab=28.16  E-value=1.1e+02  Score=26.31  Aligned_cols=26  Identities=19%  Similarity=0.238  Sum_probs=19.2

Q ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHH
Q 034721           17 GLRSLFSYRIFVSAMFSLLFLATLSV   42 (86)
Q Consensus        17 glrslfsyrifvsamfsllflatlsv   42 (86)
                      ++..+.+|-|...+.++|+|..++..
T Consensus        30 ~~~~~~~~l~~~~~~~~l~~~~~~~~   55 (537)
T PLN03153         30 AVVAVAALLLSTTAWLSLVFSGTTAR   55 (537)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhh
Confidence            47888888888888888887755433


No 14 
>PF09967 DUF2201:  VWA-like domain (DUF2201);  InterPro: IPR018698  This family of various hypothetical bacterial proteins has no known function. 
Probab=28.07  E-value=25  Score=22.87  Aligned_cols=19  Identities=37%  Similarity=0.482  Sum_probs=14.0

Q ss_pred             cCCCCcccCcchhhhHHHH
Q 034721            7 GGRGGTAVGPGLRSLFSYR   25 (86)
Q Consensus         7 ggrggtavgpglrslfsyr   25 (86)
                      .|+|||...|..+-+-..+
T Consensus        62 ~GgGGTdf~pvf~~~~~~~   80 (126)
T PF09967_consen   62 KGGGGTDFRPVFEYLEENR   80 (126)
T ss_pred             CCCCCCcchHHHHHHHhcC
Confidence            5899999988776655433


No 15 
>MTH00037 COX1 cytochrome c oxidase subunit I; Provisional
Probab=27.20  E-value=1.8e+02  Score=23.97  Aligned_cols=15  Identities=40%  Similarity=0.713  Sum_probs=11.4

Q ss_pred             CCCCCcccccccCCcchH
Q 034721           56 VSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        56 vsppplhsffhlsempfi   73 (86)
                      .+|||.|+|   .|.|++
T Consensus       498 ~~Ppp~hnf---~e~P~v  512 (517)
T MTH00037        498 SFPPSHHTF---DETPST  512 (517)
T ss_pred             CCCCCccCC---CCCcee
Confidence            369999998   477754


No 16 
>MTH00183 COX1 cytochrome c oxidase subunit I; Provisional
Probab=26.78  E-value=1.8e+02  Score=23.83  Aligned_cols=16  Identities=44%  Similarity=0.932  Sum_probs=12.4

Q ss_pred             CCCCCCcccccccCCcchH
Q 034721           55 PVSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        55 pvsppplhsffhlsempfi   73 (86)
                      -.+|||.|+|   .|.|++
T Consensus       496 ~~sPPp~hnf---~e~p~v  511 (516)
T MTH00183        496 HGCPPPYHTF---EEPAFV  511 (516)
T ss_pred             CCCCCCccCC---CCCcee
Confidence            3489999997   677765


No 17 
>PF01712 dNK:  Deoxynucleoside kinase;  InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2.7.1.74 from EC), guanosine (2.7.1.113 from EC), adenosine (2.7.1.76 from EC) and thymidine kinase (2.7.1.21 from EC, which also phosphorylates deoxyuridine and deoxycytosine. These enzymes catalyse the production of deoxynucleotide 5'-monophosphate from a deoxynucleoside, using ATP and yielding ADP in the process.; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0006139 nucleobase-containing compound metabolic process; PDB: 2JAS_B 2JAT_B 2JAQ_A 2VP4_D 1ZMX_F 1ZM7_C 1OE0_B 2VP9_C 2VPP_B 2VP6_G ....
Probab=26.45  E-value=46  Score=21.53  Aligned_cols=16  Identities=31%  Similarity=0.592  Sum_probs=13.0

