Query         034767
Match_columns 84
No_of_seqs    34 out of 36
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 06:14:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034767.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034767hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06679 DUF1180:  Protein of u  84.4    0.94   2E-05   33.3   2.6   22    6-27     99-120 (163)
  2 CHL00190 psaM photosystem I su  69.6     6.8 0.00015   22.0   2.7   18    6-23      7-24  (30)
  3 TIGR03053 PS_I_psaM photosyste  69.5     6.9 0.00015   21.7   2.7   18    6-23      6-23  (29)
  4 PRK11874 petL cytochrome b6-f   68.3     7.5 0.00016   21.9   2.7   20    6-25      9-28  (30)
  5 PF07465 PsaM:  Photosystem I p  68.3       8 0.00017   21.5   2.7   18    6-23      6-23  (29)
  6 PF06522 B12D:  NADH-ubiquinone  68.2     6.7 0.00015   24.8   2.8   27    6-32     10-36  (73)
  7 PRK11878 psaM photosystem I re  67.7     7.6 0.00017   22.3   2.7   18    6-23     10-27  (34)
  8 smart00564 PQQ beta-propeller   60.8     1.8 3.9E-05   22.0  -0.7   18   59-76     14-31  (33)
  9 COG3745 CpaB Flp pilus assembl  55.1      16 0.00036   29.3   3.4   28    1-28      1-31  (276)
 10 KOG2592 Tumor differentially e  51.3     4.7  0.0001   34.1  -0.2   15   51-65    102-116 (426)
 11 PRK03427 cell division protein  46.4      20 0.00043   29.3   2.7   15    1-15      2-16  (333)
 12 PF03672 UPF0154:  Uncharacteri  46.4      25 0.00054   22.6   2.6   18    6-23      3-20  (64)
 13 TIGR01843 type_I_hlyD type I s  46.1      20 0.00044   27.0   2.6   26    3-28      3-28  (423)
 14 PF14138 COX16:  Cytochrome c o  44.9      14 0.00029   24.1   1.3   23    4-26      1-23  (80)
 15 PRK04335 cell division protein  44.2      18  0.0004   29.2   2.2   27    1-27      1-27  (313)
 16 PF01011 PQQ:  PQQ enzyme repea  42.3     3.6 7.9E-05   22.3  -1.5   19   59-77      8-26  (38)
 17 PF02411 MerT:  MerT mercuric t  41.6      49  0.0011   22.9   3.8   26    3-28     49-74  (116)
 18 PF10136 SpecificRecomb:  Site-  41.4      18  0.0004   31.7   1.9   16    7-22    478-493 (643)
 19 PF08520 DUF1748:  Fungal prote  39.8      21 0.00046   23.0   1.6   20    8-29     11-30  (70)
 20 PF10833 DUF2572:  Protein of u  35.4      35 0.00075   26.4   2.4   16    6-21      7-22  (221)
 21 TIGR02205 septum_zipA cell div  35.3      27 0.00059   27.6   1.9   12    4-15      2-13  (284)
 22 TIGR02833 spore_III_AB stage I  33.9      22 0.00049   25.4   1.1   23    6-28      5-27  (170)
 23 PRK08307 stage III sporulation  33.2      25 0.00055   25.2   1.3   22    7-28      7-28  (171)
 24 PF09548 Spore_III_AB:  Stage I  32.5      25 0.00053   24.9   1.1   23    6-28      5-27  (170)
 25 PRK10476 multidrug resistance   32.5      36 0.00079   25.9   2.1   21    3-23     13-33  (346)
 26 PF10066 DUF2304:  Uncharacteri  31.2      62  0.0013   21.6   2.9   26    1-27      1-26  (115)
 27 PRK00269 zipA cell division pr  30.7      47   0.001   26.8   2.6   24    4-27      5-31  (293)
 28 PF09615 Cas_Csy3:  CRISPR-asso  30.2     8.9 0.00019   31.3  -1.6   29   51-79    111-145 (331)
 29 PF01222 ERG4_ERG24:  Ergostero  29.0      35 0.00075   28.2   1.6   57    6-66    304-360 (432)
 30 PF02529 PetG:  Cytochrome B6-F  28.4      73  0.0016   18.7   2.5   16    6-21      9-24  (37)
 31 PF07543 PGA2:  Protein traffic  27.0      38 0.00082   24.2   1.3   14    4-22     18-31  (140)
 32 COG4389 Site-specific recombin  26.4      44 0.00095   29.7   1.8   14    7-20    502-515 (677)
 33 PF13334 DUF4094:  Domain of un  25.9      88  0.0019   20.9   2.8   23    7-29      6-28  (95)
 34 PF14851 FAM176:  FAM176 family  25.7      70  0.0015   23.4   2.5   18    3-20     19-36  (153)
 35 PRK04233 hypothetical protein;  25.3      22 0.00047   25.1  -0.2   16   51-68    113-128 (129)
 36 TIGR02566 cas_Csy3 CRISPR-asso  25.2      12 0.00026   30.7  -1.6   27   53-79    117-149 (341)
 37 PF13706 PepSY_TM_3:  PepSY-ass  24.5      75  0.0016   17.6   2.0   13    6-18     19-31  (37)
 38 PF05545 FixQ:  Cbb3-type cytoc  24.4      98  0.0021   17.7   2.5   19    6-24     13-31  (49)
 39 PF06364 DUF1068:  Protein of u  24.1      53  0.0011   25.0   1.7   17    4-20      8-24  (176)
 40 PF12046 DUF3529:  Protein of u  24.0      59  0.0013   24.4   1.9   19    6-25    113-131 (173)
 41 PF12588 PSDC:  Phophatidylseri  23.4      46   0.001   23.9   1.2   21    2-22     74-94  (141)
 42 PF14004 DUF4227:  Protein of u  23.1      95  0.0021   20.1   2.5   24    4-27      7-30  (71)
 43 PRK01844 hypothetical protein;  22.9   1E+02  0.0022   20.3   2.7   17    7-23     11-27  (72)
 44 PRK00523 hypothetical protein;  22.9   1E+02  0.0022   20.3   2.7   17    7-23     12-28  (72)
 45 PF13808 DDE_Tnp_1_assoc:  DDE_  21.9      69  0.0015   20.5   1.7   17    6-22     24-40  (90)
 46 PF06092 DUF943:  Enterobacteri  21.8      86  0.0019   23.1   2.3   16   10-28     13-28  (157)
 47 PF09527 ATPase_gene1:  Putativ  21.7 1.3E+02  0.0029   17.3   2.8   20    6-25     36-55  (55)
 48 CHL00008 petG cytochrome b6/f   21.7   1E+02  0.0022   18.2   2.2   16    6-21      9-24  (37)
 49 PF10229 DUF2246:  Uncharacteri  21.2      40 0.00087   26.6   0.6   19   58-76    199-218 (278)
 50 PF05620 DUF788:  Protein of un  21.2 2.1E+02  0.0045   20.4   4.2   15   11-25    122-136 (170)
 51 TIGR01375 soxG sarcosine oxida  20.6      90   0.002   21.3   2.2   25   58-82    126-150 (152)
 52 PF11808 DUF3329:  Domain of un  20.5 1.1E+02  0.0024   19.7   2.5    8   14-21     36-43  (90)
 53 PF11683 DUF3278:  Protein of u  20.5      45 0.00098   22.8   0.6   21    7-27     70-90  (129)
 54 PRK00665 petG cytochrome b6-f   20.1 1.1E+02  0.0025   17.9   2.2   16    6-21      9-24  (37)
 55 PF12270 Cyt_c_ox_IV:  Cytochro  20.1 1.8E+02   0.004   21.0   3.7   22    8-29     44-67  (137)

