Citrus Sinensis ID: 034779


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MSAGGAFGGNRGARPVPPEKGVFPLDHMHQCDLEKKDYIGCLKSSGHQSENCRIFSKKYLECRMAKNAQSMHSLVHWERDNKET
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHcccccccc
*******************KGVFPLDHMHQCDLEKKDYIGCLKSSGHQSENCRIFSKKYLECRMAKNAQSMHSLV**ER*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAGGAFGGNRGARPVPPEKGVFPLDHMHQCDLEKKDYIGCLKSSGHQSENCRIFSKKYLECRMAKNAQSMHSLVHWERDNKET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase assembly protein COX19 May be required for the assembly of mitochondrial cytochrome c oxidase.probableA8E4L1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LQL, chain A
Confidence level:probable
Coverage over the Query: 29-66
View the alignment between query and template
View the model in PyMOL