Query         034808
Match_columns 82
No_of_seqs    100 out of 173
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:38:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034808.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034808hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01249 Ribosomal_S21e:  Ribos 100.0 2.3E-56   5E-61  293.4   3.6   80    1-80      1-80  (81)
  2 KOG3486 40S ribosomal protein  100.0 5.5E-50 1.2E-54  264.3   4.0   81    1-81      1-82  (83)
  3 PF06079 Apyrase:  Apyrase;  In  74.5     1.3 2.8E-05   35.2   0.6   32   11-42    185-231 (291)
  4 PTZ00486 apyrase Superfamily;   49.2       8 0.00017   31.6   0.9   31   11-41    248-292 (352)
  5 KOG4207 Predicted splicing fac  44.2     9.4  0.0002   30.0   0.5   39    5-71     37-75  (256)
  6 cd05759 Ig2_KIRREL3-like Secon  42.5      12 0.00026   22.2   0.7   21   16-36     62-82  (82)
  7 PF13990 YjcZ:  YjcZ-like prote  35.9      11 0.00023   29.9  -0.3   14    7-20    246-259 (270)
  8 PF00970 FAD_binding_6:  Oxidor  35.8      53  0.0011   20.0   2.9   39    4-46     31-76  (99)
  9 PF10114 PocR:  Sensory domain   34.7      44 0.00096   22.5   2.6   33   45-77     93-127 (173)
 10 cd05732 Ig5_NCAM-1_like Fifth   29.5      24 0.00052   21.1   0.6   19   16-36     78-96  (96)
 11 cd04977 Ig1_NCAM-1_like First   29.4      26 0.00057   21.5   0.8   20   16-36     73-92  (92)
 12 cd04969 Ig5_Contactin_like Fif  26.4      28  0.0006   20.1   0.4   19   16-36     55-73  (73)
 13 cd05870 Ig5_NCAM-2 Fifth immun  26.2      32 0.00069   21.1   0.7   19   16-36     80-98  (98)
 14 smart00634 BID_1 Bacterial Ig-  24.7 1.6E+02  0.0035   18.2   3.8   36   22-57     10-46  (92)
 15 cd04978 Ig4_L1-NrCAM_like Four  24.5      31 0.00067   19.6   0.4   19   16-36     57-75  (76)
 16 PF07976 Phe_hydrox_dim:  Pheno  24.2      50  0.0011   23.3   1.5   29   44-73     57-85  (169)
 17 TIGR00223 panD L-aspartate-alp  23.4      93   0.002   22.2   2.7   21   33-57     43-63  (126)
 18 PRK14890 putative Zn-ribbon RN  23.2      55  0.0012   20.5   1.4   18   13-30      6-23  (59)
 19 cd05773 Ig8_hNephrin_like Eigh  22.4      42  0.0009   21.5   0.7   20   16-37     86-105 (109)
 20 PRK05449 aspartate alpha-decar  22.2   1E+02  0.0022   21.9   2.7   21   33-57     43-63  (126)
 21 COG2888 Predicted Zn-ribbon RN  21.5      56  0.0012   20.8   1.2   24    9-32      4-27  (61)
 22 PRK00042 tpiA triosephosphate   21.2 1.5E+02  0.0032   22.5   3.6   49   30-78     56-121 (250)
 23 KOG0280 Uncharacterized conser  21.2      61  0.0013   26.6   1.6   57    4-64    186-246 (339)
 24 cd05854 Ig6_Contactin-2 Sixth   20.4      47   0.001   20.2   0.7   19   16-36     63-81  (85)
 25 cd06919 Asp_decarbox Aspartate  20.1 1.2E+02  0.0026   21.1   2.7   21   33-57     42-62  (111)
 26 cd04970 Ig6_Contactin_like Six  20.0      49  0.0011   19.6   0.7   20   16-37     63-82  (85)

No 1  
>PF01249 Ribosomal_S21e:  Ribosomal protein S21e ;  InterPro: IPR001931 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. These proteins have 82 to 87 amino acids. The amino termini are all N alpha-acetylated. The N-terminal halves of the protein molecules are highly conserved in contrast to the carboxy-terminal parts [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_V 3U5C_V 3IZB_T 2XZN_Z 2XZM_Z 3IZ6_T.
Probab=100.00  E-value=2.3e-56  Score=293.42  Aligned_cols=80  Identities=56%  Similarity=1.011  Sum_probs=75.2