No 1  
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=84.43  E-value=0.94  Score=33.33  Aligned_cols=22  Identities=41%  Similarity=0.534  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHHhccCC
Q 034767            6 FILVFFSAVLAGYFAWRTVRSS   27 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~s~   27 (84)
                      .||+.||+.+..||++|.+|..
T Consensus        99 ~Vl~g~s~l~i~yfvir~~R~r  120 (163)
T PF06679_consen   99 YVLVGLSALAILYFVIRTFRLR  120 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Confidence            5788999999999999999776


No 2  
>CHL00190 psaM photosystem I subunit XII; Provisional
Probab=69.62  E-value=6.8  Score=22.00  Aligned_cols=18  Identities=28%  Similarity=0.504  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034767            6 FILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~   23 (84)
                      ++..++.|.++|++++|-
T Consensus         7 i~iAL~~Al~~~iLA~rL   24 (30)
T CHL00190          7 IFIALFLALTTGILAIRL   24 (30)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566788999999999974


No 3  
>TIGR03053 PS_I_psaM photosystem I reaction center subunit XII. Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. The seed alignment for this model includes sequences from Pfam model pfam07465 and additional sequences, as from Prochlorococcus.
Probab=69.54  E-value=6.9  Score=21.70  Aligned_cols=18  Identities=28%  Similarity=0.512  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034767            6 FILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~   23 (84)
                      +++.++.|.++|++|+|-
T Consensus         6 i~iaL~~Al~~~iLA~rL   23 (29)
T TIGR03053         6 IFIALVIALIAGILALRL   23 (29)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566788999999999974


No 4  
>PRK11874 petL cytochrome b6-f complex subunit PetL; Reviewed
Probab=68.29  E-value=7.5  Score=21.87  Aligned_cols=20  Identities=30%  Similarity=0.570  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHHhcc
Q 034767            6 FILVFFSAVLAGYFAWRTVR   25 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~   25 (84)
                      ++.+|+++.++-||.+|+.+
T Consensus         9 ~l~~~~g~A~gl~fgLrsiK   28 (30)
T PRK11874          9 YLGVFTGIALGLYFGLRAAK   28 (30)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            67789999999999999864


No 5  
>PF07465 PsaM:  Photosystem I protein M (PsaM);  InterPro: IPR010010 Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction centre. PsaM forms part of the photosystem I complex and its binding is stabilised by PsaI []. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen.; GO: 0015979 photosynthesis, 0009522 photosystem I, 0030094 plasma membrane-derived photosystem I; PDB: 3PCQ_M 1JB0_M.
Probab=68.27  E-value=8  Score=21.55  Aligned_cols=18  Identities=22%  Similarity=0.479  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034767            6 FILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~   23 (84)
                      ++..++.|.++|++++|-
T Consensus         6 i~iAL~~Al~~~iLA~rL   23 (29)
T PF07465_consen    6 IFIALVIALITGILALRL   23 (29)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            567788999999999973


No 6  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=68.21  E-value=6.7  Score=24.82  Aligned_cols=27  Identities=19%  Similarity=0.406  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHhccCCCcccC
Q 034767            6 FILVFFSAVLAGYFAWRTVRSSPEADI   32 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~s~p~~~~   32 (84)
                      |+.|-+-+++|+|+..|.+...||.-.
T Consensus        10 ~~~vg~a~~~a~~~~~r~l~~~PdV~~   36 (73)
T PF06522_consen   10 FVIVGVAVGGATFYLYRLLLTNPDVRW   36 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCeEE
Confidence            456777889999999999999998644


No 7  
>PRK11878 psaM photosystem I reaction center subunit XII; Reviewed
Probab=67.70  E-value=7.6  Score=22.33  Aligned_cols=18  Identities=28%  Similarity=0.397  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034767            6 FILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~   23 (84)
                      +++.++.|.++|++|+|-
T Consensus        10 i~iaL~~Al~~giLA~RL   27 (34)
T PRK11878         10 VFVALVVALHAGVLALRL   27 (34)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456788999999999984


No 8  
>smart00564 PQQ beta-propeller repeat. Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
Probab=60.77  E-value=1.8  Score=21.99  Aligned_cols=18  Identities=28%  Similarity=0.625  Sum_probs=15.8