Q ss_pred             hhhHH-HHHHHHHHHHH
Q 034721           19 RSLFS-YRIFVSAMFSL   34 (86)
Q Consensus        19 rslfs-yrifvsamfsl   34 (86)
                      ||++| +.||..+|+..
T Consensus        26 Rsi~sd~~vF~~~~~~~   42 (146)
T PF01712_consen   26 RSIYSDDFVFAKMLFKS   42 (146)
T ss_dssp             S-HHHHHHTHHHHHHHT
T ss_pred             CCeeechHHHHHHHHHh
Confidence            89999 99999998764


No 18 
>MTH00116 COX1 cytochrome c oxidase subunit I; Provisional
Probab=26.05  E-value=1.8e+02  Score=23.90  Aligned_cols=15  Identities=47%  Similarity=1.019  Sum_probs=11.7

Q ss_pred             CCCCCcccccccCCcchH
Q 034721           56 VSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        56 vsppplhsffhlsempfi   73 (86)
                      -+|||.|+|   .|.|++
T Consensus       497 ~sPpp~hnF---~e~P~v  511 (515)
T MTH00116        497 GCPPPYHTF---EEPAFV  511 (515)
T ss_pred             CCCCccccC---CCCcee
Confidence            379999998   577765


No 19 
>MTH00153 COX1 cytochrome c oxidase subunit I; Provisional
Probab=25.96  E-value=1.6e+02  Score=24.20  Aligned_cols=16  Identities=44%  Similarity=0.885  Sum_probs=11.9

Q ss_pred             CCCCCCcccccccCCcchH
Q 034721           55 PVSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        55 pvsppplhsffhlsempfi   73 (86)
                      -.+|||.|+|   .|.|++
T Consensus       494 ~~sPpp~hnf---~e~P~v  509 (511)
T MTH00153        494 QNLPPAEHSY---SELPLL  509 (511)
T ss_pred             cCCCCcccCC---CCCcee
Confidence            3479999997   477764


No 20 
>PTZ00474 tryptophan/threonine-rich antigen superfamily; Provisional
Probab=25.49  E-value=1.1e+02  Score=23.89  Aligned_cols=20  Identities=15%  Similarity=0.225  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q 034721           25 RIFVSAMFSLLFLATLSVIL   44 (86)
Q Consensus        25 rifvsamfsllflatlsvil   44 (86)
                      +.||+.+.+++|+.+.++++
T Consensus        33 ~~~~~~~~~~~~~~~~~~~~   52 (316)
T PTZ00474         33 TSTLSRLTILIFALSCAFFV   52 (316)
T ss_pred             hHHHHHHHHHHHHHHHHHHh
Confidence            45566666666665555554


No 21 
>PLN02971 tryptophan N-hydroxylase
Probab=24.25  E-value=1.6e+02  Score=22.40  Aligned_cols=30  Identities=27%  Similarity=0.384  Sum_probs=13.9

Q ss_pred             CCcccCcchhhhHHHHHHHHHHHHHHHHHHHH
Q 034721           10 GGTAVGPGLRSLFSYRIFVSAMFSLLFLATLS   41 (86)
Q Consensus        10 ggtavgpglrslfsyrifvsamfsllflatls   41 (86)
                      -|++--||--+ |+ ..++...|.+++..+++
T Consensus        11 ~~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~   40 (543)
T PLN02971         11 LTTKSSPGTSS-FT-NMYLLTTLQALVAITLL   40 (543)
T ss_pred             cccccCCCCcc-HH-HHHHHHHHHHHHHHHHH
Confidence            35666677554 33 33334444444333333


No 22 
>PF14937 DUF4500:  Domain of unknown function (DUF4500)
Probab=23.75  E-value=32  Score=23.31  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=15.1

Q ss_pred             cccCcchhhhHHHHHHHHHHH
Q 034721           12 TAVGPGLRSLFSYRIFVSAMF   32 (86)
Q Consensus        12 tavgpglrslfsyrifvsamf   32 (86)
                      ..-||||||+-+-..|-..=|
T Consensus         9 ~~~g~GlRs~rtT~lFRavNf   29 (86)
T PF14937_consen    9 DFPGPGLRSVRTTTLFRAVNF   29 (86)
T ss_pred             CCCCCCccccccchhhhhhCH
Confidence            456899999988777655433