Q ss_pred             CccccCceeeeeeeccccCcCCcccCCCCcceEeEeeEeCCCceeeCceeEEEEehhhhhcccchHHHHHHHHhcccccc
Q 034808            1 MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQGDGDSAIDRLWQKKKVEVR   80 (82)
Q Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~akDHaSVQInva~vd~~G~~tg~~~t~ai~G~iR~~GesD~~l~rL~~~~~~~~~   80 (82)
                      ||||+|+|||||||||||||||||+|||||||||||++||++|+|||+++||||||+||+|||||+||+|||+++|++++
T Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~aKDHaSvQinv~~vd~~G~~~g~~~t~ai~G~iR~~GesD~~l~rL~~~~g~l~~   80 (81)
T PF01249_consen    1 MQNDAGEFVDLYIPRKCSATNRIISAKDHASVQINVADVDENGRFTGQFKTYAICGFIRRMGESDDALNRLAKKDGLLSK   80 (81)
T ss_dssp             -CHCCCHC-SSSHHHCHTTTHHCHHTTSTTSEEEEEEEE-SSS-EEEEEEEEEEHHHHHHTTHHHHHHHHHHHHTCCCSS
T ss_pred             CcCcCCcEEEEeccccccccCCccccCCceeEEEEeeeecCcccCcCCceEEEEechHhhCcchhHHHHHHHHHhCcccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999975


No 2  
>KOG3486 consensus 40S ribosomal protein S21 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=5.5e-50  Score=264.29  Aligned_cols=81  Identities=69%  Similarity=1.162  Sum_probs=78.3

Q ss_pred             CccccCceeeeeeeccccCcCCcccCCCCcceEeEeeEeCCC-ceeeCceeEEEEehhhhhcccchHHHHHHHHhccccc
Q 034808            1 MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDAD-GIYTGQFSTFALCGFVRAQGDGDSAIDRLWQKKKVEV   79 (82)
Q Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~akDHaSVQInva~vd~~-G~~tg~~~t~ai~G~iR~~GesD~~l~rL~~~~~~~~   79 (82)
                      ||||+|+|||||||||||+|||||.||||+|||||+++||+. |.|+|+++||||||+||+|||||++++||++++|++.
T Consensus         1 MqNdaGe~v~LYvPrKcS~sNriI~aKDHaSVQ~N~~~vd~~g~~~~g~~ttyAlcg~vr~~gesd~~~~rl~~~~~~~~   80 (83)
T KOG3486|consen    1 MQNDAGQFVELYVPRKCSATNRIITAKDHASVQLNIGHVDAEGGLYTGQFTTYALCGFVRRMGESDSGVDRLAQKDGVEA   80 (83)
T ss_pred             CCCCCcceeEEEecccccccceeeecccchheeecccccccccCccCCceehHHHHHHHHHcCCCcchHHHHHHhccccc
Confidence            999999999999999999999999999999999999999998 5699999999999999999999999999999999987


Q ss_pred             cc
Q 034808           80 RQ   81 (82)
Q Consensus        80 ~~   81 (82)
                      .+
T Consensus        81 ~~   82 (83)
T KOG3486|consen   81 KQ   82 (83)
T ss_pred             cc
Confidence            64


No 3  
>PF06079 Apyrase:  Apyrase;  InterPro: IPR009283 This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (3.6.1.5 from EC), and related nucleoside diphosphatases (3.6.1.6 from EC). The salivary apyrases of blood-feeding arthropods are nucleotide hydrolysing enzymes implicated in the inhibition of host platelet aggregation through the hydrolysis of extracellular adenosine diphosphate [].; GO: 0005509 calcium ion binding, 0016462 pyrophosphatase activity; PDB: 2H2N_A 1S18_A 2H2U_A 1S1D_B.
Probab=74.47  E-value=1.3  Score=35.20  Aligned_cols=32  Identities=34%  Similarity=0.842  Sum_probs=17.0