Q ss_pred             hccceeeEEccchhHHHH
Q 034767           59 QNGFWVFVDMASGRYLWR   76 (84)
Q Consensus        59 ~~GFW~~VDMASGrYLWr   76 (84)
                      .+|....+|..+|+-+|+
T Consensus        14 ~~g~l~a~d~~~G~~~W~   31 (33)
T smart00564       14 TDGTLYALDAKTGEILWT   31 (33)
T ss_pred             CCCEEEEEEcccCcEEEE
Confidence            468999999999999885


No 9  
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion]
Probab=55.14  E-value=16  Score=29.29  Aligned_cols=28  Identities=32%  Similarity=0.347  Sum_probs=22.5

Q ss_pred             CCchh---HHHHHHHHHHHHHHHHHhccCCC
Q 034767            1 MCPLR---FILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         1 MCPLR---~ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      |-|.|   .|++..+|.+|||+++..-..+|
T Consensus         1 M~~~rliil~~~~~~ag~ag~la~~~~~a~~   31 (276)
T COG3745           1 MRPKRLIILIVALAAAGLAGVLAASIWLAPA   31 (276)
T ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHhccCCc
Confidence            77888   34566789999999998888875


No 10 
>KOG2592 consensus Tumor differentially expressed (TDE) protein [Function unknown]
Probab=51.33  E-value=4.7  Score=34.10  Aligned_cols=15  Identities=47%  Similarity=0.986  Sum_probs=13.3

Q ss_pred             chhhhhhhhccceee
Q 034767           51 ESNFTRSIQNGFWVF   65 (84)
Q Consensus        51 ~sk~~~~i~~GFW~~   65 (84)
                      .++++.+||||||.|
T Consensus       102 s~D~R~~iqng~W~f  116 (426)
T KOG2592|consen  102 SKDPRAAIQNGFWFF  116 (426)
T ss_pred             CCCHHHHHHcCcHHH
Confidence            677899999999986


No 11 
>PRK03427 cell division protein ZipA; Provisional
Probab=46.39  E-value=20  Score=29.32  Aligned_cols=15  Identities=40%  Similarity=0.640  Sum_probs=11.9

Q ss_pred             CCchhHHHHHHHHHH
Q 034767            1 MCPLRFILVFFSAVL   15 (84)
Q Consensus         1 MCPLR~ILiflSA~l   15 (84)
                      |==||+|||.+.|+-
T Consensus         2 MqdLrLiLivvGAIA   16 (333)
T PRK03427          2 MQDLRLILIIVGAIA   16 (333)
T ss_pred             chhhhhHHHHHHHHH
Confidence            345999999999863


No 12 
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=46.39  E-value=25  Score=22.61  Aligned_cols=18  Identities=28%  Similarity=0.589  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034767            6 FILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~   23 (84)
                      .||.++-++++|||+-|-
T Consensus         3 iilali~G~~~Gff~ar~   20 (64)
T PF03672_consen    3 IILALIVGAVIGFFIARK   20 (64)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            577788888899988764


No 13 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=46.09  E-value=20  Score=27.03  Aligned_cols=26  Identities=15%  Similarity=0.326  Sum_probs=21.0

Q ss_pred             chhHHHHHHHHHHHHHHHHHhccCCC
Q 034767            3 PLRFILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         3 PLR~ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      +.|++++++.+++.++++|-.+-.-|
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~   28 (423)
T TIGR01843         3 FARLITWLIAGLVVIFFLWAYFAPLD   28 (423)
T ss_pred             chhhHHHHHHHHHHHHHHHHhheecc
Confidence            57999999999999999995544433


No 14 
>PF14138 COX16:  Cytochrome c oxidase assembly protein COX16
Probab=44.91  E-value=14  Score=24.06  Aligned_cols=23  Identities=30%  Similarity=0.519  Sum_probs=19.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHhccC
Q 034767            4 LRFILVFFSAVLAGYFAWRTVRS   26 (84)
Q Consensus         4 LR~ILiflSA~lAGyfa~r~l~s   26 (84)
                      |||=|=|++-+++|.|.++.+..
T Consensus         1 l~~GlPf~~liV~GS~gL~~ftq   23 (80)
T PF14138_consen    1 LRFGLPFLLLIVGGSFGLSEFTQ   23 (80)
T ss_pred             CcccccHHHHHHHHHHHHHHHHH
Confidence            56778899999999999977654


No 15 
>PRK04335 cell division protein ZipA; Provisional
Probab=44.24  E-value=18  Score=29.17  Aligned_cols=27  Identities=26%  Similarity=0.448  Sum_probs=18.1

Q ss_pred             CCchhHHHHHHHHHHHHHHHHHhccCC
Q 034767            1 MCPLRFILVFFSAVLAGYFAWRTVRSS   27 (84)
Q Consensus         1 MCPLR~ILiflSA~lAGyfa~r~l~s~   27 (84)
                      |==||||||.+-|+.=.-+++-+|+.+
T Consensus         1 MQeLRlvLiivGAlAI~ALL~HGlWts   27 (313)
T PRK04335          1 MQELRFVLIVVGALAIAALLFHGLWTS   27 (313)
T ss_pred             CcceeehHHHHHHHHHHHHHHhccccc
Confidence            456999999999875444444444443


No 16 
>PF01011 PQQ:  PQQ enzyme repeat family.;  InterPro: IPR002372 Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [, ]. A number of bacterial quinoproteins belong to this family. Enzymes in this group have repeats of a beta propeller.; PDB: 1H4I_C 1H4J_E 1W6S_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A 1G72_A ....
Probab=42.27  E-value=3.6  Score=22.32  Aligned_cols=19  Identities=26%  Similarity=0.746  Sum_probs=15.6