No 23 
>MTH00167 COX1 cytochrome c oxidase subunit I; Provisional
Probab=23.47  E-value=2e+02  Score=23.50  Aligned_cols=16  Identities=44%  Similarity=0.974  Sum_probs=11.6

Q ss_pred             CCCCCCcccccccCCcchH
Q 034721           55 PVSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        55 pvsppplhsffhlsempfi   73 (86)
                      -.+|||.|+|   .|.|++
T Consensus       496 ~~sPpp~hnf---~e~P~v  511 (512)
T MTH00167        496 HGCPPPHHTW---EEPPFV  511 (512)
T ss_pred             CCCCCcccCC---CcCCCC
Confidence            3489999998   366754


No 24 
>MTH00026 COX1 cytochrome c oxidase subunit I; Provisional
Probab=22.96  E-value=2.2e+02  Score=23.51  Aligned_cols=14  Identities=43%  Similarity=1.132  Sum_probs=10.6

Q ss_pred             CCCCCcccccccCCcch
Q 034721           56 VSPPPLHSFFHLSEMPF   72 (86)
Q Consensus        56 vsppplhsffhlsempf   72 (86)
                      -+|||.|+|   .|.|+
T Consensus       513 ~sPpp~hnf---~e~P~  526 (534)
T MTH00026        513 TSPPEHHTY---NELPY  526 (534)
T ss_pred             CCCCCccCC---CCCce
Confidence            379999998   46664


No 25 
>PF14992 TMCO5:  TMCO5 family
Probab=21.66  E-value=1.1e+02  Score=24.12  Aligned_cols=29  Identities=24%  Similarity=0.221  Sum_probs=22.7

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHhccC
Q 034721           19 RSLFSYRIFVSAMFSLLFLATLSVILTSH   47 (86)
Q Consensus        19 rslfsyrifvsamfsllflatlsviltsh   47 (86)
                      +..|.+|+|-..+|..||+..|..-+.-|
T Consensus       210 ~~~~wkr~lr~l~f~vL~f~~LL~y~~f~  238 (280)
T PF14992_consen  210 SPTFWKRALRLLFFMVLFFTRLLGYLLFY  238 (280)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45899999999888888877777666555


No 26 
>MTH00103 COX1 cytochrome c oxidase subunit I; Validated
Probab=21.55  E-value=2.2e+02  Score=23.52  Aligned_cols=16  Identities=38%  Similarity=0.889  Sum_probs=12.1

Q ss_pred             CCCCCCcccccccCCcchH
Q 034721           55 PVSPPPLHSFFHLSEMPFI   73 (86)
Q Consensus        55 pvsppplhsffhlsempfi   73 (86)
                      -.+|||.|+|   .|.|.+
T Consensus       496 ~~sPpp~Hnf---~e~P~v  511 (513)
T MTH00103        496 HGCPPPYHTF---EEPTYV  511 (513)
T ss_pred             CCCCCCccCC---CCCCcc
Confidence            3479999997   577765


No 27 
>COG0114 FumC Fumarase [Energy production and conversion]
Probab=21.01  E-value=39  Score=28.69  Aligned_cols=16  Identities=50%  Similarity=0.779  Sum_probs=12.3

Q ss_pred             CCCcccCcchhhhHHH
Q 034721            9 RGGTAVGPGLRSLFSY   24 (86)
Q Consensus         9 rggtavgpglrslfsy   24 (86)
                      -||||||-||..--.|
T Consensus       226 iGGTAVGTGlNa~p~f  241 (462)
T COG0114         226 IGGTAVGTGLNAHPEF  241 (462)
T ss_pred             cCCcccccCcCCCccH
Confidence            4899999998765444


