Citrus Sinensis ID: 034753

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTKSKLALLNEKLDTLERRLELLEVQVGTASANPHLFTT
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
**********VNVGIAVQADWENREFISHISLNVRRLFEFLVQFEATTKSKLALLNEKLDTLERRLELLEVQVGTASA*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPHLFTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein BRICK1 Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.confidentQ84VA7
Protein BRICK 1 Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.confidentQ94JY4
Protein BRICK1 Promotes multiple, actin-dependent cell polarization events in the developing leaf epidermis. Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.probableQ8RW98

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PP5, chain A
Confidence level:very confident
Coverage over the Query: 13-75
View the alignment between query and template
View the model in PyMOL