BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034752
(85 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
Length = 93
Score = 73.9 bits (180), Expect = 2e-14, Method: Compositional matrix adjust.
Identities = 34/47 (72%), Positives = 39/47 (82%)
Query: 4 EEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILG 50
E AV EPLDL+RLSLDE +YVKLR DREL G+LHAYD+HLN +LG
Sbjct: 2 ESAQAVAEPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNXVLG 48
>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
Length = 96
Score = 53.1 bits (126), Expect = 4e-08, Method: Compositional matrix adjust.
Identities = 22/42 (52%), Positives = 32/42 (76%)
Query: 9 VKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILG 50
++ PLDL++L+LDER+Y+KLR R L G L A+D H N++L
Sbjct: 8 METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLS 49
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 44.7 bits (104), Expect = 1e-05, Method: Compositional matrix adjust.
Identities = 19/48 (39%), Positives = 31/48 (64%)
Query: 2 ASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
S + V+ PLD + SL+ + +KL+ DRE RG L ++D H+N++L
Sbjct: 6 VSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 53
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 44.7 bits (104), Expect = 1e-05, Method: Compositional matrix adjust.
Identities = 19/47 (40%), Positives = 31/47 (65%)
Query: 3 SEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
S + V+ PLD + SL+ + +KL+ DRE RG L ++D H+N++L
Sbjct: 5 SSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 44.7 bits (104), Expect = 1e-05, Method: Compositional matrix adjust.
Identities = 19/47 (40%), Positives = 31/47 (65%)
Query: 3 SEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
S + V+ PLD + SL+ + +KL+ DRE RG L ++D H+N++L
Sbjct: 5 SSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit
Length = 85
Score = 44.7 bits (104), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 19/48 (39%), Positives = 31/48 (64%)
Query: 2 ASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
S + V+ PLD + SL+ + +KL+ DRE RG L ++D H+N++L
Sbjct: 4 VSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 42.0 bits (97), Expect = 9e-05, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 25/38 (65%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PLD++ SL + V+L+ RE RG L YD H+N++L
Sbjct: 5 PLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVL 42
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
Length = 121
Score = 40.0 bits (92), Expect = 3e-04, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 25/38 (65%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PL LI + RIYV ++ D+E G L +D+++NM+L
Sbjct: 29 PLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVL 66
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 40.0 bits (92), Expect = 4e-04, Method: Compositional matrix adjust.
Identities = 19/38 (50%), Positives = 26/38 (68%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PLD+I SLD+ + V L+ E RG+L YD HLN++L
Sbjct: 7 PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL 44
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 39.7 bits (91), Expect = 4e-04, Method: Compositional matrix adjust.
Identities = 19/38 (50%), Positives = 26/38 (68%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PLD+I SLD+ + V L+ E RG+L YD HLN++L
Sbjct: 5 PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL 42
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 39.7 bits (91), Expect = 5e-04, Method: Compositional matrix adjust.
Identities = 15/31 (48%), Positives = 25/31 (80%)
Query: 19 SLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
SL+ + VKL+ ++E+RG L +YDQH+N++L
Sbjct: 17 SLNNLVLVKLKGNKEVRGMLRSYDQHMNLVL 47
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
Length = 81
Score = 35.8 bits (81), Expect = 0.005, Method: Compositional matrix adjust.
Identities = 14/31 (45%), Positives = 24/31 (77%)
Query: 19 SLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
S+ +++ VKLR E+RG L ++DQH+N++L
Sbjct: 19 SIGKQVLVKLRDSHEIRGILRSFDQHVNLLL 49
>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 82
Score = 35.0 bits (79), Expect = 0.010, Method: Compositional matrix adjust.
Identities = 13/38 (34%), Positives = 25/38 (65%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PL+LI + ++V ++S+RE G L +D ++N++L
Sbjct: 9 PLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVL 46
>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
Length = 94
Score = 33.5 bits (75), Expect = 0.028, Method: Compositional matrix adjust.
Identities = 13/38 (34%), Positives = 24/38 (63%)
Query: 12 PLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PL+LI + ++V +S+RE G L +D ++N++L
Sbjct: 21 PLELIDKCIGSNLWVIXKSEREFAGTLVGFDDYVNIVL 58
>pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|C Chain C, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|P Chain P, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Q Chain Q, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|R Chain R, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|Y Chain Y, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|V Chain V, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|B Chain B, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|B Chain B, Macromolecular Machine 6
pdb|4F7U|D Chain D, Macromolecular Machine 6
pdb|1VU2|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU2|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU2|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU2|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU2|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|1VU2|XX Chain x, The 8s Snrnp Assembly Intermediate
pdb|1VU3|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU3|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU3|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU3|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU3|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|4F77|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|4F77|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|4F77|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|4F77|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|4F77|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|XX Chain x, The 8s Snrnp Assembly Intermediate
Length = 118
Score = 30.8 bits (68), Expect = 0.19, Method: Compositional matrix adjust.
Identities = 12/40 (30%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
Query: 12 PLDLIRLSL--DERIYVKLRSDRELRGKLHAYDQHLNMIL 49
PL ++ S+ + ++ + R++++L G++ A+D+H NM+L
Sbjct: 28 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVL 67
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 117
Score = 29.6 bits (65), Expect = 0.40, Method: Compositional matrix adjust.
Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Query: 13 LDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
LDL R D+RI R++ G L +DQ +N++L
Sbjct: 30 LDLSRYQ-DQRIQATFTGGRQITGILKGFDQLMNLVL 65
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
Length = 113
Score = 28.5 bits (62), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
Query: 13 LDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMIL 49
LDL R D+RI R++ G L +DQ N++L
Sbjct: 26 LDLSRYQ-DQRIQATFTGGRQITGILKGFDQLXNLVL 61
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.141 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,572,579
Number of Sequences: 62578
Number of extensions: 36972
Number of successful extensions: 111
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 95
Number of HSP's gapped (non-prelim): 17
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)