BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034773
(84 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P53313|SDA1_YEAST Protein SDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 /
S288c) GN=SDA1 PE=1 SV=1
Length = 767
Score = 29.3 bits (64), Expect = 7.3, Method: Compositional matrix adjust.
Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
Query: 21 FEDRSKSYSFNGPTGKADVLASSGNPESKRRKR-VAAYNMYTMEGKLKSSLRNSFKWIKN 79
E R F GK D + S+ N E +RRK V + + ++ GK K SLR+ K ++
Sbjct: 698 LEGREGRDKFGSRRGKRDNMRSTTNREKERRKNFVMSIHKRSVRGKQKMSLRDKQKVLRA 757
Query: 80 KFT 82
T
Sbjct: 758 HIT 760
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.311 0.126 0.363
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,156,666
Number of Sequences: 539616
Number of extensions: 1099682
Number of successful extensions: 1919
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1917
Number of HSP's gapped (non-prelim): 4
length of query: 84
length of database: 191,569,459
effective HSP length: 55
effective length of query: 29
effective length of database: 161,890,579
effective search space: 4694826791
effective search space used: 4694826791
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 55 (25.8 bits)