Query         034777
Match_columns 84
No_of_seqs    105 out of 431
Neff          5.5 
Searched_HMMs 13730
Date          Mon Mar 25 10:09:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034777.a3m -d /work/01045/syshi/HHdatabase/scop70.hhm -o /work/01045/syshi/hhsearch_scop/034777hhsearch_scop -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1iwga8 f.35.1.1 (A:513-566,A:  15.3 1.3E+02  0.0094   18.6   5.1   29   41-69     96-124 (222)
  2 d1ppjw_ f.23.14.1 (W:) Subunit  13.8      25  0.0018   19.0   0.6   18   37-54     18-35  (62)
  3 d2p7tc1 f.14.1.1 (C:86-119) Po   8.5 1.2E+02  0.0086   14.0   2.0   17   36-52     17-33  (34)
  4 d1rh5b_ f.23.28.1 (B:) Preprot   7.1 1.8E+02   0.013   15.0   2.6   23   28-50     23-45  (56)
  5 d1deeg_ a.8.1.1 (G:) Immunoglo   5.4      58  0.0042   16.8  -0.2   19   16-34     21-39  (51)
  6 d1fc2c_ a.8.1.1 (C:) Immunoglo   5.3      68  0.0049   16.0   0.1   17   16-32     24-40  (44)
  7 d2axtj1 f.23.32.1 (J:7-40) Pho   4.6 2.2E+02   0.016   13.2   2.3   16   37-52     11-26  (34)
  8 d1r3jc_ f.14.1.1 (C:) Potassiu   4.5 2.8E+02    0.02   14.7   2.6   24   50-73     57-83  (103)
  9 d1bu2a2 a.74.1.1 (A:149-250) V   4.4      76  0.0056   18.1  -0.2   26   11-43     65-90  (102)
 10 d2axtl1 f.23.31.1 (L:1-37) Pho   4.2 2.5E+02   0.018   13.2   2.0   12   39-50     25-36  (37)

No 1  
>d1iwga8 f.35.1.1 (A:513-566,A:869-1036) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]}
Probab=15.29  E-value=1.3e+02  Score=18.59  Aligned_cols=29  Identities=10%  Similarity=-0.099  Sum_probs=22.6

Q ss_pred             HHHHHHHHHhcccccHHHHHHHHHHHHHH
Q 034777           41 SSGLAGFFLFEEQLSFQWFAGALFIVVGV   69 (84)
Q Consensus        41 ~t~l~g~~~f~E~l~~~~~~G~~lIi~Gv   69 (84)
                      ..++.+.++++.+++..-..|..+.+...
T Consensus        96 ~~~~~~l~~~g~~~~~~~~~g~i~l~Gi~  124 (222)
T d1iwga8          96 IGALLAATFRGLTNDVYFQVGLLTTIGLS  124 (222)
T ss_dssp             HHHHHHHHHTTCCBCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCchhhhhcccccchhhhh
Confidence            45677788899999999998888765543


No 2  
>d1ppjw_ f.23.14.1 (W:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
Probab=13.83  E-value=25  Score=18.98  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHhcccc
Q 034777           37 TNFLSSGLAGFFLFEEQL   54 (84)
Q Consensus        37 ~n~v~t~l~g~~~f~E~l   54 (84)
                      .-|+.+.+.|.++|....
T Consensus        18 Stf~~tI~~gAf~fE~~f   35 (62)
T d1ppjw_          18 STFALTIVVGALFFERAF   35 (62)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            347888888888776543


No 3  
>d2p7tc1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
Probab=8.50  E-value=1.2e+02  Score=14.03  Aligned_cols=17  Identities=24%  Similarity=0.446  Sum_probs=10.4

Q ss_pred             hHHHHHHHHHHHHHhcc
Q 034777           36 ATNFLSSGLAGFFLFEE   52 (84)
Q Consensus        36 s~n~v~t~l~g~~~f~E   52 (84)
                      |.+.+..++..|++=+|
T Consensus        17 s~glv~aa~atwfvgre   33 (34)
T d2p7tc1          17 SFGLVTAALATWFVGRE   33 (34)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHhhccc
Confidence            33457777777766444


No 4  
>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=7.10  E-value=1.8e+02  Score=14.97  Aligned_cols=23  Identities=17%  Similarity=0.245  Sum_probs=16.0

Q ss_pred             eeeeehhhhHHHHHHHHHHHHHh
Q 034777           28 LQATVTNFATNFLSSGLAGFFLF   50 (84)
Q Consensus        28 ~~ati~~~s~n~v~t~l~g~~~f   50 (84)
                      ..-+...++.|+.+..+.|++++
T Consensus        23 f~~ia~v~~iG~~i~G~IGf~I~   45 (56)
T d1rh5b_          23 YLAVAKVTALGISLLGIIGYIIH   45 (56)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444556777888888888764


