BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034767
         (84 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3V9F|A Chain A, Crystal Structure Of The Extracellular Domain Of The
           Putative Hybrid Two Component System Bt3049 From B.
           Thetaiotaomicron
 pdb|3V9F|B Chain B, Crystal Structure Of The Extracellular Domain Of The
           Putative Hybrid Two Component System Bt3049 From B.
           Thetaiotaomicron
 pdb|3V9F|C Chain C, Crystal Structure Of The Extracellular Domain Of The
           Putative Hybrid Two Component System Bt3049 From B.
           Thetaiotaomicron
 pdb|3V9F|D Chain D, Crystal Structure Of The Extracellular Domain Of The
           Putative Hybrid Two Component System Bt3049 From B.
           Thetaiotaomicron
          Length = 781

 Score = 25.8 bits (55), Expect = 6.2,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 10/49 (20%)

Query: 39  SPNDKTSLKDEDESNFTRSIQ--NGFWV--------FVDMASGRYLWRN 77
           +P D  SL   D ++ T S+Q   G WV        ++D+A+G++   N
Sbjct: 105 NPEDPQSLITNDVTHITSSVQAGKGLWVCTYYRGIEYLDIATGKFTHYN 153


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.135    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,475,593
Number of Sequences: 62578
Number of extensions: 80384
Number of successful extensions: 176
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 176
Number of HSP's gapped (non-prelim): 2
length of query: 84
length of database: 14,973,337
effective HSP length: 52
effective length of query: 32
effective length of database: 11,719,281
effective search space: 375016992
effective search space used: 375016992
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)