Q ss_pred             hccceeeEEccchhHHHHH
Q 034767           59 QNGFWVFVDMASGRYLWRN   77 (84)
Q Consensus        59 ~~GFW~~VDMASGrYLWr~   77 (84)
                      .+|.=..+|..+|+.+|+.
T Consensus         8 ~~g~l~AlD~~TG~~~W~~   26 (38)
T PF01011_consen    8 PDGYLYALDAKTGKVLWKF   26 (38)
T ss_dssp             TTSEEEEEETTTTSEEEEE
T ss_pred             CCCEEEEEECCCCCEEEee
Confidence            3677789999999999963


No 17 
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=41.64  E-value=49  Score=22.91  Aligned_cols=26  Identities=27%  Similarity=0.591  Sum_probs=22.4

Q ss_pred             chhHHHHHHHHHHHHHHHHHhccCCC
Q 034767            3 PLRFILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         3 PLR~ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      |.|-+++.++..+=||--||..+.++
T Consensus        49 pyRp~fi~~tl~~lg~a~~~~yr~~~   74 (116)
T PF02411_consen   49 PYRPYFIALTLLFLGYAFWRLYRPRK   74 (116)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHcccc
Confidence            89999999999999999898887543


No 18 
>PF10136 SpecificRecomb:  Site-specific recombinase;  InterPro: IPR011385 This group represents a site-specific recombinase Gcr. Please see the following relevant reference: [].
Probab=41.38  E-value=18  Score=31.67  Aligned_cols=16  Identities=38%  Similarity=0.808  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034767            7 ILVFFSAVLAGYFAWR   22 (84)
Q Consensus         7 ILiflSA~lAGyfa~r   22 (84)
                      +++|+|+++|||+==+
T Consensus       478 V~LF~SglIaG~~dN~  493 (643)
T PF10136_consen  478 VWLFLSGLIAGYFDNW  493 (643)
T ss_pred             HHHHHHHHHHhhHHHH
Confidence            6899999999997433


No 19 
>PF08520 DUF1748:  Fungal protein of unknown function (DUF1748);  InterPro: IPR013726 This is a family of fungal proteins of unknown function. 
Probab=39.77  E-value=21  Score=23.03  Aligned_cols=20  Identities=35%  Similarity=0.521  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHhccCCCc
Q 034767            8 LVFFSAVLAGYFAWRTVRSSPE   29 (84)
Q Consensus         8 LiflSA~lAGyfa~r~l~s~p~   29 (84)
                      ++++|++|||.  =|+-.-+|.
T Consensus        11 ~vLiS~~LAGi--rR~TGl~~~   30 (70)
T PF08520_consen   11 AVLISTFLAGI--RRNTGLTPK   30 (70)
T ss_pred             HHHHHHHHHHH--hhccCCccC
Confidence            67889999995  344444443


No 20 
>PF10833 DUF2572:  Protein of unknown function (DUF2572);  InterPro: IPR022543  This bacterial family of proteins has no known function. 
Probab=35.35  E-value=35  Score=26.44  Aligned_cols=16  Identities=25%  Similarity=0.436  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGYFAW   21 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~   21 (84)
                      .+||+||++|+-.|+.
T Consensus         7 ~~LillS~~L~l~~L~   22 (221)
T PF10833_consen    7 TILILLSGLLTLIMLF   22 (221)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            5899999999988875


No 21 
>TIGR02205 septum_zipA cell division protein ZipA. This model represents the full length of bacterial cell division protein ZipA. The N-terminal hydrophobic stretch is an uncleaved signal-anchor sequence. This is followed by an unconserved, variable length, low complexity region, and then a conserved C-terminal region of about 140 amino acids (see pfam04354) that interacts with the tubulin-like cell division protein FtsZ.
Probab=35.32  E-value=27  Score=27.63  Aligned_cols=12  Identities=33%  Similarity=0.614  Sum_probs=10.3

Q ss_pred             hhHHHHHHHHHH
Q 034767            4 LRFILVFFSAVL   15 (84)
Q Consensus         4 LR~ILiflSA~l   15 (84)
                      ||+|||.+-|+.
T Consensus         2 Lr~iLIIvGaia   13 (284)
T TIGR02205         2 LRIILIIVGILA   13 (284)
T ss_pred             ceehHHHHHHHH
Confidence            899999998864


No 22 
>TIGR02833 spore_III_AB stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB.
Probab=33.95  E-value=22  Score=25.43  Aligned_cols=23  Identities=17%  Similarity=0.434  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHHHHHHHHhccCCC
Q 034767            6 FILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      -+||++|++..||..-+.++.+|
T Consensus         5 a~LIi~s~~~~G~~~a~~~~~R~   27 (170)
T TIGR02833         5 ALLIVLSSTWIGFLYANRFKERP   27 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            37999999999999999988888


No 23 
>PRK08307 stage III sporulation protein SpoAB; Provisional
Probab=33.21  E-value=25  Score=25.18  Aligned_cols=22  Identities=14%  Similarity=0.443  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHhccCCC
Q 034767            7 ILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         7 ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      +||++|++..||..-+.++.+|
T Consensus         7 ~LIi~s~~~~G~~~a~~~~~R~   28 (171)
T PRK08307          7 VLIIAASTWIGFLYAKRYKERP   28 (171)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            7999999999999999988888


No 24 
>PF09548 Spore_III_AB:  Stage III sporulation protein AB (spore_III_AB);  InterPro: IPR014198  This entry represents the stage III sporulation protein AB, which is encoded in a spore formation operon: spoIIIAABCDEFGH that is under sigma G regulation []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species.
Probab=32.49  E-value=25  Score=24.93  Aligned_cols=23  Identities=17%  Similarity=0.265  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHHhccCCC
Q 034767            6 FILVFFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~s~p   28 (84)
                      .+||++|++..||-.-+.++.+|
T Consensus         5 ~~LIi~a~~~~G~~~a~~~~~R~   27 (170)
T PF09548_consen    5 AILIIAASSGIGFLYARRLKRRV   27 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            48999999999999988888777