No 5  
>d1deeg_ a.8.1.1 (G:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
Probab=5.38  E-value=58  Score=16.78  Aligned_cols=19  Identities=26%  Similarity=0.265  Sum_probs=13.2

Q ss_pred             HHHHHHhcccCceeeeehh
Q 034777           16 GCYINSLRVLSSLQATVTN   34 (84)
Q Consensus        16 ~~y~kaL~~~~s~~ati~~   34 (84)
                      .-|.++||..||..+-+.+
T Consensus        21 n~fI~sLkddPs~sanvl~   39 (51)
T d1deeg_          21 NGFIQSLKDDPSQSTNVLG   39 (51)
T ss_dssp             HHHHHHHHHCGGGHHHHHH
T ss_pred             HHHHHHHhhChHHHHHHHH
Confidence            3588899998876555443


No 6  
>d1fc2c_ a.8.1.1 (C:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
Probab=5.30  E-value=68  Score=16.02  Aligned_cols=17  Identities=29%  Similarity=0.317  Sum_probs=11.8

Q ss_pred             HHHHHHhcccCceeeee
Q 034777           16 GCYINSLRVLSSLQATV   32 (84)
Q Consensus        16 ~~y~kaL~~~~s~~ati   32 (84)
                      .-|..+||..||.-+-+
T Consensus        24 n~fI~SLkDDPsqSan~   40 (44)
T d1fc2c_          24 NGFIQSLKDDPSQSANL   40 (44)
T ss_dssp             HHHHHHHHHCTTTTTCC
T ss_pred             HHHHHHhccCchhhHHH
Confidence            35788899887755443


No 7  
>d2axtj1 f.23.32.1 (J:7-40) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=4.61  E-value=2.2e+02  Score=13.19  Aligned_cols=16  Identities=13%  Similarity=0.353  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHhcc
Q 034777           37 TNFLSSGLAGFFLFEE   52 (84)
Q Consensus        37 ~n~v~t~l~g~~~f~E   52 (84)
                      .+...-.+.|.|+++.
T Consensus        11 ~G~~vi~~vG~FfYGs   26 (34)
T d2axtj1          11 AGMGVIVIVGLFFYGA   26 (34)
T ss_dssp             HHHHHHHHHHHHHHHT
T ss_pred             hhhhhHhheeeeeeee
Confidence            3455666777777764


No 8  
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
Probab=4.54  E-value=2.8e+02  Score=14.68  Aligned_cols=24  Identities=8%  Similarity=0.295  Sum_probs=16.9

Q ss_pred             hcccc---cHHHHHHHHHHHHHHHHHc
Q 034777           50 FEEQL---SFQWFAGALFIVVGVLILS   73 (84)
Q Consensus        50 f~E~l---~~~~~~G~~lIi~Gv~ll~   73 (84)
                      |||-.   ++-+++.+..++.|+.+.+
T Consensus        57 YGDi~P~t~~gr~~~~~~~~~Gi~~~~   83 (103)
T d1r3jc_          57 YGDLYPVTLWGRCVAVVVMVAGITSFG   83 (103)
T ss_dssp             CSSSCCCSHHHHHHHHHHHHHHHHHHH
T ss_pred             cCccccCChhHHHHHHHHHHHHHHHHH
Confidence            57732   3457888888898887654


No 9  
>d1bu2a2 a.74.1.1 (A:149-250) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
Probab=4.41  E-value=76  Score=18.12  Aligned_cols=26  Identities=35%  Similarity=0.773  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHhcccCceeeeehhhhHHHHHHH
Q 034777           11 NVAMWGCYINSLRVLSSLQATVTNFATNFLSSG   43 (84)
Q Consensus        11 n~~mw~~y~kaL~~~~s~~ati~~~s~n~v~t~   43 (84)
                      |.-.|.+|.+-|.       .|.|+|.|.+=++
T Consensus        65 n~~~wt~yledl~-------~ilnfstntirt~   90 (102)
T d1bu2a2          65 NCRPWTCYLEDLS-------SILNFSTNTVRTV   90 (102)
T ss_dssp             SCSTHHHHGGGTT-------TCSSHHHHHHHHH
T ss_pred             CccchHHHHHhhH-------HHhccccchhhHH
Confidence            4456888875442       4678888877554


No 10 
>d2axtl1 f.23.31.1 (L:1-37) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=4.18  E-value=2.5e+02  Score=13.18  Aligned_cols=12  Identities=17%  Similarity=0.329  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHh
Q 034777           39 FLSSGLAGFFLF   50 (84)
Q Consensus        39 ~v~t~l~g~~~f   50 (84)
                      |++..+++-.+|
T Consensus        25 fvl~vLFssYfF   36 (37)
T d2axtl1          25 LVLALLFSSYFF   36 (37)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhc
Confidence            445555555554


Done!