Q ss_pred             eeeecccc------------CcCCcccC-CCCcceEeE-ee-EeCCC
Q 034808           11 LYIPRKCS------------ATNRLITS-KDHAAVQIN-IG-HVDAD   42 (82)
Q Consensus        11 lYiPRKCS------------~TnriI~a-kDHaSVQIn-va-~vd~~   42 (82)
                      ..+||+||            .+|-||.| .|..+|+.. |+ .++|+
T Consensus       185 fFLPRr~S~e~Y~e~~DE~~G~N~li~a~edF~~i~v~~ig~~~~p~  231 (291)
T PF06079_consen  185 FFLPRRCSKEPYDETADERRGCNLLISADEDFSDIKVIRIGEQLDPT  231 (291)
T ss_dssp             EE--SEEESS---HHHHTT-B--EEEEE-TTSSSEEEEE-S----TT
T ss_pred             EEeccccccccccchhhhhcCccEEEEeccCcceeEEEEeCCccCcc
Confidence            36799999            58999888 566776643 56 67774


No 4  
>PTZ00486 apyrase Superfamily; Provisional
Probab=49.23  E-value=8  Score=31.60  Aligned_cols=31  Identities=19%  Similarity=0.442  Sum_probs=19.8

Q ss_pred             eeeeccccC------------cCCcccCCCC-cceEe-EeeEeCC
Q 034808           11 LYIPRKCSA------------TNRLITSKDH-AAVQI-NIGHVDA   41 (82)
Q Consensus        11 lYiPRKCS~------------TnriI~akDH-aSVQI-nva~vd~   41 (82)
                      ..+||+||-            +|.||.+.+| .+++. .++..+|
T Consensus       248 ~FlPRr~S~e~Yde~~DE~~G~N~ii~~de~F~~i~vi~i~~~~p  292 (352)
T PTZ00486        248 YFLPRRVSNEPYDEEKDEYRGSNYIIICDEDFQNPRVIKDPQYDP  292 (352)
T ss_pred             EEeccccCcccccchhhhhcCCcEEEEecccccceEEEecCCCCC
Confidence            367999995            6888886644 44442 2445555


No 5  
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]
Probab=44.22  E-value=9.4  Score=30.00  Aligned_cols=39  Identities=38%  Similarity=0.641  Sum_probs=25.9

Q ss_pred             cCceeeeeeeccccCcCCcccCCCCcceEeEeeEeCCCceeeCceeEEEEehhhhhcccchHHHHHH
Q 034808            5 EGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQGDGDSAIDRL   71 (82)
Q Consensus         5 ~g~~VDlYiPRKCS~TnriI~akDHaSVQInva~vd~~G~~tg~~~t~ai~G~iR~~GesD~~l~rL   71 (82)
                      -|+++|+||||.                           +||++..-|||--| --+-++++|+.+|
T Consensus        37 YG~vgDVyIPrd---------------------------r~Tr~sRgFaFVrf-~~k~daedA~dam   75 (256)
T KOG4207|consen   37 YGRVGDVYIPRD---------------------------RYTRQSRGFAFVRF-HDKRDAEDALDAM   75 (256)
T ss_pred             hCcccceecccc---------------------------cccccccceeEEEe-eecchHHHHHHhh
Confidence            388999999984                           56777777775522 2344566666665


No 6  
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=42.50  E-value=12  Score=22.20  Aligned_cols=21  Identities=19%  Similarity=0.540  Sum_probs=17.1

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      .|.++|.-+..-=++|++++|
T Consensus        62 ~C~a~n~~l~~~~~~s~~l~v   82 (82)
T cd05759          62 TCRARNEALPTGKETSVTLDV   82 (82)
T ss_pred             EEEEcCccCCCCcEEEEEEcC
Confidence            488888888777788888876


No 7  
>PF13990 YjcZ:  YjcZ-like protein
Probab=35.93  E-value=11  Score=29.86  Aligned_cols=14  Identities=57%  Similarity=0.869  Sum_probs=12.2