No 25 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=32.47  E-value=36  Score=25.88  Aligned_cols=21  Identities=24%  Similarity=0.409  Sum_probs=17.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHh
Q 034767            3 PLRFILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         3 PLR~ILiflSA~lAGyfa~r~   23 (84)
                      ++.++++++.-++++|+.|.+
T Consensus        13 ~~~~~~~~~~~~~~~~~~~~~   33 (346)
T PRK10476         13 LPALAIVALAIVALVFVIWRT   33 (346)
T ss_pred             chhHHHHHHHHHHHHHHhecc
Confidence            467889999999999999954


No 26 
>PF10066 DUF2304:  Uncharacterized conserved protein (DUF2304);  InterPro: IPR019277  This entry represents hypothetical archaeal and bacterial proteins that have no known function. 
Probab=31.25  E-value=62  Score=21.56  Aligned_cols=26  Identities=27%  Similarity=0.438  Sum_probs=18.0

Q ss_pred             CCchhHHHHHHHHHHHHHHHHHhccCC
Q 034767            1 MCPLRFILVFFSAVLAGYFAWRTVRSS   27 (84)
Q Consensus         1 MCPLR~ILiflSA~lAGyfa~r~l~s~   27 (84)
                      |-++++|++++|..+.++ +.+.+|.+
T Consensus         1 M~~~qii~i~~~v~~~~~-ii~~vr~~   26 (115)
T PF10066_consen    1 MTILQIILIIIAVLFLLF-IIRLVRKR   26 (115)
T ss_pred             ChHHHHHHHHHHHHHHHH-HHHHHHHh
Confidence            678999999887766555 44455544


No 27 
>PRK00269 zipA cell division protein ZipA; Reviewed
Probab=30.75  E-value=47  Score=26.83  Aligned_cols=24  Identities=25%  Similarity=0.598  Sum_probs=18.4

Q ss_pred             hhHHHHHHHHHHHH-HH--HHHhccCC
Q 034767            4 LRFILVFFSAVLAG-YF--AWRTVRSS   27 (84)
Q Consensus         4 LR~ILiflSA~lAG-yf--a~r~l~s~   27 (84)
                      ||.|||.+-+++-+ ++  -||..|-+
T Consensus         5 l~~~livig~i~i~~il~~~~~r~r~~   31 (293)
T PRK00269          5 LREWLIVIGIIVIAGILFDGWRRMRGG   31 (293)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            79999999987654 44  89987654


No 28 
>PF09615 Cas_Csy3:  CRISPR-associated protein (Cas_Csy3);  InterPro: IPR013399 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.
Probab=30.16  E-value=8.9  Score=31.26  Aligned_cols=29  Identities=24%  Similarity=0.390  Sum_probs=19.0

Q ss_pred             chhhhhhhhcccee------eEEccchhHHHHHHH
Q 034767           51 ESNFTRSIQNGFWV------FVDMASGRYLWRNLR   79 (84)
Q Consensus        51 ~sk~~~~i~~GFW~------~VDMASGrYLWr~L~   79 (84)
                      ..-+...++.+.+.      ..-.|.||.||||-+
T Consensus       111 ~~~~~~Y~~~~G~~eLA~RYa~NIanGrwLWRNR~  145 (331)
T PF09615_consen  111 QEFVQGYKEKHGFQELAKRYAKNIANGRWLWRNRV  145 (331)
T ss_pred             HHHHHHHHHccCHHHHHHHHHHHhhcCeeEeeccc
Confidence            33444555555554      346799999999963


No 29 
>PF01222 ERG4_ERG24:  Ergosterol biosynthesis ERG4/ERG24 family;  InterPro: IPR001171 The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol []. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family.; GO: 0016020 membrane
Probab=29.01  E-value=35  Score=28.15  Aligned_cols=57  Identities=16%  Similarity=0.229  Sum_probs=31.2

Q ss_pred             HHHHHHHHHHHHHHHHHhccCCCcccCCCCCCCCCCCCCCCCcccchhhhhhhhccceeeE
Q 034767            6 FILVFFSAVLAGYFAWRTVRSSPEADINSLSDDSPNDKTSLKDEDESNFTRSIQNGFWVFV   66 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~s~p~~~~~~~~dd~~~~~~s~~~~~~sk~~~~i~~GFW~~V   66 (84)
                      .++|++ .-++||.+.|+.++|-+..-   .+-.++.....+..+.++.++-+-||+|.++
T Consensus       304 ~~~i~~-l~~~gy~i~r~sn~QK~~FR---~~p~~p~~~~~~~~~t~~G~~LL~SGwWg~~  360 (432)
T PF01222_consen  304 AAAILA-LGLVGYYIFRGSNSQKNRFR---RNPKDPKVIHLKYIPTKRGSKLLVSGWWGIA  360 (432)
T ss_pred             HHHHHH-HHHHHHHHHHHhchhHHHhc---CCCCCCcccccceeecCCCCeEEEcChhHhh
Confidence            344444 34789999999999865320   0000111111222234445567889999754


No 30 
>PF02529 PetG:  Cytochrome B6-F complex subunit 5;  InterPro: IPR003683 This family consists of cytochrome b6/f complex subunit 5 (PetG). The cytochrome bf complex, found in green plants, eukaryotic algae and cyanobacteria, connects photosystem I to photosystem II in the electron transport chain, functioning as a plastoquinol:plastocyanin/cytochrome c6 oxidoreductase []. The purified complex from the unicellular alga Chlamydomonas reinhardtii contains seven subunits; namely four high molecular weight subunits (cytochrome f, Rieske iron-sulphur protein, cytochrome b6, and subunit IV) and three approximately miniproteins (PetG, PetL, and PetX) []. Stoichiometry measurements are consistent with every subunit being present as two copies per b6/f dimer. The absence of PetG affects either the assembly or stability of the cytochrome bf complex in C. reinhardtii [].; GO: 0009512 cytochrome b6f complex; PDB: 1Q90_G 2ZT9_G 1VF5_G 2D2C_G 2E74_G 2E75_G 2E76_G.
Probab=28.44  E-value=73  Score=18.74  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGYFAW   21 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~   21 (84)
                      .+|=.++-|+||-|+-
T Consensus         9 iVlGli~vtl~Glfv~   24 (37)
T PF02529_consen    9 IVLGLIPVTLAGLFVA   24 (37)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHhHHHHHHHHHHH
Confidence            4677889999999875