No 28 
>cd03367 Ribosomal_S23 S12-like family, 40S ribosomal protein S23 subfamily; S23 is located at the interface of the large and small ribosomal subunits of eukaryotes, adjacent to the decoding center. It interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes the translocation of the growing peptidyl-tRNA to the P site to make room for the next aminoacyl-tRNA at the A (acceptor) site. Through its interaction with eEF2, S23 may play an important role in translocation. Also members of this subfamily are the archaeal 30S ribosomal S12 proteins. Prokaryotic S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as control element for the rRNA- and tRNA-driven movements of translocation. S12 and S23 are also implicated in translation accuracy. Antibiotics such as streptomycin bind S12/S23 and cause the ribosome to misread the genetic code.
Probab=20.89  E-value=60  Score=22.92  Aligned_cols=17  Identities=65%  Similarity=1.195  Sum_probs=11.1

Q ss_pred             eeeec-CCCCcccC--cchh
Q 034721            3 VAIRG-GRGGTAVG--PGLR   19 (86)
Q Consensus         3 vairg-grggtavg--pglr   19 (86)
                      |-||| |+.|.++|  ||.|
T Consensus        75 VLV~G~G~~Gg~v~DlPGVr   94 (115)
T cd03367          75 VLVAGFGRKGRAVGDIPGVR   94 (115)
T ss_pred             EEEEecccCCCccCCCCceE
Confidence            67888 66555554  7765


No 29 
>PF00689 Cation_ATPase_C:  Cation transporting ATPase, C-terminus;  InterPro: IPR006068 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2.  This entry represents the conserved C-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+ (3.6.3.6 from EC), Na+ (3.6.3.7 from EC), Ca2+ (3.6.3.8 from EC), Na+/K+ (3.6.3.9 from EC), and H+/K+ (3.6.3.10 from EC). In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. More information about this protein can be found at Protein of the Month: ATP Synthases [].; PDB: 3A3Y_A 2ZXE_A 2XZB_A 3B9B_A 3N5K_A 3FPS_A 3B9R_A 1WPG_C 2AGV_A 2O9J_A ....
Probab=20.81  E-value=1.6e+02  Score=18.62  Aligned_cols=23  Identities=22%  Similarity=0.454  Sum_probs=14.3

Q ss_pred             CCcccccccCCcchHHHHHHHHH
Q 034721           59 PPLHSFFHLSEMPFINYFYEKLL   81 (86)
Q Consensus        59 pplhsffhlsempfinyfyekll   81 (86)
                      |+++++|++..+++..|++--..
T Consensus       146 P~~~~~f~~~~l~~~~w~~~l~~  168 (182)
T PF00689_consen  146 PGLNRIFGTAPLPLWQWLICLAL  168 (182)
T ss_dssp             TTHHHHST----THHHHHCHHHH
T ss_pred             hhhHhhhcccCCCHHHHHHHHHH
Confidence            46999999999999998765333


No 30 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=20.72  E-value=35  Score=27.34  Aligned_cols=16  Identities=19%  Similarity=0.374  Sum_probs=7.2

Q ss_pred             CcccCcchhhhHHHHH
Q 034721           11 GTAVGPGLRSLFSYRI   26 (86)
Q Consensus        11 gtavgpglrslfsyri   26 (86)
                      |||+|...-..+.|-|
T Consensus       248 gtAAtaA~aaF~Pcgi  263 (295)
T TIGR01478       248 ERAASAATSTFLPYGI  263 (295)
T ss_pred             chHHHHHHHhhcccHH
Confidence            3444444444444544


No 31 
>TIGR02891 CtaD_CoxA cytochrome c oxidase, subunit I. These families, as well as archaeal and eukaryotic cytochrome c subunit I's are included within the superfamily model, pfam00115.
Probab=20.41  E-value=2.2e+02  Score=22.56  Aligned_cols=15  Identities=47%  Similarity=1.059  Sum_probs=11.0

Q ss_pred             CCCCCCcccccccCCcch
Q 034721           55 PVSPPPLHSFFHLSEMPF   72 (86)
Q Consensus        55 pvsppplhsffhlsempf   72 (86)
                      -.+|||.|+|   .|.|.
T Consensus       491 ~~~Pp~~h~f---~e~p~  505 (506)
T TIGR02891       491 TSSPPPAHNF---ESLPV  505 (506)
T ss_pred             CCCCCcccCC---CCCCC
Confidence            3479999997   46664


Done!