Q ss_pred             ceeeeeeeccccCc
Q 034808            7 QNMDLYIPRKCSAT   20 (82)
Q Consensus         7 ~~VDlYiPRKCS~T   20 (82)
                      +.|-|++||-||+.
T Consensus       246 ~~v~l~mPrlcsA~  259 (270)
T PF13990_consen  246 QNVALGMPRLCSAE  259 (270)
T ss_pred             cccccCcchhccHH
Confidence            56889999999985


No 8  
>PF00970 FAD_binding_6:  Oxidoreductase FAD-binding domain;  InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain.  To date, the 3D-structures of the flavoprotein domain of Zea mays (Maize) nitrate reductase [] and of pig NADH:cytochrome b5 reductase [] have been solved. The overall fold is similar to that of ferredoxin:NADP+ reductase []: the FAD-binding domain (N-terminal) has the topology of an anti-parallel beta-barrel, while the NAD(P)-binding domain (C-terminal) has the topology of a classical pyridine dinucleotide-binding fold (i.e. a central parallel beta-sheet flanked by 2 helices on each side).; PDB: 1JB9_A 3LVB_A 3LO8_A 1FRN_A 1FND_A 1BX1_A 1FNC_A 1FNB_A 1BX0_A 1FRQ_A ....
Probab=35.80  E-value=53  Score=19.97  Aligned_cols=39  Identities=21%  Similarity=0.365  Sum_probs=22.9

Q ss_pred             ccCceeeeeee-------ccccCcCCcccCCCCcceEeEeeEeCCCceee
Q 034808            4 EEGQNMDLYIP-------RKCSATNRLITSKDHAAVQINIGHVDADGIYT   46 (82)
Q Consensus         4 d~g~~VDlYiP-------RKCS~TnriI~akDHaSVQInva~vd~~G~~t   46 (82)
                      ..|++|.+.+|       |--|.++..   .+...++|-|... ++|.++
T Consensus        31 ~pGQ~v~v~~~~~~~~~~R~yS~~s~~---~~~~~~~~~ik~~-~~G~~S   76 (99)
T PF00970_consen   31 KPGQFVSVRVPINGKQVSRPYSPASSP---DDKGYLEFAIKRY-PNGRVS   76 (99)
T ss_dssp             TTT-EEEEEEEETTEEEEEEEEBCSST---TSSSEEEEEEEEC-TTSHHH
T ss_pred             CcceEEEEEEccCCcceecceeEeeec---CCCCcEEEEEEec-cCCHHH
Confidence            35889999888       444444433   3445677777666 455544


No 9  
>PF10114 PocR:  Sensory domain found in PocR;  InterPro: IPR018771 This entry is thought to act as a sensory domain in histidine kinases catalysing the reaction: ATP + protein L-histidine = ADP + protein N- phospho-L-histidine. 
Probab=34.75  E-value=44  Score=22.50  Aligned_cols=33  Identities=24%  Similarity=0.489  Sum_probs=26.6

Q ss_pred             eeCceeEEEEehhhhhcccchHH--HHHHHHhccc
Q 034808           45 YTGQFSTFALCGFVRAQGDGDSA--IDRLWQKKKV   77 (82)
Q Consensus        45 ~tg~~~t~ai~G~iR~~GesD~~--l~rL~~~~~~   77 (82)
                      +.|+..-|.++|.++-....++.  +.+++++.++
T Consensus        93 ~~g~~iG~i~~G~v~~~~~~~~~~~~~~~a~~~~~  127 (173)
T PF10114_consen   93 VDGEYIGYIICGQVLLEDPDDESELIRELAKKYGI  127 (173)
T ss_pred             ECCEEEEEEEEEEeecCCCchhHHHHHHHHHHcCC
Confidence            45677778999999998888877  8888887665


No 10 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=29.50  E-value=24  Score=21.13  Aligned_cols=19  Identities=26%  Similarity=0.705  Sum_probs=11.2

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      .|.++|.+  ..+.+|+++.|
T Consensus        78 ~C~a~N~~--G~~~~s~~l~v   96 (96)
T cd05732          78 DCEASNRI--GGDQQSMYLEV   96 (96)
T ss_pred             EEEEEeCC--CCcEEEEEEeC
Confidence            57777765  23466666553