No 31 
>PF07543 PGA2:  Protein trafficking PGA2;  InterPro: IPR011431 A Saccharomyces cerevisiae (Baker's yeast) member of this family (PGA2, P53903 from SWISSPROT) is a single pass membrane protein which has been implicated in protein trafficking [, ].
Probab=26.97  E-value=38  Score=24.20  Aligned_cols=14  Identities=29%  Similarity=0.928  Sum_probs=10.2

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q 034767            4 LRFILVFFSAVLAGYFAWR   22 (84)
Q Consensus         4 LR~ILiflSA~lAGyfa~r   22 (84)
                      +|+|+     ++.||+++|
T Consensus        18 iRLVi-----IVggYiLlR   31 (140)
T PF07543_consen   18 IRLVI-----IVGGYILLR   31 (140)
T ss_pred             hhhhh-----hhhHHHHHH
Confidence            45555     478999998


No 32 
>COG4389 Site-specific recombinase [DNA replication, recombination, and repair]
Probab=26.39  E-value=44  Score=29.71  Aligned_cols=14  Identities=36%  Similarity=0.940  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHH
Q 034767            7 ILVFFSAVLAGYFA   20 (84)
Q Consensus         7 ILiflSA~lAGyfa   20 (84)
                      +++|+|+++||||=
T Consensus       502 ~wLf~SgiiaG~fD  515 (677)
T COG4389         502 LWLFCSGIIAGFFD  515 (677)
T ss_pred             HHHHHHHHHHHhhc
Confidence            57899999999984


No 33 
>PF13334 DUF4094:  Domain of unknown function (DUF4094)
Probab=25.87  E-value=88  Score=20.91  Aligned_cols=23  Identities=22%  Similarity=0.384  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHhccCCCc
Q 034767            7 ILVFFSAVLAGYFAWRTVRSSPE   29 (84)
Q Consensus         7 ILiflSA~lAGyfa~r~l~s~p~   29 (84)
                      +++.+.+.+||.++-.-++..|+
T Consensus         6 l~Lc~~SF~~G~lft~R~W~~pe   28 (95)
T PF13334_consen    6 LLLCIASFCAGMLFTNRMWTVPE   28 (95)
T ss_pred             HHHHHHHHHHHHHHhcccccCCc
Confidence            45567888999988887887775


No 34 
>PF14851 FAM176:  FAM176 family
Probab=25.75  E-value=70  Score=23.41  Aligned_cols=18  Identities=50%  Similarity=0.742  Sum_probs=15.9

Q ss_pred             chhHHHHHHHHHHHHHHH
Q 034767            3 PLRFILVFFSAVLAGYFA   20 (84)
Q Consensus         3 PLR~ILiflSA~lAGyfa   20 (84)
                      |=||-|.|+|+|-+|.++
T Consensus        19 PE~~aLYFv~gVC~GLlL   36 (153)
T PF14851_consen   19 PERFALYFVSGVCAGLLL   36 (153)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            668999999999999764


No 35 
>PRK04233 hypothetical protein; Provisional
Probab=25.26  E-value=22  Score=25.13  Aligned_cols=16  Identities=38%  Similarity=0.956  Sum_probs=12.1

Q ss_pred             chhhhhhhhccceeeEEc
Q 034767           51 ESNFTRSIQNGFWVFVDM   68 (84)
Q Consensus        51 ~sk~~~~i~~GFW~~VDM   68 (84)
                      .|.|++  ++|-|.+||.
T Consensus       113 ~S~F~r--~~g~W~YvDg  128 (129)
T PRK04233        113 HSRFVR--EDGRWYYLDA  128 (129)
T ss_pred             eeeEEE--ECCEEEEecC
Confidence            555555  5899999996


No 36 
>TIGR02566 cas_Csy3 CRISPR-associated protein, Csy3 family. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) family strictly associated with the Ypest subtype of CRISPR/Cas locus. This family is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.
Probab=25.20  E-value=12  Score=30.71  Aligned_cols=27  Identities=30%  Similarity=0.500  Sum_probs=17.4

Q ss_pred             hhhhhhhcccee------eEEccchhHHHHHHH
Q 034767           53 NFTRSIQNGFWV------FVDMASGRYLWRNLR   79 (84)
Q Consensus        53 k~~~~i~~GFW~------~VDMASGrYLWr~L~   79 (84)
                      -+..-++.+.|.      ..-.|.||.||||=+
T Consensus       117 ~v~~Y~~~~G~~ELA~RYa~NianGrwLWRNr~  149 (341)
T TIGR02566       117 TVKLYIEEQGFEELARRYAENIANGRWLWRNRV  149 (341)
T ss_pred             HHHHHHHccCHHHHHHHHHHHhhcCeeEeeccc
Confidence            344445555543      446789999999843


No 37 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=24.46  E-value=75  Score=17.55  Aligned_cols=13  Identities=8%  Similarity=0.562  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGY   18 (84)
Q Consensus         6 ~ILiflSA~lAGy   18 (84)
                      ++++++|++++-|
T Consensus        19 l~~~~~tG~~~~f   31 (37)
T PF13706_consen   19 LFVIFLTGAVMVF   31 (37)
T ss_pred             HHHHHHHhHHHHH
Confidence            4667777777655


No 38 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=24.35  E-value=98  Score=17.75  Aligned_cols=19  Identities=21%  Similarity=0.371  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHhc
Q 034767            6 FILVFFSAVLAGYFAWRTV   24 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l   24 (84)
                      +.+|++-++..|+.+|--.
T Consensus        13 ~~~v~~~~~F~gi~~w~~~   31 (49)
T PF05545_consen   13 IGTVLFFVFFIGIVIWAYR   31 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHc
Confidence            4577888888898888543


No 39 
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=24.09  E-value=53  Score=24.99  Aligned_cols=17  Identities=47%  Similarity=0.884  Sum_probs=15.7

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 034767            4 LRFILVFFSAVLAGYFA   20 (84)
Q Consensus         4 LR~ILiflSA~lAGyfa   20 (84)
                      +|++|+.+.-.+|||.+
T Consensus         8 lr~~l~llal~~a~yiv   24 (176)
T PF06364_consen    8 LRVVLVLLALCLAGYIV   24 (176)
T ss_pred             HHHHHHHHHHHHHhhee
Confidence            79999999999999976


No 40 
>PF12046 DUF3529:  Protein of unknown function (DUF3529);  InterPro: IPR021919  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 176 to 190 amino acids in length. 
Probab=23.97  E-value=59  Score=24.42  Aligned_cols=19  Identities=42%  Similarity=0.852  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHhcc
Q 034767            6 FILVFFSAVLAGYFAWRTVR   25 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~   25 (84)
                      +.|+.|| -+||.|-||.-.
T Consensus       113 ~~L~lLs-PlAG~~Yw~kA~  131 (173)
T PF12046_consen  113 LLLVLLS-PLAGIFYWQKAG  131 (173)
T ss_pred             HHHHHHh-hhhhhhhhhcCC
Confidence            5677777 899999998653


No 41 
>PF12588 PSDC:  Phophatidylserine decarboxylase ;  InterPro: IPR022237  This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF02666 from PFAM. Phosphatidylserine decarboxylase (PSD) is an important enzyme in the synthesis of phosphatidylethanolamine in both prokaryotes and eukaryotes. 
Probab=23.37  E-value=46  Score=23.88  Aligned_cols=21  Identities=24%  Similarity=0.344  Sum_probs=19.2

Q ss_pred             CchhHHHHHHHHHHHHHHHHH
Q 034767            2 CPLRFILVFFSAVLAGYFAWR   22 (84)
Q Consensus         2 CPLR~ILiflSA~lAGyfa~r   22 (84)
                      ||+=.||.-..+|-|||.+.+
T Consensus        74 ~P~naiLdwpM~T~sG~a~F~   94 (141)
T PF12588_consen   74 FPMNAILDWPMGTPSGYAFFL   94 (141)
T ss_pred             cChHHHHHhhccChHHHHHHc
Confidence            899999999999999998754


No 42 
>PF14004 DUF4227:  Protein of unknown function (DUF4227)
Probab=23.11  E-value=95  Score=20.11  Aligned_cols=24  Identities=29%  Similarity=0.477  Sum_probs=20.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHhccCC
Q 034767            4 LRFILVFFSAVLAGYFAWRTVRSS   27 (84)
Q Consensus         4 LR~ILiflSA~lAGyfa~r~l~s~   27 (84)
                      +||+++|..-|+.=|.++.-++..
T Consensus         7 ik~~~LF~~~T~lfYy~~~w~~~~   30 (71)
T PF14004_consen    7 IKFFLLFTGCTLLFYYAILWVSDE   30 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            689999999999999998777654


No 43 
>PRK01844 hypothetical protein; Provisional
Probab=22.92  E-value=1e+02  Score=20.28  Aligned_cols=17  Identities=24%  Similarity=0.565  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 034767            7 ILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         7 ILiflSA~lAGyfa~r~   23 (84)
                      |+-++-+++.|||.-|.
T Consensus        11 I~~li~G~~~Gff~ark   27 (72)
T PRK01844         11 VVALVAGVALGFFIARK   27 (72)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44466677788887654


No 44 
>PRK00523 hypothetical protein; Provisional
Probab=22.91  E-value=1e+02  Score=20.27  Aligned_cols=17  Identities=24%  Similarity=0.505  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 034767            7 ILVFFSAVLAGYFAWRT   23 (84)
Q Consensus         7 ILiflSA~lAGyfa~r~   23 (84)
                      |+.++-+.+.|||.-|.
T Consensus        12 i~~li~G~~~Gffiark   28 (72)
T PRK00523         12 IPLLIVGGIIGYFVSKK   28 (72)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44566777888887654


No 45 
>PF13808 DDE_Tnp_1_assoc:  DDE_Tnp_1-associated
Probab=21.90  E-value=69  Score=20.48  Aligned_cols=17  Identities=41%  Similarity=0.802  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGYFAWR   22 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r   22 (84)
                      +++|.+.|+|+|.==|+
T Consensus        24 iL~i~~~a~l~G~~~~~   40 (90)
T PF13808_consen   24 ILLIALCAVLCGADSWR   40 (90)
T ss_pred             HHHHHHHHHHHccccHH
Confidence            45678899999865443


No 46 
>PF06092 DUF943:  Enterobacterial putative membrane protein (DUF943);  InterPro: IPR010351 This family consists of several hypothetical proteins from Escherichia coli, Yersinia pestis and Salmonella typhi.
Probab=21.79  E-value=86  Score=23.08  Aligned_cols=16  Identities=44%  Similarity=0.922  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHhccCCC
Q 034767           10 FFSAVLAGYFAWRTVRSSP   28 (84)
Q Consensus        10 flSA~lAGyfa~r~l~s~p   28 (84)
                      |+-|.++ |++|..  .+|
T Consensus        13 ~l~~~~~-y~~W~~--~rp   28 (157)
T PF06092_consen   13 FLLACIL-YFLWLT--LRP   28 (157)
T ss_pred             HHHHHHH-Hhhhhc--cCC
Confidence            4434444 999944  445


No 47 
>PF09527 ATPase_gene1:  Putative F0F1-ATPase subunit (ATPase_gene1)
Probab=21.71  E-value=1.3e+02  Score=17.31  Aligned_cols=20  Identities=20%  Similarity=0.328  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHhcc
Q 034767            6 FILVFFSAVLAGYFAWRTVR   25 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~r~l~   25 (84)
                      ++.+++..+.+.|-+||.+|
T Consensus        36 ~~g~llG~~~g~~~~~~~~k   55 (55)
T PF09527_consen   36 LIGLLLGIAAGFYNVYRLVK   55 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            35566677777777776553