No 11 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=29.37  E-value=26  Score=21.53  Aligned_cols=20  Identities=40%  Similarity=0.549  Sum_probs=14.0

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      +|.++|..-. +..+||.+.|
T Consensus        73 ~C~A~N~~g~-~~~~sv~l~~   92 (92)
T cd04977          73 KCVATDAKGT-ESEATVNLKI   92 (92)
T ss_pred             EEEEEcCCCC-cceeEEEEEC
Confidence            6999997644 5567777754


No 12 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=26.40  E-value=28  Score=20.12  Aligned_cols=19  Identities=21%  Similarity=0.415  Sum_probs=12.2

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      .|.+.|.+  ..++++++++|
T Consensus        55 ~C~a~N~~--G~~~~~~~l~V   73 (73)
T cd04969          55 TCFAENFF--GKANSTGSLSV   73 (73)
T ss_pred             EEEEECCC--CceEEEEEEEC
Confidence            57777774  44566666654


No 13 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=26.23  E-value=32  Score=21.15  Aligned_cols=19  Identities=21%  Similarity=0.513  Sum_probs=10.6

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      .|.|+|.+=  .+++|++++|
T Consensus        80 ~C~A~N~~G--~~~~~~~l~~   98 (98)
T cd05870          80 DCEAASRIG--GHQKSMYLDI   98 (98)
T ss_pred             EEEEeccCC--cceeEEEEeC
Confidence            466666652  3455666554


No 14 
>smart00634 BID_1 Bacterial Ig-like domain (group 1).
Probab=24.68  E-value=1.6e+02  Score=18.22  Aligned_cols=36  Identities=22%  Similarity=0.205  Sum_probs=26.7

Q ss_pred             CcccCCCCcceEeEeeEeCCCce-eeCceeEEEEehh
Q 034808           22 RLITSKDHAAVQINIGHVDADGI-YTGQFSTFALCGF   57 (82)
Q Consensus        22 riI~akDHaSVQInva~vd~~G~-~tg~~~t~ai~G~   57 (82)
                      .-|.|......+|.+-.+|++|. ..+..-+|.+.|.
T Consensus        10 ~~~~Adg~d~~~i~v~v~D~~Gnpv~~~~V~f~~~~~   46 (92)
T smart00634       10 DTAVANGSDAITLTATVTDANGNPVAGQEVTFTTPSG   46 (92)
T ss_pred             CcEEEcCcccEEEEEEEECCCCCCcCCCEEEEEECCC
Confidence            34566656677888888999887 7788888887754


No 15 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=24.45  E-value=31  Score=19.64  Aligned_cols=19  Identities=21%  Similarity=0.302  Sum_probs=9.6

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      .|.++|..  ..+.++++++|
T Consensus        57 ~C~A~N~~--G~~~~~~~l~V   75 (76)
T cd04978          57 QCNASNVH--GYLLANAFVHV   75 (76)
T ss_pred             EEEEEccC--CeEEEeEEEEE
Confidence            46666652  22345555544


No 16 
>PF07976 Phe_hydrox_dim:  Phenol hydroxylase, C-terminal dimerisation domain ;  InterPro: IPR012941 Phenol hydroxylase is a homodimer which hydroxylates phenol to catechol, or similar products. The enzyme is comprised of three domains. The first two domains form the active site. The third domain, this domain, is involved in forming the dimerisation interface. The domain adopts a thioredoxin-like fold [].; PDB: 2DKH_A 2DKI_A 1PN0_A 1FOH_D.
Probab=24.25  E-value=50  Score=23.28  Aligned_cols=29  Identities=17%  Similarity=0.228  Sum_probs=19.1

Q ss_pred             eeeCceeEEEEehhhhhcccchHHHHHHHH
Q 034808           44 IYTGQFSTFALCGFVRAQGDGDSAIDRLWQ   73 (82)
Q Consensus        44 ~~tg~~~t~ai~G~iR~~GesD~~l~rL~~   73 (82)
                      ..+|+|..|.++|.++.... -..|..|+.
T Consensus        57 ~sdGrfri~vFagd~~~~~~-~~~l~~l~~   85 (169)
T PF07976_consen   57 PSDGRFRILVFAGDISLPEQ-LSRLSALAD   85 (169)
T ss_dssp             -SSS-EEEEEEEETTTTCHC-CCHHHHHHH
T ss_pred             ccCCCEEEEEEeCCCccchh-HHHHHHHHH
Confidence            35789999999999999443 244555443