No 48 
>CHL00008 petG cytochrome b6/f complex subunit V
Probab=21.69  E-value=1e+02  Score=18.18  Aligned_cols=16  Identities=31%  Similarity=0.501  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGYFAW   21 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~   21 (84)
                      ++|=++.-||||.|+-
T Consensus         9 iVLGlipvTl~Glfva   24 (37)
T CHL00008          9 IVLGLIPITLAGLFVT   24 (37)
T ss_pred             HHHHhHHHHHHHHHHH
Confidence            4566778899999875


No 49 
>PF10229 DUF2246:  Uncharacterized conserved protein (DUF2246);  InterPro: IPR019362  This entry represents conserved proteins found in the metazoa but absent from fungi. They are all approximately 300 residues in length and have no known function. 
Probab=21.24  E-value=40  Score=26.65  Aligned_cols=19  Identities=37%  Similarity=0.835  Sum_probs=16.5

Q ss_pred             hhcccee-eEEccchhHHHH
Q 034767           58 IQNGFWV-FVDMASGRYLWR   76 (84)
Q Consensus        58 i~~GFW~-~VDMASGrYLWr   76 (84)
                      .+.|+|. |||-.||+.+..
T Consensus       199 ~~~GYWADFIDP~SG~p~~~  218 (278)
T PF10229_consen  199 RSQGYWADFIDPFSGRPYFG  218 (278)
T ss_pred             HhCCEeeeeecCCCCccccC
Confidence            5789997 999999998865


No 50 
>PF05620 DUF788:  Protein of unknown function (DUF788);  InterPro: IPR008506 This family consists of several eukaryotic proteins of unknown function.
Probab=21.15  E-value=2.1e+02  Score=20.36  Aligned_cols=15  Identities=20%  Similarity=0.317  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHhcc
Q 034767           11 FSAVLAGYFAWRTVR   25 (84)
Q Consensus        11 lSA~lAGyfa~r~l~   25 (84)
                      +=..-|+|-+|..++
T Consensus       122 vIP~ya~Ykl~~~i~  136 (170)
T PF05620_consen  122 VIPGYAIYKLWGLIK  136 (170)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345668899999884


No 51 
>TIGR01375 soxG sarcosine oxidase, gamma subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms.
Probab=20.58  E-value=90  Score=21.29  Aligned_cols=25  Identities=20%  Similarity=0.308  Sum_probs=21.9

Q ss_pred             hhccceeeEEccchhHHHHHHHhhh
Q 034767           58 IQNGFWVFVDMASGRYLWRNLREIK   82 (84)
Q Consensus        58 i~~GFW~~VDMASGrYLWr~L~~~~   82 (84)
                      =++||=.+|.-..+.|||+.|...-
T Consensus       126 GE~GfEi~v~~s~a~~lw~~L~~ag  150 (152)
T TIGR01375       126 GEDTFEIIVRRSFAESLWHWLVDAS  150 (152)
T ss_pred             CCCeEEEEEEhhHHHHHHHHHHHHh
Confidence            3789999999999999999998643


No 52 
>PF11808 DUF3329:  Domain of unknown function (DUF3329);  InterPro: IPR021766  This family of proteins are functionally uncharacterised. This family is only found in bacteria. ; GO: 0004673 protein histidine kinase activity
Probab=20.50  E-value=1.1e+02  Score=19.65  Aligned_cols=8  Identities=38%  Similarity=0.700  Sum_probs=3.4

Q ss_pred             HHHHHHHH
Q 034767           14 VLAGYFAW   21 (84)
Q Consensus        14 ~lAGyfa~   21 (84)
                      .+.+|.+|
T Consensus        36 ~l~~~l~w   43 (90)
T PF11808_consen   36 GLLLYLFW   43 (90)
T ss_pred             HHHHHHHH
Confidence            33444444


No 53 
>PF11683 DUF3278:  Protein of unknown function (DUF3278);  InterPro: IPR021697  This bacterial family of proteins has no known function. 
Probab=20.46  E-value=45  Score=22.77  Aligned_cols=21  Identities=19%  Similarity=0.475  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHHhccCC
Q 034767            7 ILVFFSAVLAGYFAWRTVRSS   27 (84)
Q Consensus         7 ILiflSA~lAGyfa~r~l~s~   27 (84)
                      +++++.-.++||..+.+-+..
T Consensus        70 ~~~~~~~~~~~yi~~~~~~~~   90 (129)
T PF11683_consen   70 NIFFIIFIVSGYITFATRKLH   90 (129)
T ss_pred             HHHHHHHHHHHHHHHHHHHhC
Confidence            345556677888888776554


No 54 
>PRK00665 petG cytochrome b6-f complex subunit PetG; Reviewed
Probab=20.12  E-value=1.1e+02  Score=17.94  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034767            6 FILVFFSAVLAGYFAW   21 (84)
Q Consensus         6 ~ILiflSA~lAGyfa~   21 (84)
                      ++|=++.-||||.|+-
T Consensus         9 iVLGlipiTl~Glfva   24 (37)
T PRK00665          9 IVLGLIPVTLAGLFVA   24 (37)
T ss_pred             HHHHhHHHHHHHHHHH
Confidence            4566677899999875


No 55 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=20.10  E-value=1.8e+02  Score=20.97  Aligned_cols=22  Identities=18%  Similarity=0.246  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHhccC--CCc
Q 034767            8 LVFFSAVLAGYFAWRTVRS--SPE   29 (84)
Q Consensus         8 LiflSA~lAGyfa~r~l~s--~p~   29 (84)
                      ...++..+++||....=|-  +||
T Consensus        44 s~~l~~mig~yl~~~~rr~~~rPE   67 (137)
T PF12270_consen   44 SGGLALMIGFYLRFTARRIGPRPE   67 (137)
T ss_pred             HHHHHHHHHHHHHHHHhhCCCCCc
Confidence            3456777788876644443  354


Done!