No 17 
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=23.40  E-value=93  Score=22.18  Aligned_cols=21  Identities=38%  Similarity=0.782  Sum_probs=13.5

Q ss_pred             EeEeeEeCCCceeeCceeEEEEehh
Q 034808           33 QINIGHVDADGIYTGQFSTFALCGF   57 (82)
Q Consensus        33 QInva~vd~~G~~tg~~~t~ai~G~   57 (82)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        43 ~V~V~Nv~-NG---~Rf~TYvI~G~   63 (126)
T TIGR00223        43 KVDIVNVN-NG---KRFSTYAIAGK   63 (126)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44455555 44   35789999875


No 18 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=23.25  E-value=55  Score=20.54  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             eeccccCcCCcccCCCCc
Q 034808           13 IPRKCSATNRLITSKDHA   30 (82)
Q Consensus        13 iPRKCS~TnriI~akDHa   30 (82)
                      -|.+|+..|+.|+..+++
T Consensus         6 ~~~~CtSCg~~i~~~~~~   23 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKA   23 (59)
T ss_pred             cCccccCCCCcccCCCcc
Confidence            477999999999999986


No 19 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=22.45  E-value=42  Score=21.47  Aligned_cols=20  Identities=30%  Similarity=0.516  Sum_probs=14.4

Q ss_pred             cccCcCCcccCCCCcceEeEee
Q 034808           16 KCSATNRLITSKDHAAVQINIG   37 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInva   37 (82)
                      .|.|+|.+  ..|.+++|+.+.
T Consensus        86 ~C~A~N~~--G~~~~~i~L~~~  105 (109)
T cd05773          86 TCTAHNSL--GEDSLDIQLVST  105 (109)
T ss_pred             EEEEEeCC--ccCcEEEEEEec
Confidence            58888877  446777777765


No 20 
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=22.15  E-value=1e+02  Score=21.94  Aligned_cols=21  Identities=29%  Similarity=0.706  Sum_probs=13.4

Q ss_pred             EeEeeEeCCCceeeCceeEEEEehh
Q 034808           33 QINIGHVDADGIYTGQFSTFALCGF   57 (82)
Q Consensus        33 QInva~vd~~G~~tg~~~t~ai~G~   57 (82)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        43 ~V~V~Nv~-NG---~Rf~TYvI~g~   63 (126)
T PRK05449         43 KVQIVNVN-NG---ARFETYVIAGE   63 (126)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44455554 44   35789999875


No 21 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=21.54  E-value=56  Score=20.78  Aligned_cols=24  Identities=25%  Similarity=0.444  Sum_probs=18.8

Q ss_pred             eeeeeeccccCcCCcccCCCCcce
Q 034808            9 MDLYIPRKCSATNRLITSKDHAAV   32 (82)
Q Consensus         9 VDlYiPRKCS~TnriI~akDHaSV   32 (82)
                      +....|..|+..++.|+.-.++++
T Consensus         4 ~~~~~~~~CtSCg~~i~p~e~~v~   27 (61)
T COG2888           4 MEMKDPPVCTSCGREIAPGETAVK   27 (61)
T ss_pred             ccccCCceeccCCCEeccCCceeE
Confidence            334459999999999988887753


No 22 
>PRK00042 tpiA triosephosphate isomerase; Provisional
Probab=21.21  E-value=1.5e+02  Score=22.55  Aligned_cols=49  Identities=18%  Similarity=0.437  Sum_probs=34.3

Q ss_pred             cceEeEeeEeCC--CceeeCcee---------EEEEehhhhh---cccchHHHHH---HHHhcccc
Q 034808           30 AAVQINIGHVDA--DGIYTGQFS---------TFALCGFVRA---QGDGDSAIDR---LWQKKKVE   78 (82)
Q Consensus        30 aSVQInva~vd~--~G~~tg~~~---------t~ai~G~iR~---~GesD~~l~r---L~~~~~~~   78 (82)
                      ..+.+---+++.  .|.|||+..         .|+|-|-=-|   .||+|+.+++   .|.+.|+.
T Consensus        56 ~~i~vgAQn~~~~~~Ga~TGevS~~mLkd~G~~~viiGHSERR~~f~Etd~~v~~K~~~a~~~gl~  121 (250)
T PRK00042         56 SNIKLGAQNVHPEDSGAFTGEISAEMLKDLGVKYVIIGHSERRQYFGETDELVNKKVKAALKAGLT  121 (250)
T ss_pred             CCeEEEecccccccCCCccCccCHHHHHHCCCCEEEeCcccccCccCcCHHHHHHHHHHHHHCCCE
Confidence            356666666776  699999974         5666665443   3999999998   55667764


No 23 
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]
Probab=21.18  E-value=61  Score=26.58  Aligned_cols=57  Identities=19%  Similarity=0.202  Sum_probs=37.2

Q ss_pred             ccCce--eeeeeeccccCcCCcccCCCCcceEeEeeEeCC--CceeeCceeEEEEehhhhhcccc
Q 034808            4 EEGQN--MDLYIPRKCSATNRLITSKDHAAVQINIGHVDA--DGIYTGQFSTFALCGFVRAQGDG   64 (82)
Q Consensus         4 d~g~~--VDlYiPRKCS~TnriI~akDHaSVQInva~vd~--~G~~tg~~~t~ai~G~iR~~Ges   64 (82)
                      |+|.+  -|+=||-+|.|+|.-+.    .|=-..|-.-.+  .=.+||++.-+.-.=..|.||+.
T Consensus       186 DD~~l~~~D~R~p~~~i~~n~kvH----~~GV~SI~ss~~~~~~I~TGsYDe~i~~~DtRnm~kP  246 (339)
T KOG0280|consen  186 DDGSLSCWDIRIPKTFIWHNSKVH----TSGVVSIYSSPPKPTYIATGSYDECIRVLDTRNMGKP  246 (339)
T ss_pred             CCceEEEEEecCCcceeeecceee----ecceEEEecCCCCCceEEEeccccceeeeehhcccCc
Confidence            34444  47889999999987664    443333333343  45678888776666677888873


No 24 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=20.36  E-value=47  Score=20.19  Aligned_cols=19  Identities=16%  Similarity=0.408  Sum_probs=13.6

Q ss_pred             cccCcCCcccCCCCcceEeEe
Q 034808           16 KCSATNRLITSKDHAAVQINI   36 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInv   36 (82)
                      +|.|+|.+  ..+.++.++.|
T Consensus        63 tC~A~n~~--g~~~~~~~L~V   81 (85)
T cd05854          63 TCTAQTVV--DSASASATLVV   81 (85)
T ss_pred             EEEEecCC--CCEEEEEEEEE
Confidence            69999966  45666666665


No 25 
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=20.12  E-value=1.2e+02  Score=21.14  Aligned_cols=21  Identities=24%  Similarity=0.577  Sum_probs=13.2

Q ss_pred             EeEeeEeCCCceeeCceeEEEEehh
Q 034808           33 QINIGHVDADGIYTGQFSTFALCGF   57 (82)
Q Consensus        33 QInva~vd~~G~~tg~~~t~ai~G~   57 (82)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        42 ~V~I~Nv~-NG---~Rf~TYvI~g~   62 (111)
T cd06919          42 KVLVVNVN-NG---ARFETYVIPGE   62 (111)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44445554 44   35789999874


No 26 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=20.00  E-value=49  Score=19.59  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=13.9

Q ss_pred             cccCcCCcccCCCCcceEeEee
Q 034808           16 KCSATNRLITSKDHAAVQINIG   37 (82)
Q Consensus        16 KCS~TnriI~akDHaSVQInva   37 (82)
                      +|.++|.+  ..+.++.+++|.
T Consensus        63 ~C~a~n~~--g~~~~~~~l~V~   82 (85)
T cd04970          63 TCTAQTVV--DSLSASADLIVR   82 (85)
T ss_pred             EEEEecCC--CcEEEEEEEEEE
Confidence            69999966  335667777664


Done!